Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BY66

- KDM5D_HUMAN

UniProt

Q9BY66 - KDM5D_HUMAN

Protein

Lysine-specific demethylase 5D

Gene

KDM5D

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 124 (01 Oct 2014)
      Sequence version 2 (24 Oct 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. May play a role in spermatogenesis.3 Publications

    Cofactori

    Ascorbate.1 Publication
    Binds 1 Fe2+ ion per subunit.1 Publication

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi504 – 5041Iron; catalyticPROSITE-ProRule annotation
    Metal bindingi507 – 5071Iron; catalyticPROSITE-ProRule annotation
    Metal bindingi592 – 5921Iron; catalyticPROSITE-ProRule annotation

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri316 – 36247PHD-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1174 – 123562PHD-type 2PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. DNA binding Source: InterPro
    2. histone demethylase activity (H3-K4 specific) Source: MGI
    3. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors Source: InterPro
    4. zinc ion binding Source: InterPro

    GO - Biological processi

    1. histone H3-K4 demethylation Source: MGI

    Keywords - Molecular functioni

    Chromatin regulator, Dioxygenase, Oxidoreductase

    Keywords - Ligandi

    Iron, Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Lysine-specific demethylase 5D (EC:1.14.11.-)
    Alternative name(s):
    Histocompatibility Y antigen
    Short name:
    H-Y
    Histone demethylase JARID1D
    Jumonji/ARID domain-containing protein 1D
    Protein SmcY
    Gene namesi
    Name:KDM5D
    Synonyms:HY, HYA, JARID1D, KIAA0234, SMCY
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome Y

    Organism-specific databases

    HGNCiHGNC:11115. KDM5D.

    Subcellular locationi

    Nucleus Curated

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Mutagenesis

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Mutagenesisi534 – 5341H → A: Abolishes enzymatic activity; when associated with A-536. 1 Publication
    Mutagenesisi536 – 5361E → A: Abolishes enzymatic activity; when associated with A-534. 1 Publication

    Organism-specific databases

    PharmGKBiPA35965.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 15391539Lysine-specific demethylase 5DPRO_0000200588Add
    BLAST

    Proteomic databases

    MaxQBiQ9BY66.
    PaxDbiQ9BY66.
    PRIDEiQ9BY66.

    PTM databases

    PhosphoSiteiQ9BY66.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9BY66.
    BgeeiQ9BY66.
    CleanExiHS_JARID1D.
    GenevestigatoriQ9BY66.

    Organism-specific databases

    HPAiHPA049086.

    Interactioni

    Subunit structurei

    Interacts with PCGF6 and MSH5.2 Publications

    Protein-protein interaction databases

    BioGridi113891. 3 interactions.
    IntActiQ9BY66. 1 interaction.
    STRINGi9606.ENSP00000322408.

    Structurei

    Secondary structure

    1
    1539
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi81 – 9616
    Beta strandi106 – 1094
    Helixi112 – 12211
    Helixi125 – 1306
    Turni131 – 1333
    Helixi134 – 1407
    Helixi149 – 15911
    Helixi161 – 1677
    Beta strandi318 – 3203
    Helixi324 – 3285
    Turni333 – 3353
    Beta strandi341 – 3466
    Helixi359 – 3668

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2E6RNMR-A306-384[»]
    2YQENMR-A79-171[»]
    ProteinModelPortaliQ9BY66.
    SMRiQ9BY66. Positions 13-76, 79-171, 309-606, 1173-1240.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9BY66.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini14 – 5542JmjNPROSITE-ProRule annotationAdd
    BLAST
    Domaini79 – 16991ARIDPROSITE-ProRule annotationAdd
    BLAST
    Domaini458 – 624167JmjCPROSITE-ProRule annotationAdd
    BLAST

    Domaini

    The JmjC domain is required for enzymatic activity.

