SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BY07

- S4A5_HUMAN

UniProt

Q9BY07 - S4A5_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Electrogenic sodium bicarbonate cotransporter 4
Gene
SLC4A5, NBC4
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at transcript leveli

Functioni

Mediates sodium- and bicarbonate-dependent electrogenic sodium bicarbonate cotransport, with a Na+:HCO3- stoichiometry of 2:1. May have a housekeeping function in regulating the pH of tissues in which it is expressed. May play a role in mediating Na+:HCO3- cotransport in hepatocytes and intrahepatic cholangiocytes. Also may be important in protecting the renal paranchyma from alterations in urine pH.By similarity3 Publications

Enzyme regulationi

Activity is inhibited by 4,4'-di-isothiocyanatostilbene-2,2'-disulfonic acid (DIDS - an inhibitor of several anion channels and transporters).

GO - Molecular functioni

  1. inorganic anion exchanger activity Source: InterPro
  2. sodium:bicarbonate symporter activity Source: UniProtKB

GO - Biological processi

  1. bicarbonate transport Source: UniProtKB
  2. ion transport Source: Reactome
  3. sodium ion transmembrane transport Source: GOC
  4. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Anion exchange, Ion transport, Sodium transport, Transport

Keywords - Ligandi

Sodium

Enzyme and pathway databases

ReactomeiREACT_19298. Bicarbonate transporters.

Protein family/group databases

TCDBi2.A.31.2.8. the anion exchanger (ae) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Electrogenic sodium bicarbonate cotransporter 4
Alternative name(s):
NBCe2
Solute carrier family 4 member 5
Gene namesi
Name:SLC4A5
Synonyms:NBC4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:18168. SLC4A5.

Subcellular locationi

Apical cell membrane; Multi-pass membrane protein
Note: Expressed in the apical plasma membrane domain of a subset of collecting ducts in the renal medulla.1 Publication

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 523523Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei524 – 54421Helical; Reviewed prediction
Add
BLAST
Topological domaini545 – 56622Extracellular Reviewed prediction
Add
BLAST
Transmembranei567 – 58721Helical; Reviewed prediction
Add
BLAST
Topological domaini588 – 60821Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei609 – 62921Helical; Reviewed prediction
Add
BLAST
Topological domaini630 – 63910Extracellular Reviewed prediction
Transmembranei640 – 66021Helical; Reviewed prediction
Add
BLAST
Topological domaini661 – 73878Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei739 – 75921Helical; Reviewed prediction
Add
BLAST
Topological domaini760 – 77617Extracellular Reviewed prediction
Add
BLAST
Transmembranei777 – 79721Helical; Reviewed prediction
Add
BLAST
Topological domaini798 – 82730Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei828 – 84821Helical; Reviewed prediction
Add
BLAST
Topological domaini849 – 87325Extracellular Reviewed prediction
Add
BLAST
Transmembranei874 – 89421Helical; Reviewed prediction
Add
BLAST
Topological domaini895 – 93036Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei931 – 95121Helical; Reviewed prediction
Add
BLAST
Topological domaini952 – 9521Extracellular Reviewed prediction
Transmembranei953 – 97321Helical; Reviewed prediction
Add
BLAST
Topological domaini974 – 101138Cytoplasmic Reviewed prediction
Add
BLAST
Transmembranei1012 – 103221Helical; Reviewed prediction
Add
BLAST
Transmembranei1033 – 105321Helical; Reviewed prediction
Add
BLAST
Topological domaini1054 – 113784Extracellular Reviewed prediction
Add
BLAST

GO - Cellular componenti

  1. apical plasma membrane Source: UniProtKB-SubCell
  2. integral component of membrane Source: UniProtKB
  3. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA164742397.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11371137Electrogenic sodium bicarbonate cotransporter 4
PRO_0000328920Add
BLAST

Proteomic databases

MaxQBiQ9BY07.
PaxDbiQ9BY07.
PRIDEiQ9BY07.

PTM databases

PhosphoSiteiQ9BY07.

Expressioni

Tissue specificityi

Highest expression observed in liver, spleen and testis; moderate expression in the choroid plexus, hippocampus, cerebrum and cerebellum of brain, and in kidney cortex and kidney medulla. Also observed in heart, pancreas, muscle, lung, placenta, stomach and small intestine. Weakest expression seen in peripheral blood lymphocytes, colon, duodenum, jejunum, ileum and skeletal muscle.4 Publications

Gene expression databases

BgeeiQ9BY07.
CleanExiHS_SLC4A5.
GenevestigatoriQ9BY07.

Organism-specific databases

HPAiHPA036621.

Interactioni

Protein-protein interaction databases

IntActiQ9BY07. 1 interaction.
MINTiMINT-6489517.
STRINGi9606.ENSP00000350475.

Structurei

3D structure databases

ProteinModelPortaliQ9BY07.
SMRiQ9BY07. Positions 113-402.

Family & Domainsi

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi433 – 49765Gly-rich
Add
BLAST

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG318437.
HOVERGENiHBG004326.
InParanoidiQ9BY07.
KOiK13857.
OMAiELIWTGR.
OrthoDBiEOG7TMZR0.
PhylomeDBiQ9BY07.
TreeFamiTF313630.

Family and domain databases

Gene3Di3.40.1100.10. 1 hit.
InterProiIPR013769. Band3_cytoplasmic_dom.
IPR011531. HCO3_transpt_C.
IPR003020. HCO3_transpt_euk.
IPR003024. Na/HCO3_transpt.
IPR016152. PTrfase/Anion_transptr.
[Graphical view]
PANTHERiPTHR11453. PTHR11453. 1 hit.
PfamiPF07565. Band_3_cyto. 1 hit.
PF00955. HCO3_cotransp. 1 hit.
[Graphical view]
PRINTSiPR01231. HCO3TRNSPORT.
PR01232. NAHCO3TRSPRT.
SUPFAMiSSF55804. SSF55804. 1 hit.
TIGRFAMsiTIGR00834. ae. 1 hit.

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. Align

Isoform 11 Publication (identifier: Q9BY07-1) [UniParc]FASTAAdd to Basket

Also known as: NBC4a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MKVKEEKAGV GKLDHTNHRR RFPDQKECPP IHIGLPVPTY PQRKTDQKGH     50
LSGLQKVHWG LRPDQPQQEL TGPGSGASSQ DSSMDLISRT RSPAAEQLQD 100
ILGEEDEAPN PTLFTEMDTL QHDGDQMEWK ESARWIKFEE KVEEGGERWS 150
KPHVSTLSLH SLFELRTCLQ TGTVLLDLDS GSLPQIIDDV IEKQIEDGLL 200
RPELRERVSY VLLRRHRHQT KKPIHRSLAD IGKSVSTTNR SPARSPGAGP 250
SLHHSTEDLR MRQSANYGRL CHAQSRSMND ISLTPNTDQR KNKFMKKIPK 300
DSEASNVLVG EVDFLDQPFI AFVRLIQSAM LGGVTEVPVP TRFLFILLGP 350
SGRAKSYNEI GRAIATLMVD DLFSDVAYKA RNREDLIAGI DEFLDEVIVL 400
PPGEWDPNIR IEPPKKVPSA DKRKSVFSLA ELGQMNGSVG GGGGAPGGGN 450
GGGGGGGSGG GAGSGGAGGT SSGDDGEMPA MHEIGEELIW TGRFFGGLCL 500
DIKRKLPWFP SDFYDGFHIQ SISAILFIYL GCITNAITFG GLLGDATDNY 550
QGVMESFLGT AMAGSLFCLF SGQPLIILSS TGPILIFEKL LFDFSKGNGL 600
DYMEFRLWIG LHSAVQCLIL VATDASFIIK YITRFTEEGF STLISFIFIY 650
DAIKKMIGAF KYYPINMDFK PNFITTYKCE CVAPDTVNTT VFNASAPLAP 700
DTNASLYNLL NLTALDWSLL SKKECLSYGG RLLGNSCKFI PDLALMSFIL 750
FFGTYSMTLT LKKFKFSRYF PTKVRALVAD FSIVFSILMF CGIDACFGLE 800
TPKLHVPSVI KPTRPDRGWF VAPFGKNPWW VYPASILPAL LVTILIFMDQ 850
QITAVIVNRK ENKLKKAAGY HLDLFWVGIL MALCSFMGLP WYVAATVISI 900
AHIDSLKMET ETSAPGEQPQ FLGVREQRVT GIIVFILTGI SVFLAPILKC 950
IPLPVLYGVF LYMGVASLNG IQMGTGGSEF KIQKKLTPFW ERCKLFLMPA 1000
KHQPDHAFLR HVPLRRIHLF TLVQILCLAV LWILKSTVAA IIFPVMILGL 1050
IIVRRLLDFI FSQHDLAWID NILPEKEKKE TDKKRKRKKG AHEDCDEEPQ 1100
FPPPSVIKIP MESVQSDPQN GIHCIARKRS SSWSYSL 1137
Length:1,137
Mass (Da):126,255
Last modified:April 8, 2008 - v2
Checksum:iED4E4A4DC2CA17F1
GO
Isoform 23 Publications (identifier: Q9BY07-2) [UniParc]FASTAAdd to Basket

Also known as: NBC4b

The sequence of this isoform differs from the canonical sequence as follows:
     1046-1046: M → MSLSTTD

Show »
Length:1,143
Mass (Da):126,860
Checksum:i3C32B411955873FD
GO
Isoform 32 Publications (identifier: Q9BY07-3) [UniParc]FASTAAdd to Basket

Also known as: NBC4c

The sequence of this isoform differs from the canonical sequence as follows:
     973-988: Missing.

Show »
Length:1,121
Mass (Da):124,551
Checksum:iDC17DB7C69ABD27D
GO
Isoform 42 Publications (identifier: Q9BY07-4) [UniParc]FASTAAdd to Basket

Also known as: NBC4d

The sequence of this isoform differs from the canonical sequence as follows:
     950-1046: Missing.

Show »
Length:1,040
Mass (Da):115,240
Checksum:iFEE31CEF13F4F57B
GO
Isoform 51 Publication (identifier: Q9BY07-5) [UniParc]FASTAAdd to Basket

Also known as: isoform d variant

The sequence of this isoform differs from the canonical sequence as follows:
     88-91: SRTR → EHKG
     866-993: KAAGYHLDLF...KKLTPFWERC → GTESNRHHRL...HLFPARPGLD
     994-1137: Missing.

Note: No experimental confirmation available. Incomplete sequence.

Show »
Length:993
Mass (Da):108,663
Checksum:i9C45DA4AC127035F
GO
Isoform 61 Publication (identifier: Q9BY07-6) [UniParc]FASTAAdd to Basket

Also known as: NBC4f

The sequence of this isoform differs from the canonical sequence as follows:
     774-811: Missing.
     866-924: Missing.
     973-988: Missing.
     1046-1046: M → MSLSTTD
     1071-1075: NILPE → KIEFP
     1076-1137: Missing.

Show »
Length:968
Mass (Da):107,526
Checksum:i61243CD7DF614154
GO
Isoform 71 Publication (identifier: Q9BY07-7) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-91: ECPPIHIGLPVPTYPQRKTDQKGHLSGLQKVHWGLRPDQPQQELTGPGSGASSQDSSMDLISRTR → G
     774-811: Missing.
     973-988: Missing.

Note: No experimental confirmation available.

Show »
Length:1,019
Mass (Da):113,390
Checksum:i93AAC3C3E0649931
GO
Isoform 81 Publication (identifier: Q9BY07-8) [UniParc]FASTAAdd to Basket

Also known as: NBC4e

The sequence of this isoform differs from the canonical sequence as follows:
     1068-1137: Missing.

Show »
Length:1,067
Mass (Da):118,125
Checksum:i7D1BA0C19F65AC3F
GO

Sequence cautioni

The sequence AAG18492.1 differs from that shown. Reason: Frameshift at position 1047.
The sequence AAL50802.1 differs from that shown. Reason: Frameshift at positions 760, 925 and 1047.
The sequence EAW99691.1 differs from that shown. Reason: Frameshift at position 1047.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti251 – 2511S → N.
Corresponds to variant rs17009792 [ dbSNP | Ensembl ].
VAR_048350
Natural varianti253 – 2531H → Y.1 Publication
Corresponds to variant rs55651232 [ dbSNP | Ensembl ].
VAR_061032

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei27 – 9165ECPPI…ISRTR → G in isoform 7. 1 Publication
VSP_052770Add
BLAST
Alternative sequencei88 – 914SRTR → EHKG in isoform 5. 1 Publication
VSP_052771
Alternative sequencei774 – 81138Missing in isoform 6 and isoform 7. 2 Publications
VSP_052772Add
BLAST
Alternative sequencei866 – 993128KAAGY…FWERC → GTESNRHHRLHPDGNLCLPG SHPKVYPPAGAVRSLPLHGR GLPEWHPVLGTLQALPDASQ APAGPCLPAARAAAPDPPLH PGADPLPGGALDPQIHGGCH HLPGHDPGPHHRSKASGFHL FPARPGLD in isoform 5. 1 Publication
VSP_052773Add
BLAST
Alternative sequencei866 – 92459Missing in isoform 6. 1 Publication
VSP_052774Add
BLAST
Alternative sequencei950 – 104697Missing in isoform 4. 1 Publication
VSP_052775Add
BLAST
Alternative sequencei973 – 98816Missing in isoform 3, isoform 6 and isoform 7. 3 Publications
VSP_052776Add
BLAST
Alternative sequencei994 – 1137144Missing in isoform 5. 1 Publication
VSP_052777Add
BLAST
Alternative sequencei1046 – 10461M → MSLSTTD in isoform 2 and isoform 6. 3 Publications
VSP_052778
Alternative sequencei1068 – 113770Missing in isoform 8. 1 Publication
VSP_052779Add
BLAST
Alternative sequencei1071 – 10755NILPE → KIEFP in isoform 6. 1 Publication
VSP_052780
Alternative sequencei1076 – 113762Missing in isoform 6. 1 Publication
VSP_052781Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti612 – 6121H → Y in AAL48291. 1 Publication
Sequence conflicti612 – 6121H → Y in AAL50802. 1 Publication
Sequence conflicti699 – 6991A → T in AAL48291. 1 Publication
Sequence conflicti759 – 7591L → R in AAL50802. 1 Publication
Sequence conflicti813 – 8131T → P in AAK26741. 1 Publication
Sequence conflicti896 – 8961T → M in AAL48291. 1 Publication
Sequence conflicti923 – 9231G → R in AAL48291. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF207661 mRNA. Translation: AAG18492.1. Frameshift.
AF243499 mRNA. Translation: AAK26741.1.
AF293338 mRNA. Translation: AAK97073.1.
AF293337 mRNA. Translation: AAK97072.1.
AF452248 mRNA. Translation: AAL48291.1.
AF453528 mRNA. Translation: AAL50802.1. Frameshift.
CH471053 Genomic DNA. Translation: EAW99690.1.
CH471053 Genomic DNA. Translation: EAW99691.1. Frameshift.
CH471053 Genomic DNA. Translation: EAW99693.1.
BC109221 mRNA. Translation: AAI09222.1.
AB209752 mRNA. Translation: BAD92989.1.
CCDSiCCDS1936.1. [Q9BY07-1]
CCDS1937.1. [Q9BY07-3]
RefSeqiNP_067019.3. NM_021196.3. [Q9BY07-1]
NP_597812.1. NM_133478.2. [Q9BY07-3]
UniGeneiHs.594099.

Genome annotation databases

EnsembliENST00000346834; ENSP00000251768; ENSG00000188687. [Q9BY07-4]
ENST00000357822; ENSP00000350475; ENSG00000188687. [Q9BY07-1]
ENST00000358683; ENSP00000351513; ENSG00000188687. [Q9BY07-7]
ENST00000359484; ENSP00000352461; ENSG00000188687. [Q9BY07-7]
ENST00000377632; ENSP00000366859; ENSG00000188687. [Q9BY07-4]
ENST00000377634; ENSP00000366861; ENSG00000188687. [Q9BY07-1]
ENST00000394019; ENSP00000377587; ENSG00000188687. [Q9BY07-3]
GeneIDi57835.
KEGGihsa:57835.
UCSCiuc002skn.3. human. [Q9BY07-3]
uc002sko.1. human. [Q9BY07-1]
uc002skp.1. human. [Q9BY07-7]
uc010ffc.1. human. [Q9BY07-4]

Polymorphism databases

DMDMi182691595.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF207661 mRNA. Translation: AAG18492.1 . Frameshift.
AF243499 mRNA. Translation: AAK26741.1 .
AF293338 mRNA. Translation: AAK97073.1 .
AF293337 mRNA. Translation: AAK97072.1 .
AF452248 mRNA. Translation: AAL48291.1 .
AF453528 mRNA. Translation: AAL50802.1 . Frameshift.
CH471053 Genomic DNA. Translation: EAW99690.1 .
CH471053 Genomic DNA. Translation: EAW99691.1 . Frameshift.
CH471053 Genomic DNA. Translation: EAW99693.1 .
BC109221 mRNA. Translation: AAI09222.1 .
AB209752 mRNA. Translation: BAD92989.1 .
CCDSi CCDS1936.1. [Q9BY07-1 ]
CCDS1937.1. [Q9BY07-3 ]
RefSeqi NP_067019.3. NM_021196.3. [Q9BY07-1 ]
NP_597812.1. NM_133478.2. [Q9BY07-3 ]
UniGenei Hs.594099.

3D structure databases

ProteinModelPortali Q9BY07.
SMRi Q9BY07. Positions 113-402.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q9BY07. 1 interaction.
MINTi MINT-6489517.
STRINGi 9606.ENSP00000350475.

Protein family/group databases

TCDBi 2.A.31.2.8. the anion exchanger (ae) family.

PTM databases

PhosphoSitei Q9BY07.

Polymorphism databases

DMDMi 182691595.

Proteomic databases

MaxQBi Q9BY07.
PaxDbi Q9BY07.
PRIDEi Q9BY07.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000346834 ; ENSP00000251768 ; ENSG00000188687 . [Q9BY07-4 ]
ENST00000357822 ; ENSP00000350475 ; ENSG00000188687 . [Q9BY07-1 ]
ENST00000358683 ; ENSP00000351513 ; ENSG00000188687 . [Q9BY07-7 ]
ENST00000359484 ; ENSP00000352461 ; ENSG00000188687 . [Q9BY07-7 ]
ENST00000377632 ; ENSP00000366859 ; ENSG00000188687 . [Q9BY07-4 ]
ENST00000377634 ; ENSP00000366861 ; ENSG00000188687 . [Q9BY07-1 ]
ENST00000394019 ; ENSP00000377587 ; ENSG00000188687 . [Q9BY07-3 ]
GeneIDi 57835.
KEGGi hsa:57835.
UCSCi uc002skn.3. human. [Q9BY07-3 ]
uc002sko.1. human. [Q9BY07-1 ]
uc002skp.1. human. [Q9BY07-7 ]
uc010ffc.1. human. [Q9BY07-4 ]

Organism-specific databases

CTDi 57835.
GeneCardsi GC02M074443.
HGNCi HGNC:18168. SLC4A5.
HPAi HPA036621.
MIMi 606757. gene.
neXtProti NX_Q9BY07.
PharmGKBi PA164742397.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG318437.
HOVERGENi HBG004326.
InParanoidi Q9BY07.
KOi K13857.
OMAi ELIWTGR.
OrthoDBi EOG7TMZR0.
PhylomeDBi Q9BY07.
TreeFami TF313630.

Enzyme and pathway databases

Reactomei REACT_19298. Bicarbonate transporters.

Miscellaneous databases

ChiTaRSi SLC4A5. human.
GeneWikii SLC4A5.
GenomeRNAii 57835.
NextBioi 64831.
PROi Q9BY07.
SOURCEi Search...

Gene expression databases

Bgeei Q9BY07.
CleanExi HS_SLC4A5.
Genevestigatori Q9BY07.

Family and domain databases

Gene3Di 3.40.1100.10. 1 hit.
InterProi IPR013769. Band3_cytoplasmic_dom.
IPR011531. HCO3_transpt_C.
IPR003020. HCO3_transpt_euk.
IPR003024. Na/HCO3_transpt.
IPR016152. PTrfase/Anion_transptr.
[Graphical view ]
PANTHERi PTHR11453. PTHR11453. 1 hit.
Pfami PF07565. Band_3_cyto. 1 hit.
PF00955. HCO3_cotransp. 1 hit.
[Graphical view ]
PRINTSi PR01231. HCO3TRNSPORT.
PR01232. NAHCO3TRSPRT.
SUPFAMi SSF55804. SSF55804. 1 hit.
TIGRFAMsi TIGR00834. ae. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning, characterization and chromosomal assignment of NBC4, a new member of the sodium bicarbonate cotransporter family."
    Pushkin A., Abuladze N., Newman D., Lee I., Xu G., Kurtz I.
    Biochim. Biophys. Acta 1493:215-218(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
    Tissue: Heart.
  2. "Two C-terminal variants of NBC4, a new member of the sodium bicarbonate cotransporter family: cloning, characterization, and localization."
    Pushkin A., Abuladze N., Newman D., Lee I., Xu G., Kurtz I.
    IUBMB Life 50:13-19(2000) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
    Tissue: Heart and Testis.
  3. "Genomic organization of the DCTN1-SLC4A5 locus encoding both NBC4 and p150(Glued)."
    Pushkin A., Abuladze N., Newman D., Tatishchev S., Kurtz I.
    Cytogenet. Cell Genet. 95:163-168(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4).
    Tissue: Testis.
  4. "Functional characterization of NBC4: a new electrogenic sodium-bicarbonate cotransporter."
    Sassani P., Pushkin A., Gross E., Gomer A., Abuladze N., Dukkipati R., Carpenito G., Kurtz I.
    Am. J. Physiol. 282:C408-C416(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, TISSUE SPECIFICITY, INHIBITION.
    Tissue: Testis.
  5. "Functional characterization of human NBC4 as an electrogenic Na+-HCO cotransporter (NBCe2)."
    Virkki L.V., Wilson D.A., Vaughan-Jones R.D., Boron W.F.
    Am. J. Physiol. 282:C1278-C1289(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, INHIBITION.
  6. "Expression of the Na+-HCO-3 cotransporter NBC4 in rat kidney and characterization of a novel NBC4 variant."
    Xu J., Wang Z., Barone S., Petrovic M., Amlal H., Conforti L., Petrovic S., Soleimani M.
    Am. J. Physiol. 284:F41-F50(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8), FUNCTION, INHIBITION.
    Tissue: Liver.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 7).
  9. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S., Ohara O., Nagase T., Kikuno R.F.
    Submitted (MAR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 88-993 (ISOFORM 5), VARIANT TYR-253.
    Tissue: Brain.
  10. "Molecular expression of SLC4-derived Na+-dependent anion transporters in selected human tissues."
    Damkier H.H., Nielsen S., Praetorius J.
    Am. J. Physiol. 293:R2136-R2146(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiS4A5_HUMAN
AccessioniPrimary (citable) accession number: Q9BY07
Secondary accession number(s): Q32MA7
, Q59EQ9, Q8WXD3, Q8WXD7, Q96DS7, Q96DS8, Q9HBU5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: April 8, 2008
Last modified: September 3, 2014
This is version 100 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi