Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Seizure 6-like protein

Gene

SEZ6L

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May contribute to specialized endoplasmic reticulum functions in neurons.By similarity

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100095-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Seizure 6-like protein
Gene namesi
Name:SEZ6L
Synonyms:KIAA0927
ORF Names:UNQ2542/PRO6094
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:10763. SEZ6L.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini29 – 958ExtracellularSequence analysisAdd BLAST930
Transmembranei959 – 979HelicalSequence analysisAdd BLAST21
Topological domaini980 – 1024CytoplasmicSequence analysisAdd BLAST45

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi23544.
OpenTargetsiENSG00000100095.
PharmGKBiPA35681.

Polymorphism and mutation databases

BioMutaiSEZ6L.
DMDMi22002000.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 28Sequence analysisAdd BLAST28
ChainiPRO_000002232329 – 1024Seizure 6-like proteinAdd BLAST996

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi49O-linked (GalNAc...)1 Publication1
Disulfide bondi281 ↔ 308By similarity
Glycosylationi311N-linked (GlcNAc...)Sequence analysis1
Glycosylationi328N-linked (GlcNAc...)Sequence analysis1
Glycosylationi350N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi393 ↔ 433By similarity
Disulfide bondi419 ↔ 448By similarity
Glycosylationi435N-linked (GlcNAc...)Sequence analysis1
Glycosylationi458N-linked (GlcNAc...)Sequence analysis1
Glycosylationi474N-linked (GlcNAc...)Sequence analysis1
Glycosylationi514N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi567 ↔ 609By similarity
Glycosylationi576N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi594 ↔ 624By similarity
Glycosylationi618N-linked (GlcNAc...)Sequence analysis1
Glycosylationi674N-linked (GlcNAc...)Sequence analysis1
Glycosylationi742N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi745 ↔ 7871 Publication
Disulfide bondi773 ↔ 8001 Publication
Disulfide bondi806 ↔ 848By similarity
Disulfide bondi834 ↔ 865By similarity
Disulfide bondi873 ↔ 915By similarity
Disulfide bondi901 ↔ 930By similarity

Post-translational modificationi

O-glycosylated.1 Publication

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9BYH1.
PeptideAtlasiQ9BYH1.
PRIDEiQ9BYH1.

PTM databases

iPTMnetiQ9BYH1.
PhosphoSitePlusiQ9BYH1.

Expressioni

Tissue specificityi

Widely expressed, including adult and fetal brains and lungs. Not expressed in all lung cancer cell lines.

Gene expression databases

BgeeiENSG00000100095.
ExpressionAtlasiQ9BYH1. baseline and differential.
GenevisibleiQ9BYH1. HS.

Interactioni

Protein-protein interaction databases

IntActiQ9BYH1. 3 interactors.
STRINGi9606.ENSP00000248933.

Structurei

Secondary structure

11024
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi754 – 756Combined sources3
Beta strandi759 – 762Combined sources4
Beta strandi768 – 773Combined sources6
Beta strandi777 – 781Combined sources5
Beta strandi783 – 787Combined sources5
Beta strandi793 – 795Combined sources3
Beta strandi799 – 802Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YRANMR-A745-802[»]
ProteinModelPortaliQ9BYH1.
SMRiQ9BYH1.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9BYH1.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini281 – 389CUB 1PROSITE-ProRule annotationAdd BLAST109
Domaini391 – 450Sushi 1PROSITE-ProRule annotationAdd BLAST60
Domaini452 – 562CUB 2PROSITE-ProRule annotationAdd BLAST111
Domaini565 – 626Sushi 2PROSITE-ProRule annotationAdd BLAST62
Domaini628 – 739CUB 3PROSITE-ProRule annotationAdd BLAST112
Domaini743 – 802Sushi 3PROSITE-ProRule annotationAdd BLAST60
Domaini804 – 867Sushi 4PROSITE-ProRule annotationAdd BLAST64
Domaini871 – 932Sushi 5PROSITE-ProRule annotationAdd BLAST62