    Sequence similaritiesi

    Belongs to the JARID1 histone demethylase family.Curated
    Contains 1 ARID domain.PROSITE-ProRule annotation
    Contains 1 JmjC domain.PROSITE-ProRule annotation
    Contains 1 JmjN domain.PROSITE-ProRule annotation
    Contains 2 PHD-type zinc fingers.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri316 – 36247PHD-type 1PROSITE-ProRule annotationAdd
    BLAST
    Zinc fingeri1174 – 123562PHD-type 2PROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG327026.
    HOGENOMiHOG000290719.
    InParanoidiQ9BY66.
    KOiK11446.
    OMAiGREEEHY.
    OrthoDBiEOG7D85VK.
    PhylomeDBiQ9BY66.
    TreeFamiTF106476.

    Family and domain databases

    Gene3Di1.10.150.60. 1 hit.
    3.30.40.10. 2 hits.
    InterProiIPR001606. ARID/BRIGHT_DNA-bd.
    IPR003347. JmjC_dom.
    IPR013637. Lys_sp_deMease_like_dom.
    IPR003349. TF_JmjN.
    IPR019786. Zinc_finger_PHD-type_CS.
    IPR004198. Znf_C5HC2.
    IPR011011. Znf_FYVE_PHD.
    IPR001965. Znf_PHD.
    IPR019787. Znf_PHD-finger.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view]
    PfamiPF01388. ARID. 1 hit.
    PF02373. JmjC. 1 hit.
    PF02375. JmjN. 1 hit.
    PF00628. PHD. 2 hits.
    PF08429. PLU-1. 1 hit.
    PF02928. zf-C5HC2. 1 hit.
    [Graphical view]
    SMARTiSM00501. BRIGHT. 1 hit.
    SM00558. JmjC. 1 hit.
    SM00545. JmjN. 1 hit.
    SM00249. PHD. 2 hits.
    [Graphical view]
    SUPFAMiSSF46774. SSF46774. 1 hit.
    SSF57903. SSF57903. 2 hits.
    PROSITEiPS51011. ARID. 1 hit.
    PS51184. JMJC. 1 hit.
    PS51183. JMJN. 1 hit.
    PS01359. ZF_PHD_1. 2 hits.
    PS50016. ZF_PHD_2. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Note: Additional isoforms seem to exist.

    Isoform 1 (identifier: Q9BY66-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEPGCDEFLP PPECPVFEPS WAEFQDPLGY IAKIRPIAEK SGICKIRPPA     50
    DWQPPFAVEV DNFRFTPRVQ RLNELEAQTR VKLNYLDQIA KFWEIQGSSL 100
    KIPNVERKIL DLYSLSKIVI EEGGYEAICK DRRWARVAQR LHYPPGKNIG 150
    SLLRSHYERI IYPYEMFQSG ANHVQCNTHP FDNEVKDKEY KPHSIPLRQS 200
    VQPSKFSSYS RRAKRLQPDP EPTEEDIEKH PELKKLQIYG PGPKMMGLGL 250
    MAKDKDKTVH KKVTCPPTVT VKDEQSGGGN VSSTLLKQHL SLEPCTKTTM 300
    QLRKNHSSAQ FIDSYICQVC SRGDEDDKLL FCDGCDDNYH IFCLLPPLPE 350
    IPRGIWRCPK CILAECKQPP EAFGFEQATQ EYSLQSFGEM ADSFKSDYFN 400
    MPVHMVPTEL VEKEFWRLVS SIEEDVTVEY GADIHSKEFG SGFPVSNSKQ 450
    NLSPEEKEYA TSGWNLNVMP VLDQSVLCHI NADISGMKVP WLYVGMVFSA 500
    FCWHIEDHWS YSINYLHWGE PKTWYGVPSL AAEHLEEVMK MLTPELFDSQ 550
    PDLLHQLVTL MNPNTLMSHG VPVVRTNQCA GEFVITFPRA YHSGFNQGYN 600
    FAEAVNFCTA DWLPAGRQCI EHYRRLRRYC VFSHEELICK MAAFPETLDL 650
    NLAVAVHKEM FIMVQEERRL RKALLEKGVT EAEREAFELL PDDERQCIKC 700
    KTTCFLSALA CYDCPDGLVC LSHINDLCKC SSSRQYLRYR YTLDELPTML 750
    HKLKIRAESF DTWANKVRVA LEVEDGRKRS FEELRALESE ARERRFPNSE 800
    LLQRLKNCLS EVEACIAQVL GLVSGQVARM DTPQLTLTEL RVLLEQMGSL 850
    PCAMHQIGDV KDVLEQVEAY QAEAREALAT LPSSPGLLRS LLERGQQLGV 900
    EVPEAHQLQQ QVEQAQWLDE VKQALAPSAH RGSLVIMQGL LVMGAKIASS 950
    PSVDKARAEL QELLTIAERW EEKAHFCLEA RQKHPPATLE AIIRETENIP 1000
    VHLPNIQALK EALTKAQAWI ADVDEIQNGD HYPCLDDLEG LVAVGRDLPV 1050
    GLEELRQLEL QVLTAHSWRE KASKTFLKKN SCYTLLEVLC PCADAGSDST 1100
    KRSRWMEKAL GLYQCDTELL GLSAQDLRDP GSVIVAFKEG EQKEKEGILQ 1150
    LRRTNSAKPS PLAPSLMASS PTSICVCGQV PAGVGVLQCD LCQDWFHGQC 1200
    VSVPHLLTSP KPSLTSSPLL AWWEWDTKFL CPLCMRSRRP RLETILALLV 1250
    ALQRLPVRLP EGEALQCLTE RAIGWQDRAR KALASEDVTA LLRQLAELRQ 1300
    QLQAKPRPEE ASVYTSATAC DPIREGSGNN ISKVQGLLEN GDSVTSPENM 1350
    APGKGSDLEL LSSLLPQLTG PVLELPEAIR APLEELMMEG DLLEVTLDEN 1400
    HSIWQLLQAG QPPDLDRIRT LLELEKFEHQ GSRTRSRALE RRRRRQKVDQ 1450
    GRNVENLVQQ ELQSKRARSS GIMSQVGREE EHYQEKADRE NMFLTPSTDH 1500
    SPFLKGNQNS LQHKDSGSSA ACPSLMPLLQ LSYSDEQQL 1539
    Length:1,539
    Mass (Da):174,073
    Last modified:October 24, 2001 - v2
    Checksum:iE58DAE374E3BD7AA
    GO
    Isoform 2 (identifier: Q9BY66-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         118-174: Missing.

