Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Transmembrane protease serine 13

Gene

TMPRSS13

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Active sitei366 – 3661Charge relay systemBy similarity
Active sitei414 – 4141Charge relay systemBy similarity
Active sitei511 – 5111Charge relay systemBy similarity

GO - Molecular functioni

  • scavenger receptor activity Source: InterPro
  • serine-type endopeptidase activity Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Hydrolase, Protease, Serine protease

Protein family/group databases

MEROPSiS01.087.

Names & Taxonomyi

Protein namesi
Recommended name:
Transmembrane protease serine 13 (EC:3.4.21.-)
Alternative name(s):
Membrane-type mosaic serine protease
Short name:
Mosaic serine protease
Gene namesi
Name:TMPRSS13
Synonyms:MSP, TMPRSS11
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

HGNCiHGNC:29808. TMPRSS13.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 165165CytoplasmicSequence analysisAdd
BLAST
Transmembranei166 – 18621Helical; Signal-anchor for type II membrane proteinSequence analysisAdd
BLAST
Topological domaini187 – 586400ExtracellularSequence analysisAdd
BLAST

GO - Cellular componenti

  • blood microparticle Source: UniProtKB
  • integral component of membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Polymorphism and mutation databases

BioMutaiTMPRSS13.
DMDMi313104278.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 586586Transmembrane protease serine 13PRO_0000088698Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi250 ↔ 314By similarity
Glycosylationi255 – 2551N-linked (GlcNAc...)Sequence analysis
Disulfide bondi263 ↔ 317By similarity
Glycosylationi292 – 2921N-linked (GlcNAc...)Sequence analysis
Disulfide bondi351 ↔ 367By similarity
Glycosylationi405 – 4051N-linked (GlcNAc...)Sequence analysis
Glycosylationi445 – 4451N-linked (GlcNAc...)Sequence analysis
Disulfide bondi448 ↔ 517By similarity
Disulfide bondi480 ↔ 496By similarity
Disulfide bondi507 ↔ 535By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein

Proteomic databases

PaxDbiQ9BYE2.
PeptideAtlasiQ9BYE2.
PRIDEiQ9BYE2.

PTM databases

iPTMnetiQ9BYE2.
PhosphoSiteiQ9BYE2.

Expressioni

Tissue specificityi

Isoform 1 and isoform 3 are predominantly expressed in lung, placenta, pancreas, and prostate. Isoform 3 is weakly expressed in testis and peripheral blood lymphocytes.1 Publication

Gene expression databases

BgeeiQ9BYE2.
CleanExiHS_TMPRSS13.
ExpressionAtlasiQ9BYE2. baseline and differential.
GenevisibleiQ9BYE2. HS.

Organism-specific databases

HPAiHPA028947.

Interactioni

Protein-protein interaction databases

BioGridi123845. 4 interactions.
STRINGi9606.ENSP00000434279.

Structurei

3D structure databases

ProteinModelPortaliQ9BYE2.
SMRiQ9BYE2. Positions 236-562.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati9 – 1351-1
Repeati14 – 1852-1; approximate
Repeati19 – 2351-2
Repeati24 – 2851-3
Repeati29 – 3352-2
Repeati34 – 3851-4
Repeati39 – 4351-5
Repeati44 – 4851-6
Repeati49 – 5352-3
Repeati54 – 5851-7
Repeati59 – 6351-8
Repeati64 – 6852-4
Repeati69 – 78101-9; approximate
Repeati79 – 8351-10
Repeati84 – 8851-11
Repeati89 – 9351-12
Domaini195 – 325131SRCRPROSITE-ProRule annotationAdd
BLAST
Domaini204 – 22623LDL-receptor class AAdd
BLAST
Domaini326 – 559234Peptidase S1PROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni9 – 938513 X 5 AA repeats of A-S-P-A-[GLQR]Add
BLAST
Regioni14 – 68554 X 5 AA repeats of T-P-P-G-RAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi9 – 9486Ala-richAdd
BLAST

Sequence similaritiesi

Belongs to the peptidase S1 family.PROSITE-ProRule annotation
Contains 1 LDL-receptor class A domain.Curated
Contains 1 peptidase S1 domain.PROSITE-ProRule annotation
Contains 1 SRCR domain.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG3627. Eukaryota.
COG5640. LUCA.
GeneTreeiENSGT00760000118962.
HOGENOMiHOG000251822.
HOVERGENiHBG013304.
InParanoidiQ9BYE2.
KOiK09643.