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni147 – 161O-glycosylated at one siteAdd BLAST15
Regioni176 – 180O-glycosylated at one site5

Sequence similaritiesi

Belongs to the SEZ6 family.Curated
Contains 3 CUB domains.PROSITE-ProRule annotation
Contains 5 Sushi (CCP/SCR) domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal, Sushi, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IJTP. Eukaryota.
ENOG410ZD9C. LUCA.
GeneTreeiENSGT00760000118803.
HOVERGENiHBG057885.
InParanoidiQ9BYH1.
OMAiSEEPLWL.
OrthoDBiEOG091G0144.
PhylomeDBiQ9BYH1.
TreeFamiTF330037.

Family and domain databases

CDDicd00033. CCP. 5 hits.
cd00041. CUB. 3 hits.
Gene3Di2.60.120.290. 3 hits.
InterProiIPR000859. CUB_dom.
IPR000436. Sushi_SCR_CCP_dom.
[Graphical view]
PfamiPF00431. CUB. 2 hits.
PF00084. Sushi. 5 hits.
[Graphical view]
SMARTiSM00032. CCP. 5 hits.
SM00042. CUB. 3 hits.
[Graphical view]
SUPFAMiSSF49854. SSF49854. 3 hits.
SSF57535. SSF57535. 5 hits.
PROSITEiPS01180. CUB. 3 hits.
PS50923. SUSHI. 5 hits.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Experimental confirmation may be lacking for some isoforms.
Isoform 4 (identifier: Q9BYH1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPAARPPAAG LRGISLFLAL LLGSPAAALE RDALPEGDAS PLGPYLLPSG
60 70 80 90 100
APERGSPGKE HPEERVVTAP PSSSQSAEVL GELVLDGTAP SAHHDIPALS
110 120 130 140 150
PLLPEEARPK HALPPKKKLP SLKQVNSARK QLRPKATSAA TVQRAGSQPA
160 170 180 190 200
SQGLDLLSSS TEKPGPPGDP DPIVASEEAS EVPLWLDRKE SAVPTTPAPL
210 220 230 240 250
QISPFTSQPY VAHTLPQRPE PGEPGPDMAQ EAPQEDTSPM ALMDKGENEL
260 270 280 290 300
TGSASEESQE TTTSTIITTT VITTEQAPAL CSVSFSNPEG YIDSSDYPLL
310 320 330 340 350
PLNNFLECTY NVTVYTGYGV ELQVKSVNLS DGELLSIRGV DGPTLTVLAN
360 370 380 390 400
QTLLVEGQVI RSPTNTISVY FRTFQDDGLG TFQLHYQAFM LSCNFPRRPD
410 420 430 440 450
SGDVTVMDLH SGGVAHFHCH LGYELQGAKM LTCINASKPH WSSQEPICSA
460 470 480 490 500
PCGGAVHNAT IGRVLSPSYP ENTNGSQFCI WTIEAPEGQK LHLHFERLLL
510 520 530 540 550
HDKDRMTVHS GQTNKSALLY DSLQTESVPF EGLLSEGNTI RIEFTSDQAR
560 570 580 590 600
AASTFNIRFE AFEKGHCYEP YIQNGNFTTS DPTYNIGTIV EFTCDPGHSL
610 620 630 640 650
EQGPAIIECI NVRDPYWNDT EPLCRAMCGG ELSAVAGVVL SPNWPEPYVE
660 670 680 690 700
GEDCIWKIHV GEEKRIFLDI QFLNLSNSDI LTIYDGDEVM PHILGQYLGN
710 720 730 740 750
SGPQKLYSST PDLTIQFHSD PAGLIFGKGQ GFIMNYIEVS RNDSCSDLPE
760 770 780 790 800
IQNGWKTTSH TELVRGARIT YQCDPGYDIV GSDTLTCQWD LSWSSDPPFC
810 820 830 840 850
EKIMYCTDPG EVDHSTRLIS DPVLLVGTTI QYTCNPGFVL EGSSLLTCYS
860 870 880 890 900
RETGTPIWTS RLPHCVSEES LACDNPGLPE NGYQILYKRL YLPGESLTFM
910 920 930 940 950
CYEGFELMGE VTIRCILGQP SHWNGPLPVC KVNQDSFEHA LEVAEAAAET
960 970 980 990 1000
SLEGGNMALA IFIPVLIISL LLGGAYIYIT RCRYYSNLRL PLMYSHPYSQ
1010 1020
ITVETEFDNP IYETGETREY EVSI
Length:1,024
Mass (Da):111,782
Last modified:June 1, 2001 - v1
Checksum:iCBC0679E22C23B6E
GO
Isoform 1 (identifier: Q9BYH1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-227: Missing.
     868-944: Missing.
     1016-1024: ETREYEVSI → GTQKV

