Q9BYM8 (HOIL1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
December 14, 2011.
Version 107.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: RanBP-type and C3HC4-type zinc finger-containing protein 1 EC=6.3.2.- Alternative name(s): HBV-associated factor 4 Heme-oxidized IRP2 ubiquitin ligase 1 Short name=HOIL-1 Hepatitis B virus X-associated protein 4 RING finger protein 54 Ubiquitin-conjugating enzyme 7-interacting protein 3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 510 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | E3 ubiquitin-protein ligase, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, such as UBE2L3/UBCM4, and then transfers it to substrates. Functions as an E3 ligase for oxidized IREB2 and both heme and oxygen are necessary for IREB2 ubiquitination. Promotes ubiquitination of TAB2 and IRF3 and their degradation by the proteasome. Component of the LUBAC complex which conjugates linear polyubiquitin chains in a head-to-tail manner to substrates and plays a key role in NF-kappa-B activation and regulation of inflammation. LUBAC conjugates linear polyubiquitin to IKBKG and RIPK1 and is involved in activation of the canonical NF-kappa-B and the JNK signaling pathways. Linear ubiquitination mediated by the LUBAC complex interferes with TNF-induced cell death and thereby prevents inflammation. LUBAC is proposed to be recruited to the TNF-R1 signaling complex (TNF-RSC) following polyubiquitination of TNF-RSC components by BIRC2 and/or BIRC3 and to conjugate linear polyubiquitin to IKBKG and possibly other components contributing to the stability of the complex. Binds polyubiquitin of different linkage types. Ref.2 Ref.7 Ref.8 Ref.10 Ref.12 Ref.13 Ref.14 Ref.15 Ref.16 |
| Subunit structure | Forms homodimers in vitro By similarity. Component of the LUBAC complex (linear ubiquitin chain assembly complex) which consists of SHARPIN, RBCK1 and RNF31. LUBAC has a MW of approximative 600 kDa suggesting a heteromultimeric assembly of its subunits. Interacts with beta-I-type (PRKCB1) and zeta-type protein kinase C (PRKCZ) and with UBE2L3. Interacts with PRKCH. Interacts with the HBV pX/HBx protein, which is required to activate transcription of the viral genome. Isoform 1 and isoform 2 interact with IREB2 only in iron-rich conditions. Associates with the TNF-R1 signaling complex (TNF-RSC) in a stimulation-dependent manner. Interacts with EYA1, TAB2, TAB3, MAP3K7 TRAF6 and RIPK1. Interacts with IRF3. Ref.1 Ref.2 Ref.8 Ref.10 |
| Induction | By viral transfection. Ref.10 |
| Domain | The RanBP2-type zinc fingers mediate the specific interaction with ubiquitin. Ref.16 |
| Post-translational modification | Auto-ubiquitinated. Auto-ubiquitination leads to degradation by the proteasome By similarity. Phosphorylated. In vitro, phosphorylation inhibits auto-ubiquitination activity By similarity. Ref.6 Ref.9 Ref.11 |
| Sequence similarities | Contains 1 B box-type zinc finger. Contains 2 IBR-type zinc fingers. Contains 1 RanBP2-type zinc finger. Contains 1 RING-type zinc finger. Contains 1 ubiquitin-like domain. |
| Sequence caution | The sequence AAH15219.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q9BYM8-1) Also known as: HOIL-1L; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BYM8-3) The sequence of this isoform differs from the canonical sequence as follows: 1-55: MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDI → MGTATPDGREDQE | ||||||
