Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BY76

- ANGL4_HUMAN

UniProt

Q9BY76 - ANGL4_HUMAN

Protein

Angiopoietin-related protein 4

Gene

ANGPTL4

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 125 (01 Oct 2014)
      Sequence version 2 (08 Nov 2002)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Protein with hypoxia-induced expression in endothelial cells. May act as a regulator of angiogenesis and modulate tumorigenesis. Inhibits proliferation, migration, and tubule formation of endothelial cells and reduces vascular leakage. May exert a protective function on endothelial cells through an endocrine action. It is directly involved in regulating glucose homeostasis, lipid metabolism, and insulin sensitivity. In response to hypoxia, the unprocessed form of the protein accumulates in the subendothelial extracellular matrix (ECM). The matrix-associated and immobilized unprocessed form limits the formation of actin stress fibers and focal contacts in the adhering endothelial cells and inhibits their adhesion. It also decreases motility of endothelial cells and inhibits the sprouting and tube formation By similarity.By similarity

    GO - Molecular functioni

    1. enzyme inhibitor activity Source: UniProtKB
    2. protein binding Source: IntAct

    GO - Biological processi

    1. angiogenesis Source: UniProtKB-KW
    2. cell differentiation Source: UniProtKB-KW
    3. cellular lipid metabolic process Source: Reactome
    4. negative regulation of apoptotic process Source: UniProtKB
    5. negative regulation of endothelial cell apoptotic process Source: Ensembl
    6. negative regulation of lipoprotein lipase activity Source: BHF-UCL
    7. positive regulation of angiogenesis Source: UniProtKB
    8. protein homooligomerization Source: Ensembl
    9. response to hypoxia Source: UniProtKB
    10. small molecule metabolic process Source: Reactome
    11. triglyceride homeostasis Source: BHF-UCL

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Angiogenesis, Differentiation

    Enzyme and pathway databases

    ReactomeiREACT_116145. PPARA activates gene expression.
    REACT_27161. Transcriptional regulation of white adipocyte differentiation.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Angiopoietin-related protein 4
    Alternative name(s):
    Angiopoietin-like protein 4
    Hepatic fibrinogen/angiopoietin-related protein
    Short name:
    HFARP
    Gene namesi
    Name:ANGPTL4
    Synonyms:ARP4, HFARP, PGAR
    ORF Names:PP1158, PSEC0166, UNQ171/PRO197
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:16039. ANGPTL4.

    Subcellular locationi

    Secreted 1 Publication. Secretedextracellular spaceextracellular matrix By similarity
    Note: The unprocessed form interacts with the extracellular matrix. This may constitute a dynamic reservoir, a regulatory mechanism of the bioavailability of ANGPTL4 By similarity.By similarity

    GO - Cellular componenti

    1. blood microparticle Source: UniProt
    2. extracellular region Source: UniProtKB
    3. extracellular space Source: MGI
    4. proteinaceous extracellular matrix Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Extracellular matrix, Secreted

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA24797.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2525Sequence AnalysisAdd
    BLAST
    Chaini26 – 406381Angiopoietin-related protein 4PRO_0000009124Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi177 – 1771N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi188 ↔ 216PROSITE-ProRule annotation
    Disulfide bondi341 ↔ 354PROSITE-ProRule annotation

    Post-translational modificationi

    N-glycosylated.1 Publication

    Keywords - PTMi

    Disulfide bond, Glycoprotein

    Proteomic databases

    PaxDbiQ9BY76.
    PRIDEiQ9BY76.

    PTM databases

    PhosphoSiteiQ9BY76.

    Expressioni

    Tissue specificityi

    Expressed at high levels in the placenta, heart, liver, muscle, pancreas and lung but expressed poorly in the brain and kidney.2 Publications

    Gene expression databases

    ArrayExpressiQ9BY76.
    BgeeiQ9BY76.
    CleanExiHS_ANGPTL4.
    GenevestigatoriQ9BY76.

    Organism-specific databases

    HPAiHPA007879.

