Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Seizure 6-like protein

Gene

SEZ6L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May contribute to specialized endoplasmic reticulum functions in neurons.By similarity

GO - Biological processi

Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Seizure 6-like protein
Gene namesi
Name:SEZ6L
Synonyms:KIAA0927
ORF Names:UNQ2542/PRO6094
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:10763. SEZ6L.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini29 – 958930ExtracellularSequence analysisAdd
BLAST
Transmembranei959 – 97921HelicalSequence analysisAdd
BLAST
Topological domaini980 – 102445CytoplasmicSequence analysisAdd
BLAST

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA35681.

Polymorphism and mutation databases

BioMutaiSEZ6L.
DMDMi22002000.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2828Sequence analysisAdd
BLAST
Chaini29 – 1024996Seizure 6-like proteinPRO_0000022323Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi49 – 491O-linked (GalNAc...)1 Publication
Disulfide bondi281 ↔ 308By similarity
Glycosylationi311 – 3111N-linked (GlcNAc...)Sequence analysis
Glycosylationi328 – 3281N-linked (GlcNAc...)Sequence analysis
Glycosylationi350 – 3501N-linked (GlcNAc...)Sequence analysis
Disulfide bondi393 ↔ 433By similarity
Disulfide bondi419 ↔ 448By similarity
Glycosylationi435 – 4351N-linked (GlcNAc...)Sequence analysis
Glycosylationi458 – 4581N-linked (GlcNAc...)Sequence analysis
Glycosylationi474 – 4741N-linked (GlcNAc...)Sequence analysis
Glycosylationi514 – 5141N-linked (GlcNAc...)Sequence analysis
Disulfide bondi567 ↔ 609By similarity
Glycosylationi576 – 5761N-linked (GlcNAc...)Sequence analysis
Disulfide bondi594 ↔ 624By similarity
Glycosylationi618 – 6181N-linked (GlcNAc...)Sequence analysis
Glycosylationi674 – 6741N-linked (GlcNAc...)Sequence analysis
Glycosylationi742 – 7421N-linked (GlcNAc...)Sequence analysis
Disulfide bondi745 ↔ 7871 Publication
Disulfide bondi773 ↔ 8001 Publication
Disulfide bondi806 ↔ 848By similarity
Disulfide bondi834 ↔ 865By similarity
Disulfide bondi873 ↔ 915By similarity
Disulfide bondi901 ↔ 930By similarity

Post-translational modificationi

O-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9BYH1.
PRIDEiQ9BYH1.

PTM databases

PhosphoSiteiQ9BYH1.

Expressioni

Tissue specificityi

Widely expressed, including adult and fetal brains and lungs. Not expressed in all lung cancer cell lines.

Gene expression databases

BgeeiQ9BYH1.
ExpressionAtlasiQ9BYH1. baseline and differential.
GenevisibleiQ9BYH1. HS.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000248933.

Structurei

Secondary structure

1
1024
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi754 – 7563Combined sources
Beta strandi759 – 7624Combined sources
Beta strandi768 – 7736Combined sources
Beta strandi777 – 7815Combined sources
Beta strandi783 – 7875Combined sources
Beta strandi793 – 7953Combined sources
Beta strandi799 – 8024Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2YRANMR-A745-802[»]
ProteinModelPortaliQ9BYH1.
SMRiQ9BYH1. Positions 747-802.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9BYH1.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini281 – 389109CUB 1PROSITE-ProRule annotationAdd
BLAST
Domaini391 – 45060Sushi 1PROSITE-ProRule annotationAdd
BLAST
Domaini452 – 562111CUB 2PROSITE-ProRule annotationAdd
BLAST
Domaini565 – 62662Sushi 2PROSITE-ProRule annotationAdd
BLAST
Domaini628 – 739112CUB 3PROSITE-ProRule annotationAdd
BLAST
Domaini743 – 80260Sushi 3PROSITE-ProRule annotationAdd
BLAST
Domaini804 – 86764Sushi 4PROSITE-ProRule annotationAdd
BLAST
Domaini871 – 93262Sushi 5PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni147 – 16115O-glycosylated at one siteAdd
BLAST
Regioni176 – 1805O-glycosylated at one site

Sequence similaritiesi

Belongs to the SEZ6 family.Curated
Contains 3 CUB domains.PROSITE-ProRule annotation
Contains 5 Sushi (CCP/SCR) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Sushi, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJTP. Eukaryota.
ENOG410ZD9C. LUCA.
GeneTreeiENSGT00760000118803.
HOVERGENiHBG057885.
InParanoidiQ9BYH1.
OMAiSEEPLWL.
OrthoDBiEOG7T7GS8.
PhylomeDBiQ9BYH1.
TreeFamiTF330037.