| Isoform 3 (identifier: Q9BYM8-4) The sequence of this isoform differs from the canonical sequence as follows: 1-55: MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDI → MGTATPDGREDQE 253-272: RKQQQQEGNYLQHVQLDQRS → GVPAGHHPQQPGGGGLLPLH 273-510: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||
Molecule processing | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 510 | 510 | RanBP-type and C3HC4-type zinc finger-containing protein 1 | PRO_0000056295 | |||||||||||
Regions | |||||||||||||||
| Domain | 55 – 119 | 65 | Ubiquitin-like | ||||||||||||
| Zinc finger | 193 – 222 | 30 | RanBP2-type | ||||||||||||
| Zinc finger | 282 – 327 | 46 | RING-type | ||||||||||||
| Zinc finger | 362 – 411 | 50 | IBR-type 1 | ||||||||||||
| Zinc finger | 376 – 411 | 36 | B box-type | ||||||||||||
| Zinc finger | 440 – 476 | 37 | IBR-type 2 | ||||||||||||
| Region | 1 – 270 | 270 | Interaction with TAB2 | ||||||||||||
| Region | 1 – 220 | 220 | Interaction with IRF3 | ||||||||||||
| Region | 69 – 131 | 63 | Interaction with RNF31 | ||||||||||||
| Coiled coil | 233 – 261 | 29 | Potential | ||||||||||||
Amino acid modifications | |||||||||||||||
| Modified residue | 330 | 1 | Phosphotyrosine Ref.6 Ref.9 Ref.11 | ||||||||||||
Natural variations | |||||||||||||||
| Alternative sequence | 1 – 55 | 55 | MDEKT…PTQDI → MGTATPDGREDQE in isoform 2 and isoform 3. | VSP_005766 | |||||||||||
| Alternative sequence | 253 – 272 | 20 | RKQQQ…LDQRS → GVPAGHHPQQPGGGGLLPLH in isoform 3. | VSP_005767 | |||||||||||
| Alternative sequence | 273 – 510 | 238 | Missing in isoform 3. | VSP_005768 | |||||||||||
Experimental info | |||||||||||||||
| Mutagenesis | 282 | 1 | C → S: Binds to IREB2 in iron-treated cells. Reversed iron-induced down-regulation of IREB2. No ubiquitination of heme-loaded IREB2; when associated with S-285. Ref.2 | ||||||||||||
| Mutagenesis | 285 | 1 | C → S: Binds to IREB2 in iron-treated cells. Reversed iron-induced down-regulation of IREB2. No ubiquitination of heme-loaded IREB2; when associated with S-282. Ref.2 | ||||||||||||
| Sequence conflict | 236 | 1 | E → D in BAC75409. Ref.2 | ||||||||||||
Secondary structure | |||||||||||||||
Helix Strand Turn | |||||||||||||||
| Beta strand | 184 – 187 | 4 | |||||||||||||
| Turn | 190 – 192 | 3 | |||||||||||||
| Beta strand | 204 – 206 | 3 | |||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The hepatitis B virus X-associated protein, XAP3, is a protein kinase C-binding protein." Cong Y.-S., Yao Y.-L., Yang W.-M., Kuzhandaivelu N., Seto E. J. Biol. Chem. 272:16482-16489(1997) [PubMed: 9195957] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), INTERACTION WITH PRKCH AND PX OF HBV. |
| [2] | "Identification of the ubiquitin-protein ligase that recognizes oxidized IRP2." Yamanaka K., Ishikawa H., Megumi Y., Tokunaga F., Kanie M., Rouault T.A., Morishima I., Minato N., Ishimori K., Iwai K. Nat. Cell Biol. 5:336-340(2003) [PubMed: 12629548] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH IREB2, MUTAGENESIS OF CYS-282 AND CYS-285. Tissue: Kidney adenocarcinoma. |
| [3] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3). Tissue: Lung and Placenta. |
| [5] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:R8.1-R8.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [6] | "Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules." Zhang Y., Wolf-Yadlin A., Ross P.L., Pappin D.J., Rush J., Lauffenburger D.A., White F.M. Mol. Cell. Proteomics 4:1240-1250(2005) [PubMed: 15951569] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-330, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [7] | "A ubiquitin ligase complex assembles linear polyubiquitin chains." Kirisako T., Kamei K., Murata S., Kato M., Fukumoto H., Kanie M., Sano S., Tokunaga F., Tanaka K., Iwai K. EMBO J. 25:4877-4887(2006) [PubMed: 17006537] [Abstract] Cited for: IDENTIFICATION IN THE LUBAC COMPLEX, FUNCTION OF THE LUBAC COMPLEX. |
