SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BY66

- KDM5D_HUMAN

UniProt

Q9BY66 - KDM5D_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Lysine-specific demethylase 5D

Gene
KDM5D, HY, HYA, JARID1D, KIAA0234, SMCY
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Histone demethylase that specifically demethylates 'Lys-4' of histone H3, thereby playing a central role in histone code. Does not demethylate histone H3 'Lys-9', H3 'Lys-27', H3 'Lys-36', H3 'Lys-79' or H4 'Lys-20'. Demethylates trimethylated and dimethylated but not monomethylated H3 'Lys-4'. May play a role in spermatogenesis.3 Publications

Cofactori

Ascorbate.1 Publication
Binds 1 Fe2+ ion per subunit.1 Publication

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi504 – 5041Iron; catalytic By similarity
Metal bindingi507 – 5071Iron; catalytic By similarity
Metal bindingi592 – 5921Iron; catalytic By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri316 – 36247PHD-type 1Add
BLAST
Zinc fingeri1174 – 123562PHD-type 2Add
BLAST

GO - Molecular functioni

  1. DNA binding Source: InterPro
  2. histone demethylase activity (H3-K4 specific) Source: MGI
  3. oxidoreductase activity, acting on paired donors, with incorporation or reduction of molecular oxygen, 2-oxoglutarate as one donor, and incorporation of one atom each of oxygen into both donors Source: InterPro
  4. zinc ion binding Source: InterPro

GO - Biological processi

  1. histone H3-K4 demethylation Source: MGI
Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator, Dioxygenase, Oxidoreductase

Keywords - Ligandi

Iron, Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
Lysine-specific demethylase 5D (EC:1.14.11.-)
Alternative name(s):
Histocompatibility Y antigen
Short name:
H-Y
Histone demethylase JARID1D
Jumonji/ARID domain-containing protein 1D
Protein SmcY
Gene namesi
Name:KDM5D
Synonyms:HY, HYA, JARID1D, KIAA0234, SMCY
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome Y

Organism-specific databases

HGNCiHGNC:11115. KDM5D.

Subcellular locationi

Nucleus Inferred

GO - Cellular componenti

  1. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi534 – 5341H → A: Abolishes enzymatic activity; when associated with A-536. 1 Publication
Mutagenesisi536 – 5361E → A: Abolishes enzymatic activity; when associated with A-534. 1 Publication

Organism-specific databases

PharmGKBiPA35965.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 15391539Lysine-specific demethylase 5DPRO_0000200588Add
BLAST

Proteomic databases

MaxQBiQ9BY66.
PaxDbiQ9BY66.
PRIDEiQ9BY66.

PTM databases

PhosphoSiteiQ9BY66.

Expressioni

Gene expression databases

ArrayExpressiQ9BY66.
BgeeiQ9BY66.
CleanExiHS_JARID1D.
GenevestigatoriQ9BY66.

Organism-specific databases

HPAiHPA049086.

Interactioni

Subunit structurei

Interacts with PCGF6 and MSH5.2 Publications

Protein-protein interaction databases

BioGridi113891. 3 interactions.
IntActiQ9BY66. 1 interaction.
STRINGi9606.ENSP00000322408.

Structurei

Secondary structure

1
1539
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi81 – 9616
Beta strandi106 – 1094
Helixi112 – 12211
Helixi125 – 1306
Turni131 – 1333
Helixi134 – 1407
Helixi149 – 15911
Helixi161 – 1677
Beta strandi318 – 3203
Helixi324 – 3285
Turni333 – 3353
Beta strandi341 – 3466
Helixi359 – 3668

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2E6RNMR-A306-384[»]
2YQENMR-A79-171[»]
ProteinModelPortaliQ9BY66.
SMRiQ9BY66. Positions 13-76, 79-171, 309-606, 1173-1240.

Miscellaneous databases

EvolutionaryTraceiQ9BY66.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini14 – 5542JmjNAdd
BLAST
Domaini79 – 16991ARIDAdd
BLAST
Domaini458 – 624167JmjCAdd
BLAST

Domaini

The JmjC domain is required for enzymatic activity.