    Show »
    Length:1,482
    Mass (Da):167,401
    Checksum:iF1A41999427CA63D
    GO
    Isoform 3 (identifier: Q9BY66-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         457-457: K → KRQSLTVLTRLISSFWAQAVLPPWPPKVLGLQ

    Note: No experimental confirmation available.

    Show »
    Length:1,570
    Mass (Da):177,558
    Checksum:i364A4C31873A1D57
    GO

    Sequence cautioni

    The sequence BAA13241.2 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti327 – 3271D → N in AAC50806. (PubMed:8841177)Curated
    Sequence conflicti327 – 3271D → N in AAC51135. (PubMed:9060413)Curated
    Sequence conflicti1285 – 12851S → F in AAC50806. (PubMed:8841177)Curated
    Sequence conflicti1352 – 13521P → L in AAK27839. 1 PublicationCurated
    Sequence conflicti1391 – 13911D → G in AAC50806. (PubMed:8841177)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti1186 – 11861V → L.1 Publication
    Corresponds to variant rs1050807 [ dbSNP | Ensembl ].
    VAR_032991

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei118 – 17457Missing in isoform 2. 2 PublicationsVSP_000317Add
    BLAST
    Alternative sequencei457 – 4571K → KRQSLTVLTRLISSFWAQAV LPPWPPKVLGLQ in isoform 3. 1 PublicationVSP_043320

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U52191 mRNA. Translation: AAC50806.1.
    D87072 mRNA. Translation: BAA13241.2. Different initiation.
    AF273841 Genomic DNA. Translation: AAG00951.1.
    AC010889 Genomic DNA. No translation available.
    CH471202 Genomic DNA. Translation: EAW54663.1.
    BC132721 mRNA. Translation: AAI32722.1.
    BC144102 mRNA. Translation: AAI44103.1.
    BC146767 mRNA. Translation: AAI46768.1.
    U52365 mRNA. Translation: AAC51135.1.
    AF134849 Genomic DNA. Translation: AAK27839.1.
    CCDSiCCDS14794.1. [Q9BY66-1]
    CCDS55554.1. [Q9BY66-2]
    CCDS55555.1. [Q9BY66-3]
    RefSeqiNP_001140177.1. NM_001146705.1. [Q9BY66-3]
    NP_001140178.1. NM_001146706.1. [Q9BY66-2]
    NP_004644.2. NM_004653.4. [Q9BY66-1]
    UniGeneiHs.80358.