Family and domain databases

Gene3Di2.60.120.290. 3 hits.
InterProiIPR000859. CUB_dom.
IPR000436. Sushi_SCR_CCP_dom.
[Graphical view]
PfamiPF00431. CUB. 2 hits.
PF00084. Sushi. 5 hits.
[Graphical view]
SMARTiSM00032. CCP. 5 hits.
SM00042. CUB. 3 hits.
[Graphical view]
SUPFAMiSSF49854. SSF49854. 3 hits.
SSF57535. SSF57535. 5 hits.
PROSITEiPS01180. CUB. 3 hits.
PS50923. SUSHI. 5 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.

Isoform 4 (identifier: Q9BYH1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPAARPPAAG LRGISLFLAL LLGSPAAALE RDALPEGDAS PLGPYLLPSG
60 70 80 90 100
APERGSPGKE HPEERVVTAP PSSSQSAEVL GELVLDGTAP SAHHDIPALS
110 120 130 140 150
PLLPEEARPK HALPPKKKLP SLKQVNSARK QLRPKATSAA TVQRAGSQPA
160 170 180 190 200
SQGLDLLSSS TEKPGPPGDP DPIVASEEAS EVPLWLDRKE SAVPTTPAPL
210 220 230 240 250
QISPFTSQPY VAHTLPQRPE PGEPGPDMAQ EAPQEDTSPM ALMDKGENEL
260 270 280 290 300
TGSASEESQE TTTSTIITTT VITTEQAPAL CSVSFSNPEG YIDSSDYPLL
310 320 330 340 350
PLNNFLECTY NVTVYTGYGV ELQVKSVNLS DGELLSIRGV DGPTLTVLAN
360 370 380 390 400
QTLLVEGQVI RSPTNTISVY FRTFQDDGLG TFQLHYQAFM LSCNFPRRPD
410 420 430 440 450
SGDVTVMDLH SGGVAHFHCH LGYELQGAKM LTCINASKPH WSSQEPICSA
460 470 480 490 500
PCGGAVHNAT IGRVLSPSYP ENTNGSQFCI WTIEAPEGQK LHLHFERLLL
510 520 530 540 550
HDKDRMTVHS GQTNKSALLY DSLQTESVPF EGLLSEGNTI RIEFTSDQAR
560 570 580 590 600
AASTFNIRFE AFEKGHCYEP YIQNGNFTTS DPTYNIGTIV EFTCDPGHSL
610 620 630 640 650
EQGPAIIECI NVRDPYWNDT EPLCRAMCGG ELSAVAGVVL SPNWPEPYVE
660 670 680 690 700
GEDCIWKIHV GEEKRIFLDI QFLNLSNSDI LTIYDGDEVM PHILGQYLGN
710 720 730 740 750
SGPQKLYSST PDLTIQFHSD PAGLIFGKGQ GFIMNYIEVS RNDSCSDLPE
760 770 780 790 800
IQNGWKTTSH TELVRGARIT YQCDPGYDIV GSDTLTCQWD LSWSSDPPFC
810 820 830 840 850
EKIMYCTDPG EVDHSTRLIS DPVLLVGTTI QYTCNPGFVL EGSSLLTCYS
860 870 880 890 900
RETGTPIWTS RLPHCVSEES LACDNPGLPE NGYQILYKRL YLPGESLTFM
910 920 930 940 950
CYEGFELMGE VTIRCILGQP SHWNGPLPVC KVNQDSFEHA LEVAEAAAET
960 970 980 990 1000
SLEGGNMALA IFIPVLIISL LLGGAYIYIT RCRYYSNLRL PLMYSHPYSQ
1010 1020
ITVETEFDNP IYETGETREY EVSI
Length:1,024
Mass (Da):111,782
Last modified:June 1, 2001 - v1
Checksum:iCBC0679E22C23B6E
GO
Isoform 1 (identifier: Q9BYH1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-227: Missing.
     868-944: Missing.
     1016-1024: ETREYEVSI → GTQKV