Show »
Length:716
Mass (Da):79,048
Checksum:i2D7EB9BFA5255AE6
GO
Isoform 2 (identifier: Q9BYH1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-227: Missing.
     943-943: Missing.
     1016-1024: ETREYEVSI → GTQKV

Show »
Length:792
Mass (Da):87,593
Checksum:i06B56E639B87C01A
GO
Isoform 3 (identifier: Q9BYH1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     803-867: IMYCTDPGEVDHSTRLISDPVLLVGTTIQYTCNPGFVLEGSSLLTCYSRETGTPIWTSRLPHCVS → T
     933-943: Missing.

Show »
Length:949
Mass (Da):103,497
Checksum:i64FACD9450B3F6F3
GO
Isoform 5 (identifier: Q9BYH1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     867-943: SEESLACDNP...QDSFEHALEV → L

Show »
Length:948
Mass (Da):103,234
Checksum:iAC7FE35AA8986926
GO
Isoform 6 (identifier: Q9BYH1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     943-943: Missing.

Show »
Length:1,023
Mass (Da):111,683
Checksum:iF944A3C541880D3A
GO
Isoform 7 (identifier: Q9BYH1-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     933-943: Missing.

Note: No experimental confirmation available.
Show »
Length:1,013
Mass (Da):110,511
Checksum:iE5A684F7BB233D9F
GO

Sequence cautioni

The sequence BAA76771 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_04333852P → L.Corresponds to variant rs6004989dbSNPEnsembl.1
Natural variantiVAR_024348185W → L.Corresponds to variant rs137203dbSNPEnsembl.1
Natural variantiVAR_020330430M → I.1 PublicationCorresponds to variant rs663048dbSNPEnsembl.1
Natural variantiVAR_043339671Q → H.Corresponds to variant rs586542dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0039761 – 227Missing in isoform 1 and isoform 2. 2 PublicationsAdd BLAST227
Alternative sequenceiVSP_003981803 – 867IMYCT…PHCVS → T in isoform 3. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_013022867 – 943SEESL…HALEV → L in isoform 5. 1 PublicationAdd BLAST77
Alternative sequenceiVSP_003977868 – 944Missing in isoform 1. 2 PublicationsAdd BLAST77
Alternative sequenceiVSP_003978933 – 943Missing in isoform 3 and isoform 7. 2 PublicationsAdd BLAST11
Alternative sequenceiVSP_003979943Missing in isoform 2 and isoform 6. 2 Publications1
Alternative sequenceiVSP_0039801016 – 1024ETREYEVSI → GTQKV in isoform 1 and isoform 2. 2 Publications9