    Genome annotation databases

    EnsembliENST00000317961; ENSP00000322408; ENSG00000012817. [Q9BY66-1]
    ENST00000382806; ENSP00000372256; ENSG00000012817. [Q9BY66-2]
    ENST00000541639; ENSP00000444293; ENSG00000012817. [Q9BY66-3]
    GeneIDi8284.
    KEGGihsa:8284.
    UCSCiuc004fug.3. human. [Q9BY66-1]
    uc010nwy.3. human. [Q9BY66-2]
    uc011naz.2. human. [Q9BY66-3]

    Polymorphism databases

    DMDMi17368706.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    U52191 mRNA. Translation: AAC50806.1 .
    D87072 mRNA. Translation: BAA13241.2 . Different initiation.
    AF273841 Genomic DNA. Translation: AAG00951.1 .
    AC010889 Genomic DNA. No translation available.
    CH471202 Genomic DNA. Translation: EAW54663.1 .
    BC132721 mRNA. Translation: AAI32722.1 .
    BC144102 mRNA. Translation: AAI44103.1 .
    BC146767 mRNA. Translation: AAI46768.1 .
    U52365 mRNA. Translation: AAC51135.1 .
    AF134849 Genomic DNA. Translation: AAK27839.1 .
    CCDSi CCDS14794.1. [Q9BY66-1 ]
    CCDS55554.1. [Q9BY66-2 ]
    CCDS55555.1. [Q9BY66-3 ]
    RefSeqi NP_001140177.1. NM_001146705.1. [Q9BY66-3 ]
    NP_001140178.1. NM_001146706.1. [Q9BY66-2 ]
    NP_004644.2. NM_004653.4. [Q9BY66-1 ]
    UniGenei Hs.80358.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2E6R NMR - A 306-384 [» ]
    2YQE NMR - A 79-171 [» ]
    ProteinModelPortali Q9BY66.
    SMRi Q9BY66. Positions 13-76, 79-171, 309-606, 1173-1240.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 113891. 3 interactions.
    IntActi Q9BY66. 1 interaction.
    STRINGi 9606.ENSP00000322408.

    Chemistry

    DrugBanki DB00126. Vitamin C.

    PTM databases

    PhosphoSitei Q9BY66.

    Polymorphism databases

    DMDMi 17368706.

    Proteomic databases

    MaxQBi Q9BY66.
    PaxDbi Q9BY66.
    PRIDEi Q9BY66.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000317961 ; ENSP00000322408 ; ENSG00000012817 . [Q9BY66-1 ]
    ENST00000382806 ; ENSP00000372256 ; ENSG00000012817 . [Q9BY66-2 ]
    ENST00000541639 ; ENSP00000444293 ; ENSG00000012817 . [Q9BY66-3 ]
    GeneIDi 8284.
    KEGGi hsa:8284.
    UCSCi uc004fug.3. human. [Q9BY66-1 ]
    uc010nwy.3. human. [Q9BY66-2 ]
    uc011naz.2. human. [Q9BY66-3 ]

    Organism-specific databases

    CTDi 8284.
    GeneCardsi GC0YM021865.
    GeneReviewsi KDM5D.
    HGNCi HGNC:11115. KDM5D.
    HPAi HPA049086.
    MIMi 426000. gene.
    neXtProti NX_Q9BY66.
    PharmGKBi PA35965.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG327026.
    HOGENOMi HOG000290719.
    InParanoidi Q9BY66.
    KOi K11446.
    OMAi GREEEHY.
    OrthoDBi EOG7D85VK.
    PhylomeDBi Q9BY66.
    TreeFami TF106476.

    Miscellaneous databases

    ChiTaRSi KDM5D. human.
    EvolutionaryTracei Q9BY66.
    GeneWikii JARID1D.
    GenomeRNAii 8284.
    NextBioi 31049.
    PROi Q9BY66.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BY66.
    Bgeei Q9BY66.
    CleanExi HS_JARID1D.
    Genevestigatori Q9BY66.