Show »
Length:716
Mass (Da):79,048
Checksum:i2D7EB9BFA5255AE6
GO
Isoform 2 (identifier: Q9BYH1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-227: Missing.
     943-943: Missing.
     1016-1024: ETREYEVSI → GTQKV

Show »
Length:792
Mass (Da):87,593
Checksum:i06B56E639B87C01A
GO
Isoform 3 (identifier: Q9BYH1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     803-867: IMYCTDPGEVDHSTRLISDPVLLVGTTIQYTCNPGFVLEGSSLLTCYSRETGTPIWTSRLPHCVS → T
     933-943: Missing.

Show »
Length:949
Mass (Da):103,497
Checksum:i64FACD9450B3F6F3
GO
Isoform 5 (identifier: Q9BYH1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     867-943: SEESLACDNP...QDSFEHALEV → L

Show »
Length:948
Mass (Da):103,234
Checksum:iAC7FE35AA8986926
GO
Isoform 6 (identifier: Q9BYH1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     943-943: Missing.

Show »
Length:1,023
Mass (Da):111,683
Checksum:iF944A3C541880D3A
GO
Isoform 7 (identifier: Q9BYH1-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     933-943: Missing.

Note: No experimental confirmation available.
Show »
Length:1,013
Mass (Da):110,511
Checksum:iE5A684F7BB233D9F
GO

Sequence cautioni

The sequence BAA76771.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti52 – 521P → L.
Corresponds to variant rs6004989 [ dbSNP | Ensembl ].
VAR_043338
Natural varianti185 – 1851W → L.
Corresponds to variant rs137203 [ dbSNP | Ensembl ].
VAR_024348
Natural varianti430 – 4301M → I.1 Publication
Corresponds to variant rs663048 [ dbSNP | Ensembl ].
VAR_020330
Natural varianti671 – 6711Q → H.
Corresponds to variant rs586542 [ dbSNP | Ensembl ].
VAR_043339

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 227227Missing in isoform 1 and isoform 2. 2 PublicationsVSP_003976Add
BLAST
Alternative sequencei803 – 86765IMYCT…PHCVS → T in isoform 3. 1 PublicationVSP_003981Add
BLAST
Alternative sequencei867 – 94377SEESL…HALEV → L in isoform 5. 1 PublicationVSP_013022Add
BLAST
Alternative sequencei868 – 94477Missing in isoform 1. 2 PublicationsVSP_003977Add
BLAST
Alternative sequencei933 – 94311Missing in isoform 3 and isoform 7. 2 PublicationsVSP_003978Add
BLAST
Alternative sequencei943 – 9431Missing in isoform 2 and isoform 6. 2 PublicationsVSP_003979
Alternative sequencei1016 – 10249ETREYEVSI → GTQKV in isoform 1 and isoform 2. 2 PublicationsVSP_003980

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB041736 mRNA. Translation: BAB40970.1.
AB023144 mRNA. Translation: BAA76771.2. Different initiation.
AL035545 mRNA. Translation: CAB37431.1.
AL050253 mRNA. Translation: CAB43355.1.
AY358405 mRNA. Translation: AAQ88771.1.
CR456574 mRNA. Translation: CAG30460.1.
AL022337, AL023513, AL078460 Genomic DNA. Translation: CAI17997.1.
AL078460, AL022337, AL023513 Genomic DNA. Translation: CAI20266.1.
AL023513, AL022337, AL078460 Genomic DNA. Translation: CAI19980.1.
AL023513, AL022337, AL078460 Genomic DNA. Translation: CAQ08922.1.
AL023513, AL022337, AL078460 Genomic DNA. Translation: CAQ08923.1.
AL078460, AL022337, AL023513 Genomic DNA. Translation: CAQ08975.1.
AL078460, AL022337, AL023513 Genomic DNA. Translation: CAQ08976.1.
AL022337, AL023513, AL078460 Genomic DNA. Translation: CAQ10786.1.
AL022337, AL023513, AL078460 Genomic DNA. Translation: CAQ10787.1.
AL080273 Genomic DNA. No translation available.
BC126115 mRNA. Translation: AAI26116.1.
BC143851 mRNA. Translation: AAI43852.1.
CCDSiCCDS13833.1. [Q9BYH1-1]
CCDS54508.1. [Q9BYH1-6]
CCDS54509.1. [Q9BYH1-7]
CCDS54510.1. [Q9BYH1-5]
CCDS54511.1. [Q9BYH1-4]
RefSeqiNP_001171702.1. NM_001184773.1. [Q9BYH1-6]
NP_001171703.1. NM_001184774.1. [Q9BYH1-7]
NP_001171704.1. NM_001184775.1.
NP_001171705.1. NM_001184776.1. [Q9BYH1-4]
NP_001171706.1. NM_001184777.1. [Q9BYH1-5]
NP_066938.2. NM_021115.4. [Q9BYH1-1]
UniGeneiHs.194766.