Sequence similaritiesi

Contains 1 ARID domain.
Contains 1 JmjC domain.
Contains 1 JmjN domain.

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri316 – 36247PHD-type 1Add
BLAST
Zinc fingeri1174 – 123562PHD-type 2Add
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG327026.
HOGENOMiHOG000290719.
InParanoidiQ9BY66.
KOiK11446.
OMAiGREEEHY.
OrthoDBiEOG7D85VK.
PhylomeDBiQ9BY66.
TreeFamiTF106476.

Family and domain databases

Gene3Di1.10.150.60. 1 hit.
3.30.40.10. 2 hits.
InterProiIPR001606. ARID/BRIGHT_DNA-bd.
IPR003347. JmjC_dom.
IPR013637. Lys_sp_deMease_like_dom.
IPR003349. TF_JmjN.
IPR019786. Zinc_finger_PHD-type_CS.
IPR004198. Znf_C5HC2.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF01388. ARID. 1 hit.
PF02373. JmjC. 1 hit.
PF02375. JmjN. 1 hit.
PF00628. PHD. 2 hits.
PF08429. PLU-1. 1 hit.
PF02928. zf-C5HC2. 1 hit.
[Graphical view]
SMARTiSM00501. BRIGHT. 1 hit.
SM00558. JmjC. 1 hit.
SM00545. JmjN. 1 hit.
SM00249. PHD. 2 hits.
[Graphical view]
SUPFAMiSSF46774. SSF46774. 1 hit.
SSF57903. SSF57903. 2 hits.
PROSITEiPS51011. ARID. 1 hit.
PS51184. JMJC. 1 hit.
PS51183. JMJN. 1 hit.
PS01359. ZF_PHD_1. 2 hits.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Note: Additional isoforms seem to exist.

Isoform 1 (identifier: Q9BY66-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEPGCDEFLP PPECPVFEPS WAEFQDPLGY IAKIRPIAEK SGICKIRPPA     50
DWQPPFAVEV DNFRFTPRVQ RLNELEAQTR VKLNYLDQIA KFWEIQGSSL 100
KIPNVERKIL DLYSLSKIVI EEGGYEAICK DRRWARVAQR LHYPPGKNIG 150
SLLRSHYERI IYPYEMFQSG ANHVQCNTHP FDNEVKDKEY KPHSIPLRQS 200
VQPSKFSSYS RRAKRLQPDP EPTEEDIEKH PELKKLQIYG PGPKMMGLGL 250
MAKDKDKTVH KKVTCPPTVT VKDEQSGGGN VSSTLLKQHL SLEPCTKTTM 300
QLRKNHSSAQ FIDSYICQVC SRGDEDDKLL FCDGCDDNYH IFCLLPPLPE 350
IPRGIWRCPK CILAECKQPP EAFGFEQATQ EYSLQSFGEM ADSFKSDYFN 400
MPVHMVPTEL VEKEFWRLVS SIEEDVTVEY GADIHSKEFG SGFPVSNSKQ 450
NLSPEEKEYA TSGWNLNVMP VLDQSVLCHI NADISGMKVP WLYVGMVFSA 500
FCWHIEDHWS YSINYLHWGE PKTWYGVPSL AAEHLEEVMK MLTPELFDSQ 550
PDLLHQLVTL MNPNTLMSHG VPVVRTNQCA GEFVITFPRA YHSGFNQGYN 600
FAEAVNFCTA DWLPAGRQCI EHYRRLRRYC VFSHEELICK MAAFPETLDL 650
NLAVAVHKEM FIMVQEERRL RKALLEKGVT EAEREAFELL PDDERQCIKC 700
KTTCFLSALA CYDCPDGLVC LSHINDLCKC SSSRQYLRYR YTLDELPTML 750
HKLKIRAESF DTWANKVRVA LEVEDGRKRS FEELRALESE ARERRFPNSE 800
LLQRLKNCLS EVEACIAQVL GLVSGQVARM DTPQLTLTEL RVLLEQMGSL 850
PCAMHQIGDV KDVLEQVEAY QAEAREALAT LPSSPGLLRS LLERGQQLGV 900
EVPEAHQLQQ QVEQAQWLDE VKQALAPSAH RGSLVIMQGL LVMGAKIASS 950
PSVDKARAEL QELLTIAERW EEKAHFCLEA RQKHPPATLE AIIRETENIP 1000
VHLPNIQALK EALTKAQAWI ADVDEIQNGD HYPCLDDLEG LVAVGRDLPV 1050
GLEELRQLEL QVLTAHSWRE KASKTFLKKN SCYTLLEVLC PCADAGSDST 1100
KRSRWMEKAL GLYQCDTELL GLSAQDLRDP GSVIVAFKEG EQKEKEGILQ 1150
LRRTNSAKPS PLAPSLMASS PTSICVCGQV PAGVGVLQCD LCQDWFHGQC 1200
VSVPHLLTSP KPSLTSSPLL AWWEWDTKFL CPLCMRSRRP RLETILALLV 1250
ALQRLPVRLP EGEALQCLTE RAIGWQDRAR KALASEDVTA LLRQLAELRQ 1300
QLQAKPRPEE ASVYTSATAC DPIREGSGNN ISKVQGLLEN GDSVTSPENM 1350
APGKGSDLEL LSSLLPQLTG PVLELPEAIR APLEELMMEG DLLEVTLDEN 1400
HSIWQLLQAG QPPDLDRIRT LLELEKFEHQ GSRTRSRALE RRRRRQKVDQ 1450
GRNVENLVQQ ELQSKRARSS GIMSQVGREE EHYQEKADRE NMFLTPSTDH 1500
SPFLKGNQNS LQHKDSGSSA ACPSLMPLLQ LSYSDEQQL 1539
Length:1,539
Mass (Da):174,073
Last modified:October 24, 2001 - v2
Checksum:iE58DAE374E3BD7AA
GO
Isoform 2 (identifier: Q9BY66-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     118-174: Missing.