Family and domain databases

Gene3Di3.10.250.10. 1 hit.
4.10.400.10. 1 hit.
InterProiIPR002172. LDrepeatLR_classA_rpt.
IPR009003. Peptidase_S1_PA.
IPR001314. Peptidase_S1A.
IPR017327. Peptidase_S1A_TMPRSS13.
IPR001190. SRCR.
IPR017448. SRCR-like_dom.
IPR001254. Trypsin_dom.
IPR018114. TRYPSIN_HIS.
IPR033116. TRYPSIN_SER.
[Graphical view]
PfamiPF15494. SRCR_2. 1 hit.
PF00089. Trypsin. 1 hit.
[Graphical view]
PIRSFiPIRSF037935. TMPRSS13. 1 hit.
PRINTSiPR00722. CHYMOTRYPSIN.
SMARTiSM00202. SR. 1 hit.
SM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.
SSF56487. SSF56487. 1 hit.
PROSITEiPS50287. SRCR_2. 1 hit.
PS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BYE2-1) [UniParc]FASTAAdd to basket

Also known as: MSPL, Large form, Membrane-type

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MERDSHGNAS PARTPSAGAS PAQASPAGTP PGRASPAQAS PAQASPAGTP
60 70 80 90 100
PGRASPAQAS PAGTPPGRAS PGRASPAQAS PAQASPARAS PALASLSRSS
110 120 130 140 150
SGRSSSARSA SVTTSPTRVY LVRATPVGAV PIRSSPARSA PATRATRESP
160 170 180 190 200
GTSLPKFTWR EGQKQLPLIG CVLLLIALVV SLIILFQFWQ GHTGIRYKEQ
210 220 230 240 250
RESCPKHAVR CDGVVDCKLK SDELGCVRFD WDKSLLKIYS GSSHQWLPIC
260 270 280 290 300
SSNWNDSYSE KTCQQLGFES AHRTTEVAHR DFANSFSILR YNSTIQESLH
310 320 330 340 350
RSECPSQRYI SLQCSHCGLR AMTGRIVGGA LASDSKWPWQ VSLHFGTTHI
360 370 380 390 400
CGGTLIDAQW VLTAAHCFFV TREKVLEGWK VYAGTSNLHQ LPEAASIAEI
410 420 430 440 450
IINSNYTDEE DDYDIALMRL SKPLTLSAHI HPACLPMHGQ TFSLNETCWI
460 470 480 490 500
TGFGKTRETD DKTSPFLREV QVNLIDFKKC NDYLVYDSYL TPRMMCAGDL
510 520 530 540 550
RGGRDSCQGD SGGPLVCEQN NRWYLAGVTS WGTGCGQRNK PGVYTKVTEV
560 570 580
LPWIYSKMEV RSLQQDTAPS RLGTSSGGDP GGAPRV
Length:586
Mass (Da):63,153
Last modified:April 16, 2014 - v4
Checksum:iF842E3B7509FB1C6
GO
Isoform 2 (identifier: Q9BYE2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     560-563: VRSL → SSAG
     564-586: Missing.

Note: No experimental confirmation available.
Show »
Length:563
Mass (Da):60,807
Checksum:iE2F6B117E8B9629A
GO
Isoform 5 (identifier: Q9BYE2-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     151-186: GTSLPKFTWREGQKQLPLIGCVLLLIALVVSLIILF → V

Show »
Length:551
Mass (Da):59,289
Checksum:i20C3459000B3E413
GO
Isoform 3 (identifier: Q9BYE2-3) [UniParc]FASTAAdd to basket

Also known as: MSPS, Small form

The sequence of this isoform differs from the canonical sequence as follows:
     151-186: GTSLPKFTWREGQKQLPLIGCVLLLIALVVSLIILF → V
     560-586: VRSLQQDTAPSRLGTSSGGDPGGAPRV → SEVRFRKS

Show »
Length:532
Mass (Da):57,631
Checksum:iA7BFBF7E6E8C6AF0
GO
Isoform 4 (identifier: Q9BYE2-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     428-491: AHIHPACLPM...DYLVYDSYLT → GEGICTPRSP...IIRETEAQGL
     492-586: Missing.