Genome annotation databases

EnsembliENST00000248933; ENSP00000248933; ENSG00000100095. [Q9BYH1-1]
ENST00000343706; ENSP00000342661; ENSG00000100095. [Q9BYH1-5]
ENST00000360929; ENSP00000354185; ENSG00000100095. [Q9BYH1-4]
ENST00000404234; ENSP00000384772; ENSG00000100095. [Q9BYH1-6]
ENST00000629590; ENSP00000485720; ENSG00000100095. [Q9BYH1-7]
GeneIDi23544.
KEGGihsa:23544.
UCSCiuc003acb.4. human. [Q9BYH1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB041736 mRNA. Translation: BAB40970.1.
AB023144 mRNA. Translation: BAA76771.2. Different initiation.
AL035545 mRNA. Translation: CAB37431.1.
AL050253 mRNA. Translation: CAB43355.1.
AY358405 mRNA. Translation: AAQ88771.1.
CR456574 mRNA. Translation: CAG30460.1.
AL022337, AL023513, AL078460 Genomic DNA. Translation: CAI17997.1.
AL078460, AL022337, AL023513 Genomic DNA. Translation: CAI20266.1.
AL023513, AL022337, AL078460 Genomic DNA. Translation: CAI19980.1.
AL023513, AL022337, AL078460 Genomic DNA. Translation: CAQ08922.1.
AL023513, AL022337, AL078460 Genomic DNA. Translation: CAQ08923.1.
AL078460, AL022337, AL023513 Genomic DNA. Translation: CAQ08975.1.
AL078460, AL022337, AL023513 Genomic DNA. Translation: CAQ08976.1.
AL022337, AL023513, AL078460 Genomic DNA. Translation: CAQ10786.1.
AL022337, AL023513, AL078460 Genomic DNA. Translation: CAQ10787.1.
AL080273 Genomic DNA. No translation available.
BC126115 mRNA. Translation: AAI26116.1.
BC143851 mRNA. Translation: AAI43852.1.
CCDSiCCDS13833.1. [Q9BYH1-1]
CCDS54508.1. [Q9BYH1-6]
CCDS54509.1. [Q9BYH1-7]
CCDS54510.1. [Q9BYH1-5]
CCDS54511.1. [Q9BYH1-4]
RefSeqiNP_001171702.1. NM_001184773.1. [Q9BYH1-6]
NP_001171703.1. NM_001184774.1. [Q9BYH1-7]
NP_001171704.1. NM_001184775.1.
NP_001171705.1. NM_001184776.1. [Q9BYH1-4]
NP_001171706.1. NM_001184777.1. [Q9BYH1-5]
NP_066938.2. NM_021115.4. [Q9BYH1-1]
UniGeneiHs.194766.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2YRANMR-A745-802[»]
ProteinModelPortaliQ9BYH1.
SMRiQ9BYH1. Positions 747-802.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000248933.

PTM databases

PhosphoSiteiQ9BYH1.

Polymorphism and mutation databases

BioMutaiSEZ6L.
DMDMi22002000.

Proteomic databases

PaxDbiQ9BYH1.
PRIDEiQ9BYH1.