Show »
Length:1,482
Mass (Da):167,401
Checksum:iF1A41999427CA63D
GO
Isoform 3 (identifier: Q9BY66-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     457-457: K → KRQSLTVLTRLISSFWAQAVLPPWPPKVLGLQ

Note: No experimental confirmation available.

Show »
Length:1,570
Mass (Da):177,558
Checksum:i364A4C31873A1D57
GO

Sequence cautioni

The sequence BAA13241.2 differs from that shown. Reason: Erroneous initiation.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti1186 – 11861V → L.1 Publication
Corresponds to variant rs1050807 [ dbSNP | Ensembl ].
VAR_032991

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei118 – 17457Missing in isoform 2. VSP_000317Add
BLAST
Alternative sequencei457 – 4571K → KRQSLTVLTRLISSFWAQAV LPPWPPKVLGLQ in isoform 3. VSP_043320

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti327 – 3271D → N in AAC50806. 1 Publication
Sequence conflicti327 – 3271D → N in AAC51135. 1 Publication
Sequence conflicti1285 – 12851S → F in AAC50806. 1 Publication
Sequence conflicti1352 – 13521P → L in AAK27839. 1 Publication
Sequence conflicti1391 – 13911D → G in AAC50806. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U52191 mRNA. Translation: AAC50806.1.
D87072 mRNA. Translation: BAA13241.2. Different initiation.
AF273841 Genomic DNA. Translation: AAG00951.1.
AC010889 Genomic DNA. No translation available.
CH471202 Genomic DNA. Translation: EAW54663.1.
BC132721 mRNA. Translation: AAI32722.1.
BC144102 mRNA. Translation: AAI44103.1.
BC146767 mRNA. Translation: AAI46768.1.
U52365 mRNA. Translation: AAC51135.1.
AF134849 Genomic DNA. Translation: AAK27839.1.
CCDSiCCDS14794.1. [Q9BY66-1]
CCDS55554.1. [Q9BY66-2]
CCDS55555.1. [Q9BY66-3]
RefSeqiNP_001140177.1. NM_001146705.1. [Q9BY66-3]
NP_001140178.1. NM_001146706.1. [Q9BY66-2]
NP_004644.2. NM_004653.4. [Q9BY66-1]
UniGeneiHs.80358.