    Interactioni

    Subunit structurei

    Homooligomer. The homooligomer undergoes proteolytic processing to release its carboxyl fibrinogen-like domain, which circulates as a monomer. The homooligomer unprocessed form is able to interact with the extracellular matrix By similarity.By similarity

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ITGB1P055562EBI-2968146,EBI-703066
    ITGB5P180843EBI-2968146,EBI-1223434

    Protein-protein interaction databases

    BioGridi119316. 4 interactions.
    IntActiQ9BY76. 4 interactions.
    STRINGi9606.ENSP00000301455.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BY76.
    SMRiQ9BY76. Positions 48-403.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini179 – 401223Fibrinogen C-terminalPROSITE-ProRule annotationAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili100 – 14344Sequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Contains 1 fibrinogen C-terminal domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Coiled coil, Signal

    Phylogenomic databases

    eggNOGiNOG281759.
    HOVERGENiHBG001644.
    InParanoidiQ9BY76.
    KOiK08767.
    OMAiVDFNRPW.
    PhylomeDBiQ9BY76.
    TreeFamiTF329953.

    Family and domain databases

    Gene3Di3.90.215.10. 2 hits.
    4.10.530.10. 1 hit.
    InterProiIPR028793. ANGPTL4.
    IPR014716. Fibrinogen_a/b/g_C_1.
    IPR014715. Fibrinogen_a/b/g_C_2.
    IPR002181. Fibrinogen_a/b/g_C_dom.
    IPR020837. Fibrinogen_CS.
    [Graphical view]
    PANTHERiPTHR19143:SF16. PTHR19143:SF16. 1 hit.
    PfamiPF00147. Fibrinogen_C. 1 hit.
    [Graphical view]
    SMARTiSM00186. FBG. 1 hit.
    [Graphical view]
    SUPFAMiSSF56496. SSF56496. 1 hit.
    PROSITEiPS00514. FIBRINOGEN_C_1. 1 hit.
    PS51406. FIBRINOGEN_C_2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BY76-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSGAPTAGAA LMLCAATAVL LSAQGGPVQS KSPRFASWDE MNVLAHGLLQ    50
    LGQGLREHAE RTRSQLSALE RRLSACGSAC QGTEGSTDLP LAPESRVDPE 100
    VLHSLQTQLK AQNSRIQQLF HKVAQQQRHL EKQHLRIQHL QSQFGLLDHK 150
    HLDHEVAKPA RRKRLPEMAQ PVDPAHNVSR LHRLPRDCQE LFQVGERQSG 200
    LFEIQPQGSP PFLVNCKMTS DGGWTVIQRR HDGSVDFNRP WEAYKAGFGD 250
    PHGEFWLGLE KVHSITGDRN SRLAVQLRDW DGNAELLQFS VHLGGEDTAY 300
    SLQLTAPVAG QLGATTVPPS GLSVPFSTWD QDHDLRRDKN CAKSLSGGWW 350
    FGTCSHSNLN GQYFRSIPQQ RQKLKKGIFW KTWRGRYYPL QATTMLIQPM 400
    AAEAAS 406
    Length:406
    Mass (Da):45,214
    Last modified:November 8, 2002 - v2
    Checksum:i219E56FEB3F602AF
    GO
    Isoform 2 (identifier: Q9BY76-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         183-221: RLPRDCQELFQVGERQSGLFEIQPQGSPPFLVNCKMTSD → H

    Note: Gene prediction based on EST data.

    Show »
    Length:368
    Mass (Da):40,917
    Checksum:i7D61B5306C3AF298
    GO
    Isoform 3 (identifier: Q9BY76-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-167: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:239
    Mass (Da):26,853
    Checksum:iFBB362F2DBDB6900
    GO