Protocols and materials databases

DNASUi23544.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000248933; ENSP00000248933; ENSG00000100095. [Q9BYH1-1]
ENST00000343706; ENSP00000342661; ENSG00000100095. [Q9BYH1-5]
ENST00000360929; ENSP00000354185; ENSG00000100095. [Q9BYH1-4]
ENST00000404234; ENSP00000384772; ENSG00000100095. [Q9BYH1-6]
ENST00000629590; ENSP00000485720; ENSG00000100095. [Q9BYH1-7]
GeneIDi23544.
KEGGihsa:23544.
UCSCiuc003acb.4. human. [Q9BYH1-1]

Organism-specific databases

CTDi23544.
GeneCardsiSEZ6L.
HGNCiHGNC:10763. SEZ6L.
MIMi607021. gene.
neXtProtiNX_Q9BYH1.
PharmGKBiPA35681.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJTP. Eukaryota.
ENOG410ZD9C. LUCA.
GeneTreeiENSGT00760000118803.
HOVERGENiHBG057885.
InParanoidiQ9BYH1.
OMAiSEEPLWL.
OrthoDBiEOG7T7GS8.
PhylomeDBiQ9BYH1.
TreeFamiTF330037.

Miscellaneous databases

ChiTaRSiSEZ6L. human.
EvolutionaryTraceiQ9BYH1.
GeneWikiiSEZ6L.
GenomeRNAii23544.
NextBioi46072.
PROiQ9BYH1.
SOURCEiSearch...

Gene expression databases

BgeeiQ9BYH1.
ExpressionAtlasiQ9BYH1. baseline and differential.
GenevisibleiQ9BYH1. HS.

