Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein maestro

Gene

MRO

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Protein maestro
Alternative name(s):
Male-specific transcription in the developing reproductive organs
Protein B29
Gene namesi
Name:MRO
Synonyms:B29, C18orf3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 18

Organism-specific databases

HGNCiHGNC:24121. MRO.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134932281.

Polymorphism and mutation databases

BioMutaiMRO.
DMDMi161789016.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 248248Protein maestroPRO_0000248197Add
BLAST

Proteomic databases

PaxDbiQ9BYG7.
PeptideAtlasiQ9BYG7.
PRIDEiQ9BYG7.

PTM databases

PhosphoSiteiQ9BYG7.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiENSG00000134042.
CleanExiHS_MRO.
ExpressionAtlasiQ9BYG7. baseline and differential.
GenevisibleiQ9BYG7. HS.

Organism-specific databases

HPAiHPA022011.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000397900.

Structurei

3D structure databases

ProteinModelPortaliQ9BYG7.
SMRiQ9BYG7. Positions 132-160.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati128 – 16336HEATAdd
BLAST

Sequence similaritiesi

Contains 1 HEAT repeat.Curated

Phylogenomic databases

eggNOGiKOG2032. Eukaryota.
ENOG410XQE8. LUCA.
GeneTreeiENSGT00840000129723.
HOGENOMiHOG000113672.
HOVERGENiHBG081989.
InParanoidiQ9BYG7.
OMAiHMAMRGL.
OrthoDBiEOG091G00DQ.
PhylomeDBiQ9BYG7.
TreeFamiTF343191.

Family and domain databases

Gene3Di1.25.10.10. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BYG7-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDQRQRRILG QPLSIPTSQP KQKRTSMISF FSKVSWKLRF QKREPLKNVF
60 70 80 90 100
FILAERARDP SAKKRHMAMR NLGTMAYEAP DKVRKYKKIV LDLLVYGLYD
110 120 130 140 150
PVNLEVIHES MKTLTVVLGK IQGKGLGSFF IDITLQTRTL LDDENDSLRY
160 170 180 190 200
SAFVLFGQLA AFAGRKWKKF FTSQVKQTRD SLLIHLQDRN PQVAKACKTT
210 220 230 240
FQACSPYLKL KEEYSFQSEE DQRNTKLYQQ LSHYHPEILQ FFYANKIL
Length:248
Mass (Da):29,054
Last modified:December 4, 2007 - v2
Checksum:i57E43D6085BFF069
GO
Isoform 2 (identifier: Q9BYG7-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MDQRQRRILGQPLSIPTSQPKQKRTSMISFFSK → MAWGSKGIQG...SRGSRLQEPQ
     144-195: Missing.

Note: No experimental confirmation available.
Show »
Length:210
Mass (Da):24,055
Checksum:i349CDF4A8E32B848
GO
Isoform 3 (identifier: Q9BYG7-3)
Sequence is not available
Length:
Mass (Da):
Isoform 4 (identifier: Q9BYG7-4)
Sequence is not available
Length:
Mass (Da):
Isoform 5 (identifier: Q9BYG7-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MDQRQRRILGQPLSIPTSQPKQKRTSMISFFSK → MAWGSKGIQG...SRGSRLQEPQ

Note: No experimental confirmation available.
Show »
Length:262
Mass (Da):30,093
Checksum:iCE5A7AA63055DAE8
GO
Isoform 6 (identifier: Q9BYG7-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     144-195: Missing.

Show »
Length:196
Mass (Da):23,016
Checksum:i49FC39BAA95E8A0C
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti39 – 391R → S.1 Publication
Corresponds to variant rs4940019 [ dbSNP | Ensembl ].
VAR_027261
Natural varianti134 – 1341T → A.3 Publications
Corresponds to variant rs2849233 [ dbSNP | Ensembl ].
VAR_027262

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 3333MDQRQ…SFFSK → MAWGSKGIQGWENLAESSHL ATTRESSPPESGTGSGSSRG SRLQEPQ in isoform 2 and isoform 5. 1 PublicationVSP_045711Add
BLAST
Alternative sequencei144 – 19552Missing in isoform 2 and isoform 6. 1 PublicationVSP_045712Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB042647 mRNA. Translation: BAB40981.1.
AK294757 mRNA. Translation: BAH11871.1.
AK054702 mRNA. Translation: BAB70797.1.
AK295666 mRNA. Translation: BAH12148.1.
AC015864 Genomic DNA. No translation available.
BC029860 mRNA. Translation: AAH29860.1.
CCDSiCCDS11947.1. [Q9BYG7-1]
CCDS45867.1. [Q9BYG7-2]
CCDS45868.1. [Q9BYG7-5]
CCDS45869.1. [Q9BYG7-6]
RefSeqiNP_001120646.1. NM_001127174.1. [Q9BYG7-6]
NP_001120647.1. NM_001127175.1. [Q9BYG7-2]
NP_001120648.1. NM_001127176.1. [Q9BYG7-5]
NP_114145.2. NM_031939.3. [Q9BYG7-1]
XP_005258422.1. XM_005258365.3. [Q9BYG7-1]
XP_011524528.1. XM_011526226.2. [Q9BYG7-6]
UniGeneiHs.30495.

