Reviewed,
UniProtKB/Swiss-Prot Q9BYM8 (UB7I3_HUMAN)
Last modified
June 16, 2009.
Version 84.
History...
Clusters with 100%,
90%,
50% identity |
Documents (4) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: RanBP-type and C3HC4-type zinc finger-containing protein 1 Alternative name(s): Ubiquitin-conjugating enzyme 7-interacting protein 3 Hepatitis B virus X-associated protein 4 HBV-associated factor 4 RING finger protein 54 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 510 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Might act as an E3 ubiquitin-protein ligase, or as part of the E3 complex, which accepts ubiquitin from specific E2 ubiquitin-conjugating enzymes, such as UBE2L3/UBCM4, and then transfers it to substrates. |
| Subunit structure | Interacts with beta-I-type (PRKCB1) and zeta-type protein kinase C (PRKCZ) and with UBE2L3. Forms homodimers in vitro By similarity. Interacts with PRKCH. Interacts with the HBV pX/HBx protein, which is required to activate transcription of the viral genome. |
| Post-translational modification | Phosphorylated By similarity. |
| Sequence similarities | Contains 1 B box-type zinc finger. Contains 1 RanBP2-type zinc finger. Contains 1 RING-type zinc finger. Contains 1 ubiquitin-like domain. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Host-virus interaction Ubl conjugation pathway |
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil Zinc-finger |
| Ligand | Metal-binding Zinc |
| PTM | Phosphoprotein |
| Technical term | 3D-structure |
| Gene Ontology (GO) | |
| Biological process | interspecies interaction between organisms Inferred from electronic annotation. Source: UniProtKB-KW modification-dependent protein catabolic processInferred from electronic annotation. Source: UniProtKB-KW |
| Cellular component | intracellular Inferred from electronic annotation. Source: InterPro |
| Molecular function | protein binding Inferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] Note: Experimental confirmation may be lacking for some isoforms. | ||||||
| Isoform 1 (identifier: Q9BYM8-1) Also known as: RBCK1; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 3 (identifier: Q9BYM8-3) The sequence of this isoform differs from the canonical sequence as follows: 1-55: MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDI → MGTATPDGREDQE | ||||||
| Isoform 4 (identifier: Q9BYM8-4) The sequence of this isoform differs from the canonical sequence as follows: 1-55: MDEKTKKAEEMALSLTRAVAGGDEQVAMKCAIWLAEQRVPLSVQLKPEVSPTQDI → MGTATPDGREDQE 253-272: RKQQQQEGNYLQHVQLDQRS → GVPAGHHPQQPGGGGLLPLH 273-510: Missing. | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||
Molecule processing | |||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 510 | 510 | RanBP-type and C3HC4-type zinc finger-containing protein 1 | PRO_0000056295 | |||||||||||
Regions | |||||||||||||||
| Domain | 55 – 119 | 65 | Ubiquitin-like | ||||||||||||
| Zinc finger | 193 – 222 | 30 | RanBP2-type | ||||||||||||
| Zinc finger | 282 – 327 | 46 | RING-type | ||||||||||||
| Zinc finger | 376 – 411 | 36 | B box-type | ||||||||||||
| Zinc finger | 447 – 473 | 27 | B box-like-type | ||||||||||||
| Coiled coil | 233 – 261 | 29 | Potential | ||||||||||||
Amino acid modifications | |||||||||||||||
| Modified residue | 330 | 1 | Phosphotyrosine Ref.5 | ||||||||||||
Natural variations | |||||||||||||||
| Alternative sequence | 1 – 55 | 55 | MDEKT…PTQDI → MGTATPDGREDQE in isoform 3 and isoform 4. | VSP_005766 | |||||||||||
| Alternative sequence | 253 – 272 | 20 | RKQQQ…LDQRS → GVPAGHHPQQPGGGGLLPLH in isoform 4. | VSP_005767 | |||||||||||
| Alternative sequence | 273 – 510 | 238 | Missing in isoform 4. | VSP_005768 | |||||||||||
Secondary structure | |||||||||||||||
Helix Strand Turn | |||||||||||||||
| Beta strand | 184 – 187 | 4 | |||||||||||||
| Turn | 190 – 192 | 3 | |||||||||||||