| [8] | "RBCK1 negatively regulates tumor necrosis factor- and interleukin-1-triggered NF-kappaB activation by targeting TAB2/3 for degradation." Tian Y., Zhang Y., Zhong B., Wang Y.Y., Diao F.C., Wang R.P., Zhang M., Chen D.Y., Zhai Z.H., Shu H.B. J. Biol. Chem. 282:16776-16782(2007) [PubMed: 17449468] [Abstract] Cited for: FUNCTION, INTERACTION WITH TAB2; TAB3; MAP3K7; TRAF6 AND RIPK1. |
| [9] | "Multiple reaction monitoring for robust quantitative proteomic analysis of cellular signaling networks." Wolf-Yadlin A., Hautaniemi S., Lauffenburger D.A., White F.M. Proc. Natl. Acad. Sci. U.S.A. 104:5860-5865(2007) [PubMed: 17389395] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-330, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [10] | "Negative feedback regulation of cellular antiviral signaling by RBCK1-mediated degradation of IRF3." Zhang M., Tian Y., Wang R.P., Gao D., Zhang Y., Diao F.C., Chen D.Y., Zhai Z.H., Shu H.B. Cell Res. 18:1096-1104(2008) [PubMed: 18711448] [Abstract] Cited for: FUNCTION, INDUCTION, INTERACTION WITH IRF3. |
| [11] | "An extensive survey of tyrosine phosphorylation revealing new sites in human mammary epithelial cells." Heibeck T.H., Ding S.-J., Opresko L.K., Zhao R., Schepmoes A.A., Yang F., Tolmachev A.V., Monroe M.E., Camp D.G. II, Smith R.D., Wiley H.S., Qian W.-J. J. Proteome Res. 8:3852-3861(2009) [PubMed: 19534553] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-330, MASS SPECTROMETRY. Tissue: Mammary epithelium. |
| [12] | "Recruitment of the linear ubiquitin chain assembly complex stabilizes the TNF-R1 signaling complex and is required for TNF-mediated gene induction." Haas T.L., Emmerich C.H., Gerlach B., Schmukle A.C., Cordier S.M., Rieser E., Feltham R., Vince J., Warnken U., Wenger T., Koschny R., Komander D., Silke J., Walczak H. Mol. Cell 36:831-844(2009) [PubMed: 20005846] [Abstract] Cited for: MASS SPECTROMETRY, POLYUBIQUITIN-BINDING, FUNCTION OF THE LUBAC COMPLEX, ASSOCIATION WITH TNF-RSC. |
| [13] | "Involvement of linear polyubiquitylation of NEMO in NF-kappaB activation." Tokunaga F., Sakata S., Saeki Y., Satomi Y., Kirisako T., Kamei K., Nakagawa T., Kato M., Murata S., Yamaoka S., Yamamoto M., Akira S., Takao T., Tanaka K., Iwai K. Nat. Cell Biol. 11:123-132(2009) [PubMed: 19136968] [Abstract] Cited for: FUNCTION OF THE LUBAC COMPLEX. |
| [14] | "Linear ubiquitination prevents inflammation and regulates immune signalling." Gerlach B., Cordier S.M., Schmukle A.C., Emmerich C.H., Rieser E., Haas T.L., Webb A.I., Rickard J.A., Anderton H., Wong W.W., Nachbur U., Gangoda L., Warnken U., Purcell A.W., Silke J., Walczak H. Nature 471:591-596(2011) [PubMed: 21455173] [Abstract] Cited for: IDENTIFICATION IN THE LUBAC COMPLEX, FUNCTION. |
| [15] | "SHARPIN is a component of the NF-kappaB-activating linear ubiquitin chain assembly complex." Tokunaga F., Nakagawa T., Nakahara M., Saeki Y., Taniguchi M., Sakata S., Tanaka K., Nakano H., Iwai K. Nature 471:633-636(2011) [PubMed: 21455180] [Abstract] Cited for: IDENTIFICATION IN THE LUBAC COMPLEX, FUNCTION. |