Genome annotation databases

EnsembliENST00000256425; ENSP00000256425; ENSG00000134042. [Q9BYG7-1]
ENST00000398439; ENSP00000381465; ENSG00000134042. [Q9BYG7-1]
ENST00000428869; ENSP00000409509; ENSG00000134042. [Q9BYG7-1]
ENST00000431965; ENSP00000392614; ENSG00000134042. [Q9BYG7-2]
ENST00000436348; ENSP00000397900; ENSG00000134042. [Q9BYG7-5]
ENST00000588444; ENSP00000465653; ENSG00000134042. [Q9BYG7-6]
ENST00000610511; ENSP00000482576; ENSG00000134042. [Q9BYG7-1]
GeneIDi83876.
KEGGihsa:83876.
UCSCiuc002lew.5. human. [Q9BYG7-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB042647 mRNA. Translation: BAB40981.1.
AK294757 mRNA. Translation: BAH11871.1.
AK054702 mRNA. Translation: BAB70797.1.
AK295666 mRNA. Translation: BAH12148.1.
AC015864 Genomic DNA. No translation available.
BC029860 mRNA. Translation: AAH29860.1.
CCDSiCCDS11947.1. [Q9BYG7-1]
CCDS45867.1. [Q9BYG7-2]
CCDS45868.1. [Q9BYG7-5]
CCDS45869.1. [Q9BYG7-6]
RefSeqiNP_001120646.1. NM_001127174.1. [Q9BYG7-6]
NP_001120647.1. NM_001127175.1. [Q9BYG7-2]
NP_001120648.1. NM_001127176.1. [Q9BYG7-5]
NP_114145.2. NM_031939.3. [Q9BYG7-1]
XP_005258422.1. XM_005258365.3. [Q9BYG7-1]
XP_011524528.1. XM_011526226.2. [Q9BYG7-6]
UniGeneiHs.30495.

3D structure databases

ProteinModelPortaliQ9BYG7.
SMRiQ9BYG7. Positions 132-160.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000397900.

PTM databases

PhosphoSiteiQ9BYG7.

Polymorphism and mutation databases

BioMutaiMRO.
DMDMi161789016.

Proteomic databases

PaxDbiQ9BYG7.
PeptideAtlasiQ9BYG7.
PRIDEiQ9BYG7.

Protocols and materials databases

DNASUi83876.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000256425; ENSP00000256425; ENSG00000134042. [Q9BYG7-1]
ENST00000398439; ENSP00000381465; ENSG00000134042. [Q9BYG7-1]
ENST00000428869; ENSP00000409509; ENSG00000134042. [Q9BYG7-1]
ENST00000431965; ENSP00000392614; ENSG00000134042. [Q9BYG7-2]
ENST00000436348; ENSP00000397900; ENSG00000134042. [Q9BYG7-5]
ENST00000588444; ENSP00000465653; ENSG00000134042. [Q9BYG7-6]
ENST00000610511; ENSP00000482576; ENSG00000134042. [Q9BYG7-1]
GeneIDi83876.
KEGGihsa:83876.
UCSCiuc002lew.5. human. [Q9BYG7-1]

Organism-specific databases

CTDi83876.
GeneCardsiMRO.
HGNCiHGNC:24121. MRO.
HPAiHPA022011.
MIMi608080. gene.
neXtProtiNX_Q9BYG7.
PharmGKBiPA134932281.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG2032. Eukaryota.
ENOG410XQE8. LUCA.
GeneTreeiENSGT00840000129723.
HOGENOMiHOG000113672.
HOVERGENiHBG081989.
InParanoidiQ9BYG7.
OMAiHMAMRGL.
OrthoDBiEOG091G00DQ.
PhylomeDBiQ9BYG7.
TreeFamiTF343191.

Miscellaneous databases

ChiTaRSiMRO. human.
GenomeRNAii83876.
PROiQ9BYG7.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000134042.
CleanExiHS_MRO.
ExpressionAtlasiQ9BYG7. baseline and differential.
GenevisibleiQ9BYG7. HS.

Family and domain databases

Gene3Di1.25.10.10. 1 hit.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiMSTRO_HUMAN
AccessioniPrimary (citable) accession number: Q9BYG7
Secondary accession number(s): B7Z2I5
, B7Z3B2, E9PAT5, E9PBI3, K7EKJ8, Q8N6K5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: December 4, 2007
Last modified: September 7, 2016
This is version 120 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 18
    Human chromosome 18: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.