    Sequence cautioni

    The sequence AAQ88642.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti55 – 7117LREHA…SALER → CANTGAHPQSAERAGA in AAD41088. 1 PublicationCuratedAdd
    BLAST
    Sequence conflicti60 – 601E → G in BAB40692. (PubMed:14583458)Curated
    Sequence conflicti175 – 1751A → P in AAF62868. (PubMed:10698685)Curated
    Sequence conflicti237 – 2371F → S in BAG64351. (PubMed:14702039)Curated
    Sequence conflicti251 – 2511P → S in BAD96209. 1 PublicationCurated
    Sequence conflicti270 – 2701N → D(PubMed:14702039)Curated
    Sequence conflicti270 – 2701N → D1 PublicationCurated
    Sequence conflicti277 – 2771L → R in BAD96244. 1 PublicationCurated
    Sequence conflicti304 – 3041L → F in AAF62868. (PubMed:10698685)Curated
    Sequence conflicti363 – 3631Y → H in BAD96209. 1 PublicationCurated
    Sequence conflicti389 – 3891P → S in AAF62868. (PubMed:10698685)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti5 – 51P → L.1 Publication
    VAR_032642
    Natural varianti40 – 401E → K Associated with lower plasma levels of triglyceride and higher levels of HDL cholesterol. 1 Publication
    Corresponds to variant rs116843064 [ dbSNP | Ensembl ].
    VAR_032643
    Natural varianti41 – 411M → I.1 Publication
    Corresponds to variant rs186754194 [ dbSNP | Ensembl ].
    VAR_032644
    Natural varianti67 – 671S → R.1 Publication
    VAR_032645
    Natural varianti72 – 721R → L.1 Publication
    Corresponds to variant rs141831018 [ dbSNP | Ensembl ].
    VAR_032646
    Natural varianti77 – 771G → R.1 Publication
    VAR_032647
    Natural varianti167 – 1671E → K.1 Publication
    Corresponds to variant rs140640857 [ dbSNP | Ensembl ].
    VAR_032648
    Natural varianti174 – 1741P → S.1 Publication
    VAR_032649
    Natural varianti190 – 1901E → Q.1 Publication
    Corresponds to variant rs77938377 [ dbSNP | Ensembl ].
    VAR_032650
    Natural varianti196 – 1961E → K.1 Publication
    VAR_032651
    Natural varianti230 – 2301R → C.1 Publication
    Corresponds to variant rs201026877 [ dbSNP | Ensembl ].
    VAR_032652
    Natural varianti233 – 2331G → R.1 Publication
    VAR_032653
    Natural varianti237 – 2371F → V.1 Publication
    VAR_032654
    Natural varianti251 – 2511P → T.1 Publication
    VAR_032655
    Natural varianti266 – 2661T → M.3 Publications
    Corresponds to variant rs1044250 [ dbSNP | Ensembl ].
    VAR_020428
    Natural varianti278 – 2781R → Q.1 Publication
    Corresponds to variant rs35061979 [ dbSNP | Ensembl ].
    VAR_032656
    Natural varianti291 – 2911V → M.1 Publication
    VAR_032657
    Natural varianti293 – 2931L → M.1 Publication
    VAR_032658
    Natural varianti296 – 2961E → V.1 Publication
    VAR_032659
    Natural varianti307 – 3071P → S.1 Publication
    VAR_032660
    Natural varianti308 – 3081V → M.1 Publication
    Corresponds to variant rs139998264 [ dbSNP | Ensembl ].
    VAR_032661
    Natural varianti336 – 3361R → C.1 Publication
    Corresponds to variant rs140744493 [ dbSNP | Ensembl ].
    VAR_032662
    Natural varianti338 – 3381D → E.1 Publication
    VAR_032663
    Natural varianti349 – 3491W → C.1 Publication
    VAR_032664
    Natural varianti361 – 3611G → R.1 Publication
    VAR_032665
    Natural varianti361 – 3611G → S.1 Publication
    VAR_032666
    Natural varianti371 – 3711R → Q.1 Publication
    VAR_032667
    Natural varianti384 – 3841R → W.1 Publication
    VAR_032668

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 167167Missing in isoform 3. 1 PublicationVSP_055092Add
    BLAST
    Alternative sequencei183 – 22139RLPRD…KMTSD → H in isoform 2. CuratedVSP_047045Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF169312 mRNA. Translation: AAF62868.1.
    AF202636 mRNA. Translation: AAG22490.1.
    AB056477 mRNA. Translation: BAB40692.1.
    AF153606 mRNA. Translation: AAD41088.1.
    AY358275 mRNA. Translation: AAQ88642.1. Different initiation.
    AK303269 mRNA. Translation: BAG64351.1.
    AK222489 mRNA. Translation: BAD96209.1.
    AK222524 mRNA. Translation: BAD96244.1.
    AC136469 Genomic DNA. No translation available.
    CH471139 Genomic DNA. Translation: EAW68930.1.
    CH471139 Genomic DNA. Translation: EAW68931.1.
    BC023647 mRNA. Translation: AAH23647.1.
    CCDSiCCDS12200.1. [Q9BY76-1]
    CCDS42493.1. [Q9BY76-2]
    RefSeqiNP_001034756.1. NM_001039667.2. [Q9BY76-2]
    NP_647475.1. NM_139314.2. [Q9BY76-1]
    UniGeneiHs.9613.