| [16] | "SHARPIN forms a linear ubiquitin ligase complex regulating NF-kappaB activity and apoptosis." Ikeda F., Deribe Y.L., Skanland S.S., Stieglitz B., Grabbe C., Franz-Wachtel M., van Wijk S.J., Goswami P., Nagy V., Terzic J., Tokunaga F., Androulidaki A., Nakagawa T., Pasparakis M., Iwai K., Sundberg J.P., Schaefer L., Rittinger K., Macek B., Dikic I. Nature 471:637-641(2011) [PubMed: 21455181] [Abstract] Cited for: IDENTIFICATION IN THE LUBAC COMPLEX, FUNCTION, DOMAIN RANBP2-TYPE, UBIQUITIN-BINDING. |
| [17] | "Solution structure of the ZF-RANBP domain of the protein HBV associated factor." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 184-222. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U67322 mRNA. Translation: AAD00162.1. AB107766 mRNA. Translation: BAC75409.1. AL121747 Genomic DNA. Translation: CAC17516.1. AL121747 Genomic DNA. Translation: CAC28312.2. BC000983 mRNA. No translation available. BC015219 mRNA. Translation: AAH15219.2. Different initiation. | ||||||||||||
| IPI | IPI00010748. IPI00220104. IPI00783058. | ||||||||||||
| RefSeq | NP_006453.1. NM_006462.4. NP_112506.2. NM_031229.2. | ||||||||||||
| UniGene | Hs.247280. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9BYM8. | ||||||||||||
| SMR | Q9BYM8. Positions 54-130, 194-232, 277-412, 441-495. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9BYM8. 10 interactions. | ||||||||||||
| MINT | MINT-6768751. | ||||||||||||
| STRING | Q9BYM8. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9BYM8. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 166214993. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q9BYM8. | ||||||||||||
Protocols and materials databases | |||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000356286; ENSP00000348632; ENSG00000125826. | ||||||||||||
| GeneID | 10616. | ||||||||||||
| KEGG | hsa:10616. | ||||||||||||
| UCSC | uc002wdp.2. human. uc002wdq.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 10616. | ||||||||||||
| GeneCards | GC20P000388. | ||||||||||||
| H-InvDB | HIX0015553. | ||||||||||||
| HGNC | HGNC:15864. RBCK1. | ||||||||||||
| HPA | HPA024185. | ||||||||||||
| MIM | 610924. gene. | ||||||||||||
| neXtProt | NX_Q9BYM8. | ||||||||||||
| PharmGKB | PA25723. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | prNOG09358. | ||||||||||||
| GeneTree | ENSGT00530000063620. | ||||||||||||
| HOGENOM | HBG446806. | ||||||||||||
| HOVERGEN | HBG061515. | ||||||||||||
| InParanoid | Q9BYM8. | ||||||||||||
| OMA | TQDIRLW. | ||||||||||||
| PhylomeDB | Q9BYM8. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Reactome | REACT_6900. Immune System. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9BYM8. | ||||||||||||
| Bgee | Q9BYM8. | ||||||||||||
| CleanEx | HS_RBCK1. | ||||||||||||
| Genevestigator | Q9BYM8. | ||||||||||||
| GermOnline | ENSG00000125826. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR019955. Ubiquitin_supergroup. IPR002867. Znf_C6HC. IPR001876. Znf_RanBP2. IPR001841. Znf_RING. IPR013083. Znf_RING/FYVE/PHD. IPR017907. Znf_RING_CS. [Graphical view] | ||||||||||||
| Gene3D | G3DSA:3.30.40.10. Znf_RING/FYVE/PHD. 1 hit. | ||||||||||||
| KO | K10630. | ||||||||||||
| Pfam | PF01485. IBR. 2 hits. [Graphical view] | ||||||||||||
| SMART | SM00184. RING. 1 hit. SM00547. ZnF_RBZ. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50053. UBIQUITIN_2. 1 hit. PS50119. ZF_BBOX. False negative. PS01358. ZF_RANBP2_1. 1 hit. PS50199. ZF_RANBP2_2. 1 hit. PS00518. ZF_RING_1. 1 hit. PS50089. ZF_RING_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| NextBio | 40334. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | HOIL1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BYM8 Secondary accession number(s): O95623 Q9BYM9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with