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB041736 mRNA. Translation: BAB40970.1.
AB023144 mRNA. Translation: BAA76771.2. Different initiation.
AL035545 mRNA. Translation: CAB37431.1.
AL050253 mRNA. Translation: CAB43355.1.
AY358405 mRNA. Translation: AAQ88771.1.
CR456574 mRNA. Translation: CAG30460.1.
AL022337, AL023513, AL078460 Genomic DNA. Translation: CAI17997.1.
AL078460, AL022337, AL023513 Genomic DNA. Translation: CAI20266.1.
AL023513, AL022337, AL078460 Genomic DNA. Translation: CAI19980.1.
AL023513, AL022337, AL078460 Genomic DNA. Translation: CAQ08922.1.
AL023513, AL022337, AL078460 Genomic DNA. Translation: CAQ08923.1.
AL078460, AL022337, AL023513 Genomic DNA. Translation: CAQ08975.1.
AL078460, AL022337, AL023513 Genomic DNA. Translation: CAQ08976.1.
AL022337, AL023513, AL078460 Genomic DNA. Translation: CAQ10786.1.
AL022337, AL023513, AL078460 Genomic DNA. Translation: CAQ10787.1.
AL080273 Genomic DNA. No translation available.
BC126115 mRNA. Translation: AAI26116.1.
BC143851 mRNA. Translation: AAI43852.1.
CCDSiCCDS13833.1. [Q9BYH1-1]
CCDS54508.1. [Q9BYH1-6]
CCDS54509.1. [Q9BYH1-7]
CCDS54510.1. [Q9BYH1-5]
CCDS54511.1. [Q9BYH1-4]
RefSeqiNP_001171702.1. NM_001184773.1. [Q9BYH1-6]
NP_001171703.1. NM_001184774.1. [Q9BYH1-7]
NP_001171704.1. NM_001184775.1.
NP_001171705.1. NM_001184776.1. [Q9BYH1-4]
NP_001171706.1. NM_001184777.1. [Q9BYH1-5]
NP_066938.2. NM_021115.4. [Q9BYH1-1]
UniGeneiHs.194766.

Genome annotation databases

EnsembliENST00000248933; ENSP00000248933; ENSG00000100095. [Q9BYH1-1]
ENST00000343706; ENSP00000342661; ENSG00000100095. [Q9BYH1-5]
ENST00000360929; ENSP00000354185; ENSG00000100095. [Q9BYH1-4]
ENST00000404234; ENSP00000384772; ENSG00000100095. [Q9BYH1-6]
ENST00000629590; ENSP00000485720; ENSG00000100095. [Q9BYH1-7]
GeneIDi23544.
KEGGihsa:23544.
UCSCiuc003acb.4. human. [Q9BYH1-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB041736 mRNA. Translation: BAB40970.1.
AB023144 mRNA. Translation: BAA76771.2. Different initiation.
AL035545 mRNA. Translation: CAB37431.1.
AL050253 mRNA. Translation: CAB43355.1.
AY358405 mRNA. Translation: AAQ88771.1.
CR456574 mRNA. Translation: CAG30460.1.
AL022337, AL023513, AL078460 Genomic DNA. Translation: CAI17997.1.
AL078460, AL022337, AL023513 Genomic DNA. Translation: CAI20266.1.
AL023513, AL022337, AL078460 Genomic DNA. Translation: CAI19980.1.
AL023513, AL022337, AL078460 Genomic DNA. Translation: CAQ08922.1.
AL023513, AL022337, AL078460 Genomic DNA. Translation: CAQ08923.1.
AL078460, AL022337, AL023513 Genomic DNA. Translation: CAQ08975.1.
AL078460, AL022337, AL023513 Genomic DNA. Translation: CAQ08976.1.
AL022337, AL023513, AL078460 Genomic DNA. Translation: CAQ10786.1.
AL022337, AL023513, AL078460 Genomic DNA. Translation: CAQ10787.1.
AL080273 Genomic DNA. No translation available.
BC126115 mRNA. Translation: AAI26116.1.
BC143851 mRNA. Translation: AAI43852.1.
CCDSiCCDS13833.1. [Q9BYH1-1]
CCDS54508.1. [Q9BYH1-6]
CCDS54509.1. [Q9BYH1-7]
CCDS54510.1. [Q9BYH1-5]
CCDS54511.1. [Q9BYH1-4]
RefSeqiNP_001171702.1. NM_001184773.1. [Q9BYH1-6]
NP_001171703.1. NM_001184774.1. [Q9BYH1-7]
NP_001171704.1. NM_001184775.1.
NP_001171705.1. NM_001184776.1. [Q9BYH1-4]
NP_001171706.1. NM_001184777.1. [Q9BYH1-5]
NP_066938.2. NM_021115.4. [Q9BYH1-1]
UniGeneiHs.194766.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2YRANMR-A745-802[»]
ProteinModelPortaliQ9BYH1.
SMRiQ9BYH1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9BYH1. 3 interactors.
STRINGi9606.ENSP00000248933.