Genome annotation databases

EnsembliENST00000317961; ENSP00000322408; ENSG00000012817. [Q9BY66-1]
ENST00000382806; ENSP00000372256; ENSG00000012817. [Q9BY66-2]
ENST00000541639; ENSP00000444293; ENSG00000012817. [Q9BY66-3]
GeneIDi8284.
KEGGihsa:8284.
UCSCiuc004fug.3. human. [Q9BY66-1]
uc010nwy.3. human. [Q9BY66-2]
uc011naz.2. human. [Q9BY66-3]

Polymorphism databases

DMDMi17368706.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
U52191 mRNA. Translation: AAC50806.1 .
D87072 mRNA. Translation: BAA13241.2 . Different initiation.
AF273841 Genomic DNA. Translation: AAG00951.1 .
AC010889 Genomic DNA. No translation available.
CH471202 Genomic DNA. Translation: EAW54663.1 .
BC132721 mRNA. Translation: AAI32722.1 .
BC144102 mRNA. Translation: AAI44103.1 .
BC146767 mRNA. Translation: AAI46768.1 .
U52365 mRNA. Translation: AAC51135.1 .
AF134849 Genomic DNA. Translation: AAK27839.1 .
CCDSi CCDS14794.1. [Q9BY66-1 ]
CCDS55554.1. [Q9BY66-2 ]
CCDS55555.1. [Q9BY66-3 ]
RefSeqi NP_001140177.1. NM_001146705.1. [Q9BY66-3 ]
NP_001140178.1. NM_001146706.1. [Q9BY66-2 ]
NP_004644.2. NM_004653.4. [Q9BY66-1 ]
UniGenei Hs.80358.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2E6R NMR - A 306-384 [» ]
2YQE NMR - A 79-171 [» ]
ProteinModelPortali Q9BY66.
SMRi Q9BY66. Positions 13-76, 79-171, 309-606, 1173-1240.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 113891. 3 interactions.
IntActi Q9BY66. 1 interaction.
STRINGi 9606.ENSP00000322408.

Chemistry

DrugBanki DB00126. Vitamin C.

PTM databases

PhosphoSitei Q9BY66.

Polymorphism databases

DMDMi 17368706.

Proteomic databases

MaxQBi Q9BY66.
PaxDbi Q9BY66.
PRIDEi Q9BY66.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000317961 ; ENSP00000322408 ; ENSG00000012817 . [Q9BY66-1 ]
ENST00000382806 ; ENSP00000372256 ; ENSG00000012817 . [Q9BY66-2 ]
ENST00000541639 ; ENSP00000444293 ; ENSG00000012817 . [Q9BY66-3 ]
GeneIDi 8284.
KEGGi hsa:8284.
UCSCi uc004fug.3. human. [Q9BY66-1 ]
uc010nwy.3. human. [Q9BY66-2 ]
uc011naz.2. human. [Q9BY66-3 ]

Organism-specific databases

CTDi 8284.
GeneCardsi GC0YM021865.
GeneReviewsi KDM5D.
HGNCi HGNC:11115. KDM5D.
HPAi HPA049086.
MIMi 426000. gene.
neXtProti NX_Q9BY66.
PharmGKBi PA35965.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG327026.
HOGENOMi HOG000290719.
InParanoidi Q9BY66.
KOi K11446.
OMAi GREEEHY.
OrthoDBi EOG7D85VK.
PhylomeDBi Q9BY66.
TreeFami TF106476.

Miscellaneous databases

ChiTaRSi KDM5D. human.
EvolutionaryTracei Q9BY66.
GeneWikii JARID1D.
GenomeRNAii 8284.
NextBioi 31049.
PROi Q9BY66.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9BY66.
Bgeei Q9BY66.
CleanExi HS_JARID1D.
Genevestigatori Q9BY66.