Note: No experimental confirmation available.
Show »
Length:491
Mass (Da):52,560
Checksum:i9D9D7FE308E593E6
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti192 – 1921H → Y in AAO38062 (Ref. 3) Curated
Sequence conflicti206 – 2061K → E in AAO38062 (Ref. 3) Curated
Sequence conflicti211 – 2111C → R in AAO38062 (Ref. 3) Curated
Sequence conflicti510 – 5101D → G in BAG62041 (PubMed:14702039).Curated

Polymorphismi

The repeat A-S-P-A-[GLQR] is polymorphic and the number of copies varies between 12 to 14.1 Publication

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei151 – 18636GTSLP…LIILF → V in isoform 3 and isoform 5. 2 PublicationsVSP_013099Add
BLAST
Alternative sequencei428 – 49164AHIHP…DSYLT → GEGICTPRSPAPQPQHPLQP SHLSASVNSYPGPKASAGQK SKTLKDPYMEHFCFIIRETE AQGL in isoform 4. 1 PublicationVSP_013100Add
BLAST
Alternative sequencei492 – 58695Missing in isoform 4. 1 PublicationVSP_013101Add
BLAST
Alternative sequencei560 – 58627VRSLQ…GAPRV → SEVRFRKS in isoform 3. 1 PublicationVSP_013102Add
BLAST
Alternative sequencei560 – 5634VRSL → SSAG in isoform 2. 1 PublicationVSP_013103
Alternative sequencei564 – 58623Missing in isoform 2. 1 PublicationVSP_013104Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB048796 mRNA. Translation: BAB39741.2.
AB048797 mRNA. Translation: BAB39742.2.
AY190317 mRNA. Translation: AAO38062.1.
AK027798 mRNA. Translation: BAB55376.1.
AK300283 mRNA. Translation: BAG62041.1.
AP002962 Genomic DNA. No translation available.
CCDSiCCDS55788.1. [Q9BYE2-3]
CCDS55789.1. [Q9BYE2-4]
CCDS58185.1. [Q9BYE2-2]
RefSeqiNP_001193718.1. NM_001206789.1. [Q9BYE2-3]
NP_001193719.1. NM_001206790.1. [Q9BYE2-4]
NP_001231924.1. NM_001244995.1. [Q9BYE2-2]
UniGeneiHs.266308.

Genome annotation databases

EnsembliENST00000430170; ENSP00000387702; ENSG00000137747. [Q9BYE2-2]
ENST00000526090; ENSP00000436502; ENSG00000137747. [Q9BYE2-4]
ENST00000528626; ENSP00000435813; ENSG00000137747. [Q9BYE2-3]
GeneIDi84000.
KEGGihsa:84000.
UCSCiuc001pru.3. human. [Q9BYE2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB048796 mRNA. Translation: BAB39741.2.
AB048797 mRNA. Translation: BAB39742.2.
AY190317 mRNA. Translation: AAO38062.1.
AK027798 mRNA. Translation: BAB55376.1.
AK300283 mRNA. Translation: BAG62041.1.
AP002962 Genomic DNA. No translation available.
CCDSiCCDS55788.1. [Q9BYE2-3]
CCDS55789.1. [Q9BYE2-4]
CCDS58185.1. [Q9BYE2-2]
RefSeqiNP_001193718.1. NM_001206789.1. [Q9BYE2-3]
NP_001193719.1. NM_001206790.1. [Q9BYE2-4]
NP_001231924.1. NM_001244995.1. [Q9BYE2-2]
UniGeneiHs.266308.

3D structure databases

ProteinModelPortaliQ9BYE2.
SMRiQ9BYE2. Positions 236-562.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123845. 4 interactions.
STRINGi9606.ENSP00000434279.