| Beta strand | 204 – 206 | 3 | |||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "The hepatitis B virus X-associated protein, XAP3, is a protein kinase C-binding protein." Cong Y.-S., Yao Y.-L., Yang W.-M., Kuzhandaivelu N., Seto E. J. Biol. Chem. 272:16482-16489(1997) [PubMed: 9195957] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), INTERACTION WITH PRKCH AND PX OF HBV. |
| [2] | "The DNA sequence and comparative analysis of human chromosome 20." Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E. Rogers J.Nature 414:865-871(2001) [PubMed: 11780052] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4). Tissue: Lung and Placenta. |
| [4] | "An unappreciated role for RNA surveillance." Hillman R.T., Green R.E., Brenner S.E. Genome Biol. 5:RESEARCH008.1-RESEARCH008.16(2004) [PubMed: 14759258] [Abstract] Cited for: SPLICE ISOFORM(S) THAT ARE POTENTIAL NMD TARGET(S). |
| [5] | "Time-resolved mass spectrometry of tyrosine phosphorylation sites in the epidermal growth factor receptor signaling network reveals dynamic modules." Zhang Y., Wolf-Yadlin A., Ross P.L., Pappin D.J., Rush J., Lauffenburger D.A., White F.M. Mol. Cell. Proteomics 4:1240-1250(2005) [PubMed: 15951569] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT TYR-330, MASS SPECTROMETRY. Tissue: Epithelium. |
| [6] | "Solution structure of the ZF-RANBP domain of the protein HBV associated factor." RIKEN structural genomics initiative (RSGI) Submitted (NOV-2005) to the PDB data bank Cited for: STRUCTURE BY NMR OF 184-222. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| U67322 mRNA. Translation: AAD00162.1. AL121747 Genomic DNA. Translation: CAC17516.1. AL121747 Genomic DNA. Translation: CAC28312.2. BC000983 mRNA. Translation: AAH00983.3. BC015219 mRNA. Translation: AAH15219.2. Different initiation. | |||||||||||||
| IPI | IPI00010748. IPI00220104. IPI00783058. | ||||||||||||
| RefSeq | NP_112506.2. | ||||||||||||
| UniGene | Hs.247280 | ||||||||||||
3D structure databases | |||||||||||||
| |||||||||||||
| ModBase | Search... | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9BYM8. | ||||||||||||
Proteomic databases | |||||||||||||
| PRIDE | Q9BYM8. | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENSG00000125826. Homo sapiens. [Contig view] | ||||||||||||
| GeneID | 10616. | ||||||||||||
Organism-specific databases | |||||||||||||
| GeneCards | GC20P000337. | ||||||||||||
| H-InvDB | HIX0015553. | ||||||||||||
| HGNC | HGNC:15864. RBCK1. | ||||||||||||
| MIM | 610924. gene. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| HOGENOM | Q9BYM8. | ||||||||||||
| HOVERGEN | Q9BYM8. | ||||||||||||
| OMA | Q9BYM8. TQDIRLW. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9BYM8. | ||||||||||||
| Bgee | Q9BYM8. | ||||||||||||
| CleanEx | HS_RBCK1. | ||||||||||||
| GermOnline | ENSG00000125826. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| InterPro | IPR019955. Ubiquitin_supergroup. IPR018957. Znf_C3HC4_RING-type. IPR001876. Znf_RanBP2. IPR001841. Znf_RING. IPR017907. Znf_RING_CS. [Graphical view] | ||||||||||||
| Pfam | PF00097. zf-C3HC4. 1 hit. PF00641. zf-RanBP. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00184. RING. 1 hit. SM00547. ZnF_RBZ. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50053. UBIQUITIN_2. 1 hit. PS50119. ZF_BBOX. False negative. PS01358. ZF_RANBP2_1. 1 hit. PS50199. ZF_RANBP2_2. 1 hit. PS00518. ZF_RING_1. 1 hit. PS50089. ZF_RING_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other Resources | |||||||||||||
| NextBio | 40334. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | UB7I3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BYM8 Secondary accession number(s): O95623, Q96BS3, Q9BYM9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
Relevant documents
| Human chromosome 20 Human chromosome 20: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with