    Family and domain databases

    Gene3Di 1.10.150.60. 1 hit.
    3.30.40.10. 2 hits.
    InterProi IPR001606. ARID/BRIGHT_DNA-bd.
    IPR003347. JmjC_dom.
    IPR013637. Lys_sp_deMease_like_dom.
    IPR003349. TF_JmjN.
    IPR019786. Zinc_finger_PHD-type_CS.
    IPR004198. Znf_C5HC2.
    IPR011011. Znf_FYVE_PHD.
    IPR001965. Znf_PHD.
    IPR019787. Znf_PHD-finger.
    IPR013083. Znf_RING/FYVE/PHD.
    [Graphical view ]
    Pfami PF01388. ARID. 1 hit.
    PF02373. JmjC. 1 hit.
    PF02375. JmjN. 1 hit.
    PF00628. PHD. 2 hits.
    PF08429. PLU-1. 1 hit.
    PF02928. zf-C5HC2. 1 hit.
    [Graphical view ]
    SMARTi SM00501. BRIGHT. 1 hit.
    SM00558. JmjC. 1 hit.
    SM00545. JmjN. 1 hit.
    SM00249. PHD. 2 hits.
    [Graphical view ]
    SUPFAMi SSF46774. SSF46774. 1 hit.
    SSF57903. SSF57903. 2 hits.
    PROSITEi PS51011. ARID. 1 hit.
    PS51184. JMJC. 1 hit.
    PS51183. JMJN. 1 hit.
    PS01359. ZF_PHD_1. 2 hits.
    PS50016. ZF_PHD_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LEU-1186.
    2. "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
      Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
      DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Bone marrow.
    3. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
    7. "Analysis of mutation rates in the SMCY/SMCX genes shows that mammalian evolution is male driven."
      Agulnik A.I., Bishop C.E., Lerner J.L., Agulnik S.I., Solovyev V.V.
      Mamm. Genome 8:134-138(1997) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-457 (ISOFORM 1).
    8. "Exon-intron structure of SMCX and SMCY genes in bovine and swine."
      Poloumienko A., Blecher S.
      Submitted (MAR-1999) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1340-1478.
      Tissue: Blood.
    9. "Physical and functional association of a trimethyl H3K4 demethylase and Ring6a/MBLR, a polycomb-like protein."
      Lee M.G., Norman J., Shilatifard A., Shiekhattar R.
      Cell 128:877-887(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, COFACTOR, INTERACTION WITH PCGF6, MUTAGENESIS OF HIS-534 AND GLU-536.
    10. "The X-linked mental retardation gene SMCX/JARID1C defines a family of histone H3 lysine 4 demethylases."
      Iwase S., Lan F., Bayliss P., de la Torre-Ubieta L., Huarte M., Qi H.H., Whetstine J.R., Bonni A., Roberts T.M., Shi Y.
      Cell 128:1077-1088(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    11. "The trithorax-group gene in Drosophila little imaginal discs encodes a trimethylated histone H3 Lys4 demethylase."
      Eissenberg J.C., Lee M.G., Schneider J., Ilvarsonn A., Shiekhattar R., Shilatifard A.
      Nat. Struct. Mol. Biol. 14:344-346(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION.
    12. "Spermatogenesis-specific association of SMCY and MSH5."
      Akimoto C., Kitagawa H., Matsumoto T., Kato S.
      Genes Cells 13:623-633(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH MSH5.
    13. "Solution structure of the PHD domain and of the ARID domain of JARID1D/SMCY protein."
      RIKEN structural genomics initiative (RSGI)
      Submitted (APR-2008) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 79-384.

    Entry informationi

    Entry nameiKDM5D_HUMAN
    AccessioniPrimary (citable) accession number: Q9BY66
    Secondary accession number(s): A2RU19
    , A6H8V7, B7ZLX1, Q92509, Q92809, Q9HCU1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 24, 2001
    Last sequence update: October 24, 2001
    Last modified: October 1, 2014
    This is version 124 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome Y
      Human chromosome Y: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3