Protein family/group databases

MEROPSiS01.087.

PTM databases

iPTMnetiQ9BYE2.
PhosphoSiteiQ9BYE2.

Polymorphism and mutation databases

BioMutaiTMPRSS13.
DMDMi313104278.

Proteomic databases

PaxDbiQ9BYE2.
PeptideAtlasiQ9BYE2.
PRIDEiQ9BYE2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000430170; ENSP00000387702; ENSG00000137747. [Q9BYE2-2]
ENST00000526090; ENSP00000436502; ENSG00000137747. [Q9BYE2-4]
ENST00000528626; ENSP00000435813; ENSG00000137747. [Q9BYE2-3]
GeneIDi84000.
KEGGihsa:84000.
UCSCiuc001pru.3. human. [Q9BYE2-1]

Organism-specific databases

CTDi84000.
GeneCardsiTMPRSS13.
HGNCiHGNC:29808. TMPRSS13.
HPAiHPA028947.
MIMi610050. gene.
neXtProtiNX_Q9BYE2.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG3627. Eukaryota.
COG5640. LUCA.
GeneTreeiENSGT00760000118962.
HOGENOMiHOG000251822.
HOVERGENiHBG013304.
InParanoidiQ9BYE2.
KOiK09643.

Miscellaneous databases

GenomeRNAii84000.
PROiQ9BYE2.
SOURCEiSearch...

Gene expression databases

BgeeiQ9BYE2.
CleanExiHS_TMPRSS13.
ExpressionAtlasiQ9BYE2. baseline and differential.
GenevisibleiQ9BYE2. HS.

Family and domain databases

Gene3Di3.10.250.10. 1 hit.
4.10.400.10. 1 hit.
InterProiIPR002172. LDrepeatLR_classA_rpt.
IPR009003. Peptidase_S1_PA.
IPR001314. Peptidase_S1A.
IPR017327. Peptidase_S1A_TMPRSS13.
IPR001190. SRCR.
IPR017448. SRCR-like_dom.
IPR001254. Trypsin_dom.
IPR018114. TRYPSIN_HIS.
IPR033116. TRYPSIN_SER.
[Graphical view]
PfamiPF15494. SRCR_2. 1 hit.
PF00089. Trypsin. 1 hit.
[Graphical view]
PIRSFiPIRSF037935. TMPRSS13. 1 hit.
PRINTSiPR00722. CHYMOTRYPSIN.
SMARTiSM00202. SR. 1 hit.
SM00020. Tryp_SPc. 1 hit.
[Graphical view]
SUPFAMiSSF50494. SSF50494. 1 hit.
SSF56487. SSF56487. 1 hit.
PROSITEiPS50287. SRCR_2. 1 hit.
PS50240. TRYPSIN_DOM. 1 hit.
PS00134. TRYPSIN_HIS. 1 hit.
PS00135. TRYPSIN_SER. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning and expression of novel mosaic serine proteases with and without a transmembrane domain from human lung."
    Kim D.R., Sharmin S., Inoue M., Kido H.
    Biochim. Biophys. Acta 1518:204-209(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), POLYMORPHISM, TISSUE SPECIFICITY.
    Tissue: Lung.
  2. Kim D.R., Inoue M., Kido H.
    Submitted (MAR-2007) to the EMBL/GenBank/DDBJ databases
    Cited for: SEQUENCE REVISION TO 192; 259; 298 AND 496.
  3. "Homo sapiens transmembrane protease, serine 6 (TMPRSS6) mRNA."
    Park T.J., Park W.J.
    Submitted (DEC-2002) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2).
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 4 AND 5).
    Tissue: Placenta.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].

Entry informationi

Entry nameiTMPSD_HUMAN
AccessioniPrimary (citable) accession number: Q9BYE2
Secondary accession number(s): B4DTM9
, E9PIJ5, F8WAJ3, Q86YM4, Q96JY8, Q9BYE1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 15, 2005
Last sequence update: April 16, 2014
Last modified: July 6, 2016
This is version 123 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Was termed TMPRSS6 (Ref. 3).Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. Peptidase families
    Classification of peptidase families and list of entries
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.