Family and domain databases

Gene3Di 1.10.150.60. 1 hit.
3.30.40.10. 2 hits.
InterProi IPR001606. ARID/BRIGHT_DNA-bd.
IPR003347. JmjC_dom.
IPR013637. Lys_sp_deMease_like_dom.
IPR003349. TF_JmjN.
IPR019786. Zinc_finger_PHD-type_CS.
IPR004198. Znf_C5HC2.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view ]
Pfami PF01388. ARID. 1 hit.
PF02373. JmjC. 1 hit.
PF02375. JmjN. 1 hit.
PF00628. PHD. 2 hits.
PF08429. PLU-1. 1 hit.
PF02928. zf-C5HC2. 1 hit.
[Graphical view ]
SMARTi SM00501. BRIGHT. 1 hit.
SM00558. JmjC. 1 hit.
SM00545. JmjN. 1 hit.
SM00249. PHD. 2 hits.
[Graphical view ]
SUPFAMi SSF46774. SSF46774. 1 hit.
SSF57903. SSF57903. 2 hits.
PROSITEi PS51011. ARID. 1 hit.
PS51184. JMJC. 1 hit.
PS51183. JMJN. 1 hit.
PS01359. ZF_PHD_1. 2 hits.
PS50016. ZF_PHD_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT LEU-1186.
  2. "Prediction of the coding sequences of unidentified human genes. VI. The coding sequences of 80 new genes (KIAA0201-KIAA0280) deduced by analysis of cDNA clones from cell line KG-1 and brain."
    Nagase T., Seki N., Ishikawa K., Ohira M., Kawarabayasi Y., Ohara O., Tanaka A., Kotani H., Miyajima N., Nomura N.
    DNA Res. 3:321-329(1996) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Bone marrow.
  3. Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] (ISOFORM 1).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3).
  7. "Analysis of mutation rates in the SMCY/SMCX genes shows that mammalian evolution is male driven."
    Agulnik A.I., Bishop C.E., Lerner J.L., Agulnik S.I., Solovyev V.V.
    Mamm. Genome 8:134-138(1997) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-457 (ISOFORM 1).
  8. "Exon-intron structure of SMCX and SMCY genes in bovine and swine."
    Poloumienko A., Blecher S.
    Submitted (MAR-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [GENOMIC DNA] OF 1340-1478.
    Tissue: Blood.
  9. "Physical and functional association of a trimethyl H3K4 demethylase and Ring6a/MBLR, a polycomb-like protein."
    Lee M.G., Norman J., Shilatifard A., Shiekhattar R.
    Cell 128:877-887(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, COFACTOR, INTERACTION WITH PCGF6, MUTAGENESIS OF HIS-534 AND GLU-536.
  10. "The X-linked mental retardation gene SMCX/JARID1C defines a family of histone H3 lysine 4 demethylases."
    Iwase S., Lan F., Bayliss P., de la Torre-Ubieta L., Huarte M., Qi H.H., Whetstine J.R., Bonni A., Roberts T.M., Shi Y.
    Cell 128:1077-1088(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  11. "The trithorax-group gene in Drosophila little imaginal discs encodes a trimethylated histone H3 Lys4 demethylase."
    Eissenberg J.C., Lee M.G., Schneider J., Ilvarsonn A., Shiekhattar R., Shilatifard A.
    Nat. Struct. Mol. Biol. 14:344-346(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION.
  12. "Spermatogenesis-specific association of SMCY and MSH5."
    Akimoto C., Kitagawa H., Matsumoto T., Kato S.
    Genes Cells 13:623-633(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH MSH5.
  13. "Solution structure of the PHD domain and of the ARID domain of JARID1D/SMCY protein."
    RIKEN structural genomics initiative (RSGI)
    Submitted (APR-2008) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 79-384.

Entry informationi

Entry nameiKDM5D_HUMAN
AccessioniPrimary (citable) accession number: Q9BY66
Secondary accession number(s): A2RU19
, A6H8V7, B7ZLX1, Q92509, Q92809, Q9HCU1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 24, 2001
Last sequence update: October 24, 2001
Last modified: July 9, 2014
This is version 123 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome Y
    Human chromosome Y: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi