Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BY07

- S4A5_HUMAN

UniProt

Q9BY07 - S4A5_HUMAN

Protein

Electrogenic sodium bicarbonate cotransporter 4

Gene

SLC4A5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 101 (01 Oct 2014)
      Sequence version 2 (08 Apr 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Mediates sodium- and bicarbonate-dependent electrogenic sodium bicarbonate cotransport, with a Na+:HCO3- stoichiometry of 2:1. May have a housekeeping function in regulating the pH of tissues in which it is expressed. May play a role in mediating Na+:HCO3- cotransport in hepatocytes and intrahepatic cholangiocytes. Also may be important in protecting the renal paranchyma from alterations in urine pH.By similarity3 Publications

    Enzyme regulationi

    Activity is inhibited by 4,4'-di-isothiocyanatostilbene-2,2'-disulfonic acid (DIDS - an inhibitor of several anion channels and transporters).

    GO - Molecular functioni

    1. inorganic anion exchanger activity Source: InterPro
    2. sodium:bicarbonate symporter activity Source: UniProtKB

    GO - Biological processi

    1. bicarbonate transport Source: UniProtKB
    2. ion transport Source: Reactome
    3. sodium ion transmembrane transport Source: GOC
    4. transmembrane transport Source: Reactome

    Keywords - Biological processi

    Anion exchange, Ion transport, Sodium transport, Transport

    Keywords - Ligandi

    Sodium

    Enzyme and pathway databases

    ReactomeiREACT_19298. Bicarbonate transporters.

    Protein family/group databases

    TCDBi2.A.31.2.8. the anion exchanger (ae) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Electrogenic sodium bicarbonate cotransporter 4
    Alternative name(s):
    NBCe2
    Solute carrier family 4 member 5
    Gene namesi
    Name:SLC4A5Imported
    Synonyms:NBC4Imported
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 2

    Organism-specific databases

    HGNCiHGNC:18168. SLC4A5.

    Subcellular locationi

    Apical cell membrane 1 Publication; Multi-pass membrane protein 1 Publication
    Note: Expressed in the apical plasma membrane domain of a subset of collecting ducts in the renal medulla.1 Publication

    GO - Cellular componenti

    1. apical plasma membrane Source: UniProtKB-SubCell
    2. integral component of membrane Source: UniProtKB
    3. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Cell membrane, Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA164742397.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 11371137Electrogenic sodium bicarbonate cotransporter 4PRO_0000328920Add
    BLAST

    Proteomic databases

    MaxQBiQ9BY07.
    PaxDbiQ9BY07.
    PRIDEiQ9BY07.

    PTM databases

    PhosphoSiteiQ9BY07.

    Expressioni

    Tissue specificityi

    Highest expression observed in liver, spleen and testis; moderate expression in the choroid plexus, hippocampus, cerebrum and cerebellum of brain, and in kidney cortex and kidney medulla. Also observed in heart, pancreas, muscle, lung, placenta, stomach and small intestine. Weakest expression seen in peripheral blood lymphocytes, colon, duodenum, jejunum, ileum and skeletal muscle.4 Publications

    Gene expression databases

    BgeeiQ9BY07.
    CleanExiHS_SLC4A5.
    GenevestigatoriQ9BY07.

    Organism-specific databases

    HPAiHPA036621.

    Interactioni

    Protein-protein interaction databases

    IntActiQ9BY07. 1 interaction.
    MINTiMINT-6489517.
    STRINGi9606.ENSP00000350475.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BY07.
    SMRiQ9BY07. Positions 113-402.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 523523CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini545 – 56622ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini588 – 60821CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini630 – 63910ExtracellularSequence Analysis
    Topological domaini661 – 73878CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini760 – 77617ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini798 – 82730CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini849 – 87325ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini895 – 93036CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini952 – 9521ExtracellularSequence Analysis
    Topological domaini974 – 101138CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini1054 – 113784ExtracellularSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei524 – 54421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei567 – 58721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei609 – 62921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei640 – 66021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei739 – 75921HelicalSequence AnalysisAdd
    BLAST
    Transmembranei777 – 79721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei828 – 84821HelicalSequence AnalysisAdd
    BLAST
    Transmembranei874 – 89421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei931 – 95121HelicalSequence AnalysisAdd
    BLAST
    Transmembranei953 – 97321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1012 – 103221HelicalSequence AnalysisAdd
    BLAST
    Transmembranei1033 – 105321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi433 – 49765Gly-richSequence AnalysisAdd
    BLAST