Family and domain databases

Gene3Di2.60.120.290. 3 hits.
InterProiIPR000859. CUB_dom.
IPR000436. Sushi_SCR_CCP_dom.
[Graphical view]
PfamiPF00431. CUB. 2 hits.
PF00084. Sushi. 5 hits.
[Graphical view]
SMARTiSM00032. CCP. 5 hits.
SM00042. CUB. 3 hits.
[Graphical view]
SUPFAMiSSF49854. SSF49854. 3 hits.
SSF57535. SSF57535. 5 hits.
PROSITEiPS01180. CUB. 3 hits.
PS50923. SUSHI. 5 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a 428-kb homozygously deleted region disrupting the SEZ6L gene at 22q12.1 in a lung cancer cell line."
    Nishioka M., Kohno T., Takahashi M., Niki T., Yamada T., Sone S., Yokota J.
    Oncogene 19:6251-6260(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Brain.
  2. "Prediction of the coding sequences of unidentified human genes. XIII. The complete sequences of 100 new cDNA clones from brain which code for large proteins in vitro."
    Nagase T., Ishikawa K., Suyama M., Kikuno R., Hirosawa M., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 6:63-70(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Brain.
  3. "Reevaluating human gene annotation: a second-generation analysis of chromosome 22."
    Collins J.E., Goward M.E., Cole C.G., Smink L.J., Huckle E.J., Knowles S., Bye J.M., Beare D.M., Dunham I.
    Genome Res. 13:27-36(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Fetal brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 6).
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 5).
  6. "The DNA sequence of human chromosome 22."
    Dunham I., Hunt A.R., Collins J.E., Bruskiewich R., Beare D.M., Clamp M., Smink L.J., Ainscough R., Almeida J.P., Babbage A.K., Bagguley C., Bailey J., Barlow K.F., Bates K.N., Beasley O.P., Bird C.P., Blakey S.E., Bridgeman A.M.
    , Buck D., Burgess J., Burrill W.D., Burton J., Carder C., Carter N.P., Chen Y., Clark G., Clegg S.M., Cobley V.E., Cole C.G., Collier R.E., Connor R., Conroy D., Corby N.R., Coville G.J., Cox A.V., Davis J., Dawson E., Dhami P.D., Dockree C., Dodsworth S.J., Durbin R.M., Ellington A.G., Evans K.L., Fey J.M., Fleming K., French L., Garner A.A., Gilbert J.G.R., Goward M.E., Grafham D.V., Griffiths M.N.D., Hall C., Hall R.E., Hall-Tamlyn G., Heathcott R.W., Ho S., Holmes S., Hunt S.E., Jones M.C., Kershaw J., Kimberley A.M., King A., Laird G.K., Langford C.F., Leversha M.A., Lloyd C., Lloyd D.M., Martyn I.D., Mashreghi-Mohammadi M., Matthews L.H., Mccann O.T., Mcclay J., Mclaren S., McMurray A.A., Milne S.A., Mortimore B.J., Odell C.N., Pavitt R., Pearce A.V., Pearson D., Phillimore B.J.C.T., Phillips S.H., Plumb R.W., Ramsay H., Ramsey Y., Rogers L., Ross M.T., Scott C.E., Sehra H.K., Skuce C.D., Smalley S., Smith M.L., Soderlund C., Spragon L., Steward C.A., Sulston J.E., Swann R.M., Vaudin M., Wall M., Wallis J.M., Whiteley M.N., Willey D.L., Williams L., Williams S.A., Williamson H., Wilmer T.E., Wilming L., Wright C.L., Hubbard T., Bentley D.R., Beck S., Rogers J., Shimizu N., Minoshima S., Kawasaki K., Sasaki T., Asakawa S., Kudoh J., Shintani A., Shibuya K., Yoshizaki Y., Aoki N., Mitsuyama S., Roe B.A., Chen F., Chu L., Crabtree J., Deschamps S., Do A., Do T., Dorman A., Fang F., Fu Y., Hu P., Hua A., Kenton S., Lai H., Lao H.I., Lewis J., Lewis S., Lin S.-P., Loh P., Malaj E., Nguyen T., Pan H., Phan S., Qi S., Qian Y., Ray L., Ren Q., Shaull S., Sloan D., Song L., Wang Q., Wang Y., Wang Z., White J., Willingham D., Wu H., Yao Z., Zhan M., Zhang G., Chissoe S., Murray J., Miller N., Minx P., Fulton R., Johnson D., Bemis G., Bentley D., Bradshaw H., Bourne S., Cordes M., Du Z., Fulton L., Goela D., Graves T., Hawkins J., Hinds K., Kemp K., Latreille P., Layman D., Ozersky P., Rohlfing T., Scheet P., Walker C., Wamsley A., Wohldmann P., Pepin K., Nelson J., Korf I., Bedell J.A., Hillier L.W., Mardis E., Waterston R., Wilson R., Emanuel B.S., Shaikh T., Kurahashi H., Saitta S., Budarf M.L., McDermid H.E., Johnson A., Wong A.C.C., Morrow B.E., Edelmann L., Kim U.J., Shizuya H., Simon M.I., Dumanski J.P., Peyrard M., Kedra D., Seroussi E., Fransson I., Tapia I., Bruder C.E., O'Brien K.P., Wilkinson P., Bodenteich A., Hartman K., Hu X., Khan A.S., Lane L., Tilahun Y., Wright H.
    Nature 402:489-495(1999) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 7), VARIANT ILE-430.
    Tissue: Brain.
  8. "A genomic screen for genes upregulated by demethylation and histone deacetylase inhibition in human colorectal cancer."
    Suzuki H., Gabrielson E., Chen W., Anbazhagan R., Van Engeland M., Weijenberg M.P., Herman J.G., Baylin S.B.
    Nat. Genet. 31:141-149(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: GENE EXPRESSION REGULATION.
  9. "LC-MS/MS characterization of O-glycosylation sites and glycan structures of human cerebrospinal fluid glycoproteins."
    Halim A., Ruetschi U., Larson G., Nilsson J.
    J. Proteome Res. 12:573-584(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: GLYCOSYLATION AT SER-49, IDENTIFICATION BY MASS SPECTROMETRY.
  10. "Solution structure of the zinc finger domains (1-87) from human F-box only protein."
    RIKEN structural genomics initiative (RSGI)
    Submitted (FEB-2009) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 745-802, DISULFIDE BONDS.

Entry informationi

Entry nameiSE6L1_HUMAN
AccessioniPrimary (citable) accession number: Q9BYH1
Secondary accession number(s): A0AUW7
, B0QYG4, B0QYG5, B7ZLJ6, G8JLP3, O95917, Q5THY5, Q6IBZ4, Q6UXD4, Q9NUI3, Q9NUI4, Q9NUI5, Q9Y2E1, Q9Y3J6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 26, 2002
Last sequence update: June 1, 2001
Last modified: March 16, 2016
This is version 135 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.