    Genome annotation databases

    EnsembliENST00000301455; ENSP00000301455; ENSG00000167772. [Q9BY76-1]
    ENST00000393962; ENSP00000377534; ENSG00000167772. [Q9BY76-2]
    ENST00000593998; ENSP00000472551; ENSG00000167772. [Q9BY76-1]
    GeneIDi51129.
    KEGGihsa:51129.
    UCSCiuc002mjq.1. human. [Q9BY76-1]

    Polymorphism databases

    DMDMi25008123.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF169312 mRNA. Translation: AAF62868.1 .
    AF202636 mRNA. Translation: AAG22490.1 .
    AB056477 mRNA. Translation: BAB40692.1 .
    AF153606 mRNA. Translation: AAD41088.1 .
    AY358275 mRNA. Translation: AAQ88642.1 . Different initiation.
    AK303269 mRNA. Translation: BAG64351.1 .
    AK222489 mRNA. Translation: BAD96209.1 .
    AK222524 mRNA. Translation: BAD96244.1 .
    AC136469 Genomic DNA. No translation available.
    CH471139 Genomic DNA. Translation: EAW68930.1 .
    CH471139 Genomic DNA. Translation: EAW68931.1 .
    BC023647 mRNA. Translation: AAH23647.1 .
    CCDSi CCDS12200.1. [Q9BY76-1 ]
    CCDS42493.1. [Q9BY76-2 ]
    RefSeqi NP_001034756.1. NM_001039667.2. [Q9BY76-2 ]
    NP_647475.1. NM_139314.2. [Q9BY76-1 ]
    UniGenei Hs.9613.

    3D structure databases

    ProteinModelPortali Q9BY76.
    SMRi Q9BY76. Positions 48-403.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119316. 4 interactions.
    IntActi Q9BY76. 4 interactions.
    STRINGi 9606.ENSP00000301455.

    PTM databases

    PhosphoSitei Q9BY76.

    Polymorphism databases

    DMDMi 25008123.

    Proteomic databases

    PaxDbi Q9BY76.
    PRIDEi Q9BY76.

    Protocols and materials databases

    DNASUi 51129.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000301455 ; ENSP00000301455 ; ENSG00000167772 . [Q9BY76-1 ]
    ENST00000393962 ; ENSP00000377534 ; ENSG00000167772 . [Q9BY76-2 ]
    ENST00000593998 ; ENSP00000472551 ; ENSG00000167772 . [Q9BY76-1 ]
    GeneIDi 51129.
    KEGGi hsa:51129.
    UCSCi uc002mjq.1. human. [Q9BY76-1 ]

    Organism-specific databases

    CTDi 51129.
    GeneCardsi GC19P008429.
    HGNCi HGNC:16039. ANGPTL4.
    HPAi HPA007879.
    MIMi 605910. gene.
    neXtProti NX_Q9BY76.
    PharmGKBi PA24797.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG281759.
    HOVERGENi HBG001644.
    InParanoidi Q9BY76.
    KOi K08767.
    OMAi VDFNRPW.
    PhylomeDBi Q9BY76.
    TreeFami TF329953.

    Enzyme and pathway databases

    Reactomei REACT_116145. PPARA activates gene expression.
    REACT_27161. Transcriptional regulation of white adipocyte differentiation.

    Miscellaneous databases

    GeneWikii ANGPTL4.
    GenomeRNAii 51129.
    NextBioi 35476680.
    PROi Q9BY76.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BY76.
    Bgeei Q9BY76.
    CleanExi HS_ANGPTL4.
    Genevestigatori Q9BY76.

    Family and domain databases

    Gene3Di 3.90.215.10. 2 hits.
    4.10.530.10. 1 hit.
    InterProi IPR028793. ANGPTL4.
    IPR014716. Fibrinogen_a/b/g_C_1.
    IPR014715. Fibrinogen_a/b/g_C_2.
    IPR002181. Fibrinogen_a/b/g_C_dom.
    IPR020837. Fibrinogen_CS.
    [Graphical view ]
    PANTHERi PTHR19143:SF16. PTHR19143:SF16. 1 hit.
    Pfami PF00147. Fibrinogen_C. 1 hit.
    [Graphical view ]
    SMARTi SM00186. FBG. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56496. SSF56496. 1 hit.
    PROSITEi PS00514. FIBRINOGEN_C_1. 1 hit.
    PS51406. FIBRINOGEN_C_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Hepatic expression, synthesis and secretion of a novel fibrinogen/angiopoietin-related protein that prevents endothelial-cell apoptosis."
      Kim I., Kim H.-G., Kim H., Kim H.-H., Park S.K., Uhm C.-S., Lee Z.H., Koh G.Y.
      Biochem. J. 346:603-610(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY, SUBCELLULAR LOCATION, GLYCOSYLATION, VARIANT MET-266.
    2. "Peroxisome proliferator-activated receptor gamma target gene encoding a novel angiopoietin-related protein associated with adipose differentiation."
      Yoon J.C., Chickering T.W., Rosen E.D., Dussault B., Qin Y., Soukas A., Friedman J.M., Holmes W.E., Spiegelman B.M.
      Mol. Cell. Biol. 20:5343-5349(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), POSSIBLE FUNCTION.
      Tissue: Aortic endothelium.
    3. "Cloning of a novel gene, ANGPTL4 and the functional study in angiogenesis."
      Zhu H., Li J., Qin W., Yang Y., He X., Wan D., Gu J.
      Zhonghua Yi Xue Za Zhi 82:94-99(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
      Tissue: Placenta.
    4. "Inhibition of angiogenesis and vascular leakiness by angiopoietin-related protein 4."
      Ito Y., Oike Y., Yasunaga K., Hamada K., Miyata K., Matsumoto S., Sugano S., Tanihara H., Masuho Y., Suda T.
      Cancer Res. 63:6651-6657(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION.
      Tissue: Placenta.
    5. "A catalogue of genes in the human dermal papilla cells as identified by expressed sequence tags."
      Kim M.K., Kim Y.H., Seo J.M., Lee H.M., Chung H.J., Sohn M.Y., Hwang S.Y., Im S.U., Jung E.J., Lee J.H., Kim J.C.
      Submitted (MAY-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Hair follicle dermal papilla.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Thymus.
    8. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-266.
      Tissue: Adipose tissue.
    9. "The DNA sequence and biology of human chromosome 19."
      Grimwood J., Gordon L.A., Olsen A.S., Terry A., Schmutz J., Lamerdin J.E., Hellsten U., Goodstein D., Couronne O., Tran-Gyamfi M., Aerts A., Altherr M., Ashworth L., Bajorek E., Black S., Branscomb E., Caenepeel S., Carrano A.V.
      , Caoile C., Chan Y.M., Christensen M., Cleland C.A., Copeland A., Dalin E., Dehal P., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Garcia C., Georgescu A.M., Glavina T., Gomez M., Gonzales E., Groza M., Hammon N., Hawkins T., Haydu L., Ho I., Huang W., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Larionov V., Leem S.-H., Lopez F., Lou Y., Lowry S., Malfatti S., Martinez D., McCready P.M., Medina C., Morgan J., Nelson K., Nolan M., Ovcharenko I., Pitluck S., Pollard M., Popkie A.P., Predki P., Quan G., Ramirez L., Rash S., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., She X., Smith D., Slezak T., Solovyev V., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wagner M., Wheeler J., Wu K., Xie G., Yang J., Dubchak I., Furey T.S., DeJong P., Dickson M., Gordon D., Eichler E.E., Pennacchio L.A., Richardson P., Stubbs L., Rokhsar D.S., Myers R.M., Rubin E.M., Lucas S.M.
      Nature 428:529-535(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    11. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Pancreas.
    12. "Expression and function of hepatocellular carcinoma-related gene pp1158."
      Zhu H., Li J., Wan D., Yang Y., Qin W., Ge C., Yao M., Gu J.
      Zhonghua Zhong Liu Za Zhi 24:123-125(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.
    13. "Population-based resequencing of ANGPTL4 uncovers variations that reduce triglycerides and increase HDL."
      Romeo S., Pennacchio L.A., Fu Y., Boerwinkle E., Tybjaerg-Hansen A., Hobbs H.H., Cohen J.C.
      Nat. Genet. 39:513-516(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: VARIANTS LEU-5; LYS-40; ILE-41; ARG-67; LEU-72; ARG-77; LYS-167; SER-174; GLN-190; LYS-196; CYS-230; ARG-233; VAL-237; THR-251; MET-266; GLN-278; MET-291; MET-293; VAL-296; SER-307; MET-308; CYS-336; GLU-338; CYS-349; SER-361; ARG-361; GLN-371 AND TRP-384.

    Entry informationi

    Entry nameiANGL4_HUMAN
    AccessioniPrimary (citable) accession number: Q9BY76
    Secondary accession number(s): A8MY84
    , B4E089, D6W670, F5H0I2, Q53HQ6, Q53HU1, Q6UXN0, Q9HBV4, Q9NZU4, Q9Y5B3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: November 8, 2002
    Last sequence update: November 8, 2002
    Last modified: October 1, 2014
    This is version 125 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3