    Sequence similaritiesi

    Belongs to the anion exchanger (TC 2.A.31) family. [View classification]Sequence Analysis

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG318437.
    HOVERGENiHBG004326.
    InParanoidiQ9BY07.
    KOiK13857.
    OMAiELIWTGR.
    OrthoDBiEOG7TMZR0.
    PhylomeDBiQ9BY07.
    TreeFamiTF313630.

    Family and domain databases

    Gene3Di3.40.1100.10. 1 hit.
    InterProiIPR013769. Band3_cytoplasmic_dom.
    IPR011531. HCO3_transpt_C.
    IPR003020. HCO3_transpt_euk.
    IPR003024. Na/HCO3_transpt.
    IPR016152. PTrfase/Anion_transptr.
    [Graphical view]
    PANTHERiPTHR11453. PTHR11453. 1 hit.
    PfamiPF07565. Band_3_cyto. 1 hit.
    PF00955. HCO3_cotransp. 1 hit.
    [Graphical view]
    PRINTSiPR01231. HCO3TRNSPORT.
    PR01232. NAHCO3TRSPRT.
    SUPFAMiSSF55804. SSF55804. 1 hit.
    TIGRFAMsiTIGR00834. ae. 1 hit.

    Sequences (8)i

    Sequence statusi: Complete.

    This entry describes 8 isoformsi produced by alternative splicing. Align

    Isoform 11 Publication (identifier: Q9BY07-1) [UniParc]FASTAAdd to Basket

    Also known as: NBC4a1 Publication

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MKVKEEKAGV GKLDHTNHRR RFPDQKECPP IHIGLPVPTY PQRKTDQKGH     50
    LSGLQKVHWG LRPDQPQQEL TGPGSGASSQ DSSMDLISRT RSPAAEQLQD 100
    ILGEEDEAPN PTLFTEMDTL QHDGDQMEWK ESARWIKFEE KVEEGGERWS 150
    KPHVSTLSLH SLFELRTCLQ TGTVLLDLDS GSLPQIIDDV IEKQIEDGLL 200
    RPELRERVSY VLLRRHRHQT KKPIHRSLAD IGKSVSTTNR SPARSPGAGP 250
    SLHHSTEDLR MRQSANYGRL CHAQSRSMND ISLTPNTDQR KNKFMKKIPK 300
    DSEASNVLVG EVDFLDQPFI AFVRLIQSAM LGGVTEVPVP TRFLFILLGP 350
    SGRAKSYNEI GRAIATLMVD DLFSDVAYKA RNREDLIAGI DEFLDEVIVL 400
    PPGEWDPNIR IEPPKKVPSA DKRKSVFSLA ELGQMNGSVG GGGGAPGGGN 450
    GGGGGGGSGG GAGSGGAGGT SSGDDGEMPA MHEIGEELIW TGRFFGGLCL 500
    DIKRKLPWFP SDFYDGFHIQ SISAILFIYL GCITNAITFG GLLGDATDNY 550
    QGVMESFLGT AMAGSLFCLF SGQPLIILSS TGPILIFEKL LFDFSKGNGL 600
    DYMEFRLWIG LHSAVQCLIL VATDASFIIK YITRFTEEGF STLISFIFIY 650
    DAIKKMIGAF KYYPINMDFK PNFITTYKCE CVAPDTVNTT VFNASAPLAP 700
    DTNASLYNLL NLTALDWSLL SKKECLSYGG RLLGNSCKFI PDLALMSFIL 750
    FFGTYSMTLT LKKFKFSRYF PTKVRALVAD FSIVFSILMF CGIDACFGLE 800
    TPKLHVPSVI KPTRPDRGWF VAPFGKNPWW VYPASILPAL LVTILIFMDQ 850
    QITAVIVNRK ENKLKKAAGY HLDLFWVGIL MALCSFMGLP WYVAATVISI 900
    AHIDSLKMET ETSAPGEQPQ FLGVREQRVT GIIVFILTGI SVFLAPILKC 950
    IPLPVLYGVF LYMGVASLNG IQMGTGGSEF KIQKKLTPFW ERCKLFLMPA 1000
    KHQPDHAFLR HVPLRRIHLF TLVQILCLAV LWILKSTVAA IIFPVMILGL 1050
    IIVRRLLDFI FSQHDLAWID NILPEKEKKE TDKKRKRKKG AHEDCDEEPQ 1100
    FPPPSVIKIP MESVQSDPQN GIHCIARKRS SSWSYSL 1137
    Length:1,137
    Mass (Da):126,255
    Last modified:April 8, 2008 - v2
    Checksum:iED4E4A4DC2CA17F1
    GO
    Isoform 22 Publications (identifier: Q9BY07-2) [UniParc]FASTAAdd to Basket

    Also known as: NBC4b1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         1046-1046: M → MSLSTTD

    Show »
    Length:1,143
    Mass (Da):126,860
    Checksum:i3C32B411955873FD
    GO
    Isoform 31 Publication (identifier: Q9BY07-3) [UniParc]FASTAAdd to Basket

    Also known as: NBC4c1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         973-988: Missing.

    Show »
    Length:1,121
    Mass (Da):124,551
    Checksum:iDC17DB7C69ABD27D
    GO
    Isoform 41 Publication (identifier: Q9BY07-4) [UniParc]FASTAAdd to Basket

    Also known as: NBC4d1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         950-1046: Missing.

    Show »
    Length:1,040
    Mass (Da):115,240
    Checksum:iFEE31CEF13F4F57B
    GO
    Isoform 5 (identifier: Q9BY07-5) [UniParc]FASTAAdd to Basket

    Also known as: isoform d variant

    The sequence of this isoform differs from the canonical sequence as follows:
         88-91: SRTR → EHKG
         866-993: KAAGYHLDLF...KKLTPFWERC → GTESNRHHRL...HLFPARPGLD
         994-1137: Missing.

    Note: No experimental confirmation available. Incomplete sequence.Curated

    Show »
    Length:993
    Mass (Da):108,663
    Checksum:i9C45DA4AC127035F
    GO
    Isoform 61 Publication (identifier: Q9BY07-6) [UniParc]FASTAAdd to Basket

    Also known as: NBC4f1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         774-811: Missing.
         866-924: Missing.
         973-988: Missing.
         1046-1046: M → MSLSTTD
         1071-1075: NILPE → KIEFP
         1076-1137: Missing.

    Show »
    Length:968
    Mass (Da):107,526
    Checksum:i61243CD7DF614154
    GO
    Isoform 71 Publication (identifier: Q9BY07-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         27-91: ECPPIHIGLPVPTYPQRKTDQKGHLSGLQKVHWGLRPDQPQQELTGPGSGASSQDSSMDLISRTR → G
         774-811: Missing.
         973-988: Missing.

    Note: No experimental confirmation available.Curated

    Show »
    Length:1,019
    Mass (Da):113,390
    Checksum:i93AAC3C3E0649931
    GO
    Isoform 81 Publication (identifier: Q9BY07-8) [UniParc]FASTAAdd to Basket

    Also known as: NBC4e1 Publication

    The sequence of this isoform differs from the canonical sequence as follows:
         1068-1137: Missing.

    Show »
    Length:1,067
    Mass (Da):118,125
    Checksum:i7D1BA0C19F65AC3F
    GO

    Sequence cautioni

    The sequence AAG18492.1 differs from that shown. Reason: Frameshift at position 1047.
    The sequence AAL50802.1 differs from that shown. Reason: Frameshift at positions 760, 925 and 1047.
    The sequence EAW99691.1 differs from that shown. Reason: Frameshift at position 1047.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti612 – 6121H → Y in AAL48291. (PubMed:12388414)Curated
    Sequence conflicti612 – 6121H → Y in AAL50802. (PubMed:12388414)Curated
    Sequence conflicti699 – 6991A → T in AAL48291. (PubMed:12388414)Curated
    Sequence conflicti759 – 7591L → R in AAL50802. (PubMed:12388414)Curated
    Sequence conflicti813 – 8131T → P in AAK26741. (PubMed:11087115)Curated
    Sequence conflicti896 – 8961T → M in AAL48291. (PubMed:12388414)Curated
    Sequence conflicti923 – 9231G → R in AAL48291. (PubMed:12388414)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti251 – 2511S → N.
    Corresponds to variant rs17009792 [ dbSNP | Ensembl ].
    VAR_048350
    Natural varianti253 – 2531H → Y.1 Publication
    Corresponds to variant rs55651232 [ dbSNP | Ensembl ].
    VAR_061032

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei27 – 9165ECPPI…ISRTR → G in isoform 7. 1 PublicationVSP_052770Add
    BLAST
    Alternative sequencei88 – 914SRTR → EHKG in isoform 5. 1 PublicationVSP_052771
    Alternative sequencei774 – 81138Missing in isoform 6 and isoform 7. 2 PublicationsVSP_052772Add
    BLAST
    Alternative sequencei866 – 993128KAAGY…FWERC → GTESNRHHRLHPDGNLCLPG SHPKVYPPAGAVRSLPLHGR GLPEWHPVLGTLQALPDASQ APAGPCLPAARAAAPDPPLH PGADPLPGGALDPQIHGGCH HLPGHDPGPHHRSKASGFHL FPARPGLD in isoform 5. 1 PublicationVSP_052773Add
    BLAST
    Alternative sequencei866 – 92459Missing in isoform 6. 1 PublicationVSP_052774Add
    BLAST
    Alternative sequencei950 – 104697Missing in isoform 4. 1 PublicationVSP_052775Add
    BLAST
    Alternative sequencei973 – 98816Missing in isoform 3, isoform 6 and isoform 7. 4 PublicationsVSP_052776Add
    BLAST
    Alternative sequencei994 – 1137144Missing in isoform 5. 1 PublicationVSP_052777Add
    BLAST
    Alternative sequencei1046 – 10461M → MSLSTTD in isoform 2 and isoform 6. 3 PublicationsVSP_052778
    Alternative sequencei1068 – 113770Missing in isoform 8. 1 PublicationVSP_052779Add
    BLAST
    Alternative sequencei1071 – 10755NILPE → KIEFP in isoform 6. 1 PublicationVSP_052780
    Alternative sequencei1076 – 113762Missing in isoform 6. 1 PublicationVSP_052781Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF207661 mRNA. Translation: AAG18492.1. Frameshift.
    AF243499 mRNA. Translation: AAK26741.1.
    AF293338 mRNA. Translation: AAK97073.1.
    AF293337 mRNA. Translation: AAK97072.1.
    AF452248 mRNA. Translation: AAL48291.1.
    AF453528 mRNA. Translation: AAL50802.1. Frameshift.
    CH471053 Genomic DNA. Translation: EAW99690.1.
    CH471053 Genomic DNA. Translation: EAW99691.1. Frameshift.
    CH471053 Genomic DNA. Translation: EAW99693.1.
    BC109221 mRNA. Translation: AAI09222.1.
    AB209752 mRNA. Translation: BAD92989.1.
    CCDSiCCDS1936.1. [Q9BY07-1]
    CCDS1937.1. [Q9BY07-3]
    RefSeqiNP_067019.3. NM_021196.3. [Q9BY07-1]
    NP_597812.1. NM_133478.2. [Q9BY07-3]
    UniGeneiHs.594099.

    Genome annotation databases

    EnsembliENST00000346834; ENSP00000251768; ENSG00000188687. [Q9BY07-4]
    ENST00000358683; ENSP00000351513; ENSG00000188687. [Q9BY07-7]
    ENST00000377632; ENSP00000366859; ENSG00000188687. [Q9BY07-4]
    ENST00000377634; ENSP00000366861; ENSG00000188687. [Q9BY07-1]
    ENST00000394019; ENSP00000377587; ENSG00000188687. [Q9BY07-3]
    GeneIDi57835.
    KEGGihsa:57835.
    UCSCiuc002skn.3. human. [Q9BY07-3]
    uc002sko.1. human. [Q9BY07-1]
    uc002skp.1. human. [Q9BY07-7]
    uc010ffc.1. human. [Q9BY07-4]

    Polymorphism databases

    DMDMi182691595.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF207661 mRNA. Translation: AAG18492.1 . Frameshift.
    AF243499 mRNA. Translation: AAK26741.1 .
    AF293338 mRNA. Translation: AAK97073.1 .
    AF293337 mRNA. Translation: AAK97072.1 .
    AF452248 mRNA. Translation: AAL48291.1 .
    AF453528 mRNA. Translation: AAL50802.1 . Frameshift.
    CH471053 Genomic DNA. Translation: EAW99690.1 .
    CH471053 Genomic DNA. Translation: EAW99691.1 . Frameshift.
    CH471053 Genomic DNA. Translation: EAW99693.1 .
    BC109221 mRNA. Translation: AAI09222.1 .
    AB209752 mRNA. Translation: BAD92989.1 .
    CCDSi CCDS1936.1. [Q9BY07-1 ]
    CCDS1937.1. [Q9BY07-3 ]
    RefSeqi NP_067019.3. NM_021196.3. [Q9BY07-1 ]
    NP_597812.1. NM_133478.2. [Q9BY07-3 ]
    UniGenei Hs.594099.

    3D structure databases

    ProteinModelPortali Q9BY07.
    SMRi Q9BY07. Positions 113-402.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q9BY07. 1 interaction.
    MINTi MINT-6489517.
    STRINGi 9606.ENSP00000350475.

    Chemistry

    DrugBanki DB01390. Sodium bicarbonate.

    Protein family/group databases

    TCDBi 2.A.31.2.8. the anion exchanger (ae) family.

    PTM databases

    PhosphoSitei Q9BY07.

    Polymorphism databases

    DMDMi 182691595.

    Proteomic databases

    MaxQBi Q9BY07.
    PaxDbi Q9BY07.
    PRIDEi Q9BY07.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000346834 ; ENSP00000251768 ; ENSG00000188687 . [Q9BY07-4 ]
    ENST00000358683 ; ENSP00000351513 ; ENSG00000188687 . [Q9BY07-7 ]
    ENST00000377632 ; ENSP00000366859 ; ENSG00000188687 . [Q9BY07-4 ]
    ENST00000377634 ; ENSP00000366861 ; ENSG00000188687 . [Q9BY07-1 ]
    ENST00000394019 ; ENSP00000377587 ; ENSG00000188687 . [Q9BY07-3 ]
    GeneIDi 57835.
    KEGGi hsa:57835.
    UCSCi uc002skn.3. human. [Q9BY07-3 ]
    uc002sko.1. human. [Q9BY07-1 ]
    uc002skp.1. human. [Q9BY07-7 ]
    uc010ffc.1. human. [Q9BY07-4 ]

    Organism-specific databases

    CTDi 57835.
    GeneCardsi GC02M074443.
    HGNCi HGNC:18168. SLC4A5.
    HPAi HPA036621.
    MIMi 606757. gene.
    neXtProti NX_Q9BY07.
    PharmGKBi PA164742397.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG318437.
    HOVERGENi HBG004326.
    InParanoidi Q9BY07.
    KOi K13857.
    OMAi ELIWTGR.
    OrthoDBi EOG7TMZR0.
    PhylomeDBi Q9BY07.
    TreeFami TF313630.

    Enzyme and pathway databases

    Reactomei REACT_19298. Bicarbonate transporters.

    Miscellaneous databases

    ChiTaRSi SLC4A5. human.
    GeneWikii SLC4A5.
    GenomeRNAii 57835.
    NextBioi 64831.
    PROi Q9BY07.
    SOURCEi Search...

    Gene expression databases

    Bgeei Q9BY07.
    CleanExi HS_SLC4A5.
    Genevestigatori Q9BY07.

    Family and domain databases

    Gene3Di 3.40.1100.10. 1 hit.
    InterProi IPR013769. Band3_cytoplasmic_dom.
    IPR011531. HCO3_transpt_C.
    IPR003020. HCO3_transpt_euk.
    IPR003024. Na/HCO3_transpt.
    IPR016152. PTrfase/Anion_transptr.
    [Graphical view ]
    PANTHERi PTHR11453. PTHR11453. 1 hit.
    Pfami PF07565. Band_3_cyto. 1 hit.
    PF00955. HCO3_cotransp. 1 hit.
    [Graphical view ]
    PRINTSi PR01231. HCO3TRNSPORT.
    PR01232. NAHCO3TRSPRT.
    SUPFAMi SSF55804. SSF55804. 1 hit.
    TIGRFAMsi TIGR00834. ae. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Cloning, characterization and chromosomal assignment of NBC4, a new member of the sodium bicarbonate cotransporter family."
      Pushkin A., Abuladze N., Newman D., Lee I., Xu G., Kurtz I.
      Biochim. Biophys. Acta 1493:215-218(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
      Tissue: HeartImported.
    2. "Two C-terminal variants of NBC4, a new member of the sodium bicarbonate cotransporter family: cloning, characterization, and localization."
      Pushkin A., Abuladze N., Newman D., Lee I., Xu G., Kurtz I.
      IUBMB Life 50:13-19(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
      Tissue: Heart1 Publication and TestisImported.
    3. "Genomic organization of the DCTN1-SLC4A5 locus encoding both NBC4 and p150(Glued)."
      Pushkin A., Abuladze N., Newman D., Tatishchev S., Kurtz I.
      Cytogenet. Cell Genet. 95:163-168(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
      Tissue: TestisImported.
    4. "Functional characterization of NBC4: a new electrogenic sodium-bicarbonate cotransporter."
      Sassani P., Pushkin A., Gross E., Gomer A., Abuladze N., Dukkipati R., Carpenito G., Kurtz I.
      Am. J. Physiol. 282:C408-C416(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY, INHIBITION.
      Tissue: TestisImported.
    5. "Functional characterization of human NBC4 as an electrogenic Na+-HCO cotransporter (NBCe2)."
      Virkki L.V., Wilson D.A., Vaughan-Jones R.D., Boron W.F.
      Am. J. Physiol. 282:C1278-C1289(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, INHIBITION.
    6. "Expression of the Na+-HCO-3 cotransporter NBC4 in rat kidney and characterization of a novel NBC4 variant."
      Xu J., Wang Z., Barone S., Petrovic M., Amlal H., Conforti L., Petrovic S., Soleimani M.
      Am. J. Physiol. 284:F41-F50(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8), FUNCTION, INHIBITION.
      Tissue: Liver1 Publication.
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
    9. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
      Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 88-993 (ISOFORM 5), VARIANT TYR-253.
      Tissue: BrainImported.
    10. "Molecular expression of SLC4-derived Na+-dependent anion transporters in selected human tissues."
      Damkier H.H., Nielsen S., Praetorius J.
      Am. J. Physiol. 293:R2136-R2146(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiS4A5_HUMAN
    AccessioniPrimary (citable) accession number: Q9BY07
    Secondary accession number(s): Q32MA7
    , Q59EQ9, Q8WXD3, Q8WXD7, Q96DS7, Q96DS8, Q9HBU5
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 8, 2008
    Last sequence update: April 8, 2008
    Last modified: October 1, 2014
    This is version 101 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 2
      Human chromosome 2: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3