PTM databases

iPTMnetiQ9BYH1.
PhosphoSitePlusiQ9BYH1.

Polymorphism and mutation databases

BioMutaiSEZ6L.
DMDMi22002000.

Proteomic databases

PaxDbiQ9BYH1.
PeptideAtlasiQ9BYH1.
PRIDEiQ9BYH1.

Protocols and materials databases

DNASUi23544.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000248933; ENSP00000248933; ENSG00000100095. [Q9BYH1-1]
ENST00000343706; ENSP00000342661; ENSG00000100095. [Q9BYH1-5]
ENST00000360929; ENSP00000354185; ENSG00000100095. [Q9BYH1-4]
ENST00000404234; ENSP00000384772; ENSG00000100095. [Q9BYH1-6]
ENST00000629590; ENSP00000485720; ENSG00000100095. [Q9BYH1-7]
GeneIDi23544.
KEGGihsa:23544.
UCSCiuc003acb.4. human. [Q9BYH1-1]

Organism-specific databases

CTDi23544.
DisGeNETi23544.
GeneCardsiSEZ6L.
HGNCiHGNC:10763. SEZ6L.
MIMi607021. gene.
neXtProtiNX_Q9BYH1.
OpenTargetsiENSG00000100095.
PharmGKBiPA35681.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJTP. Eukaryota.
ENOG410ZD9C. LUCA.
GeneTreeiENSGT00760000118803.
HOVERGENiHBG057885.
InParanoidiQ9BYH1.
OMAiSEEPLWL.
OrthoDBiEOG091G0144.
PhylomeDBiQ9BYH1.
TreeFamiTF330037.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000100095-MONOMER.

Miscellaneous databases

ChiTaRSiSEZ6L. human.
EvolutionaryTraceiQ9BYH1.
GeneWikiiSEZ6L.
GenomeRNAii23544.
PROiQ9BYH1.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000100095.
ExpressionAtlasiQ9BYH1. baseline and differential.
GenevisibleiQ9BYH1. HS.

Family and domain databases

CDDicd00033. CCP. 5 hits.
cd00041. CUB. 3 hits.
Gene3Di2.60.120.290. 3 hits.
InterProiIPR000859. CUB_dom.
IPR000436. Sushi_SCR_CCP_dom.
[Graphical view]
PfamiPF00431. CUB. 2 hits.
PF00084. Sushi. 5 hits.
[Graphical view]
SMARTiSM00032. CCP. 5 hits.
SM00042. CUB. 3 hits.
[Graphical view]
SUPFAMiSSF49854. SSF49854. 3 hits.
SSF57535. SSF57535. 5 hits.
PROSITEiPS01180. CUB. 3 hits.
PS50923. SUSHI. 5 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSE6L1_HUMAN
AccessioniPrimary (citable) accession number: Q9BYH1
Secondary accession number(s): A0AUW7
, B0QYG4, B0QYG5, B7ZLJ6, G8JLP3, O95917, Q5THY5, Q6IBZ4, Q6UXD4, Q9NUI3, Q9NUI4, Q9NUI5, Q9Y2E1, Q9Y3J6
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 26, 2002
Last sequence update: June 1, 2001
Last modified: November 30, 2016
This is version 141 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.