Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Electrogenic sodium bicarbonate cotransporter 4

Gene

SLC4A5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

Mediates sodium- and bicarbonate-dependent electrogenic sodium bicarbonate cotransport, with a Na+:HCO3- stoichiometry of 2:1. May have a housekeeping function in regulating the pH of tissues in which it is expressed. May play a role in mediating Na+:HCO3- cotransport in hepatocytes and intrahepatic cholangiocytes. Also may be important in protecting the renal paranchyma from alterations in urine pH.By similarity3 Publications

Enzyme regulationi

Activity is inhibited by 4,4'-di-isothiocyanatostilbene-2,2'-disulfonic acid (DIDS - an inhibitor of several anion channels and transporters).

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Anion exchange, Ion transport, Sodium transport, Transport

Keywords - Ligandi

Sodium

Enzyme and pathway databases

BioCyciZFISH:G66-32365-MONOMER.
ReactomeiR-HSA-425381. Bicarbonate transporters.

Protein family/group databases

TCDBi2.A.31.2.8. the anion exchanger (ae) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Electrogenic sodium bicarbonate cotransporter 4
Alternative name(s):
NBCe2
Solute carrier family 4 member 5
Gene namesi
Name:SLC4A5Imported
Synonyms:NBC4Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:18168. SLC4A5.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 521CytoplasmicSequence analysisAdd BLAST521
Transmembranei522 – 544HelicalSequence analysisAdd BLAST23
Topological domaini545 – 555ExtracellularSequence analysisAdd BLAST11
Transmembranei556 – 587HelicalSequence analysisAdd BLAST32
Topological domaini588 – 606CytoplasmicSequence analysisAdd BLAST19
Transmembranei607 – 628HelicalSequence analysisAdd BLAST22
Topological domaini629 – 742ExtracellularSequence analysisAdd BLAST114
Transmembranei743 – 762HelicalSequence analysisAdd BLAST20
Topological domaini763 – 773CytoplasmicSequence analysisAdd BLAST11
Transmembranei774 – 795HelicalSequence analysisAdd BLAST22
Topological domaini796 – 828ExtracellularSequence analysisAdd BLAST33
Transmembranei829 – 847HelicalSequence analysisAdd BLAST19
Topological domaini848 – 866CytoplasmicSequence analysisAdd BLAST19
Transmembranei867 – 883HelicalSequence analysisAdd BLAST17
Topological domaini884 – 888ExtracellularSequence analysis5
Transmembranei889 – 908HelicalSequence analysisAdd BLAST20
Topological domaini909 – 928CytoplasmicSequence analysisAdd BLAST20
Transmembranei929 – 948HelicalSequence analysisAdd BLAST20
Topological domaini949 – 953ExtracellularSequence analysis5
Transmembranei954 – 971HelicalSequence analysisAdd BLAST18
Topological domaini972 – 1016CytoplasmicSequence analysisAdd BLAST45
Transmembranei1017 – 1034HelicalSequence analysisAdd BLAST18
Topological domaini1035 – 1039ExtracellularSequence analysis5
Transmembranei1040 – 1057HelicalSequence analysisAdd BLAST18
Topological domaini1058 – 1137CytoplasmicSequence analysisAdd BLAST80

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi57835.
MalaCardsiSLC4A5.
OpenTargetsiENSG00000188687.
PharmGKBiPA164742397.

Chemistry databases

DrugBankiDB01390. Sodium bicarbonate.

Polymorphism and mutation databases

BioMutaiSLC4A5.
DMDMi182691595.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003289201 – 1137Electrogenic sodium bicarbonate cotransporter 4Add BLAST1137

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi679 ↔ 681By similarity
Disulfide bondi725 ↔ 737By similarity

Keywords - PTMi

Disulfide bond

Proteomic databases

MaxQBiQ9BY07.
PaxDbiQ9BY07.
PeptideAtlasiQ9BY07.
PRIDEiQ9BY07.

PTM databases

iPTMnetiQ9BY07.
PhosphoSitePlusiQ9BY07.

Expressioni

Tissue specificityi

Highest expression observed in liver, spleen and testis; moderate expression in the choroid plexus, hippocampus, cerebrum and cerebellum of brain, and in kidney cortex and kidney medulla. Also observed in heart, pancreas, muscle, lung, placenta, stomach and small intestine. Weakest expression seen in peripheral blood lymphocytes, colon, duodenum, jejunum, ileum and skeletal muscle.4 Publications

Gene expression databases

BgeeiENSG00000188687.
CleanExiHS_SLC4A5.
ExpressionAtlasiQ9BY07. baseline and differential.
GenevisibleiQ9BY07. HS.

Interactioni

Protein-protein interaction databases

IntActiQ9BY07. 1 interactor.
MINTiMINT-6489517.
STRINGi9606.ENSP00000350475.

Structurei

3D structure databases

ProteinModelPortaliQ9BY07.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi433 – 497Gly-richSequence analysisAdd BLAST65

Sequence similaritiesi

Belongs to the anion exchanger (TC 2.A.31) family. [View classification]Sequence analysis

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1172. Eukaryota.
ENOG410XPHD. LUCA.
GeneTreeiENSGT00760000119021.
HOVERGENiHBG004326.
InParanoidiQ9BY07.
KOiK13857.
OMAiELIWTGR.
OrthoDBiEOG091G01FT.
PhylomeDBiQ9BY07.
TreeFamiTF313630.

Family and domain databases

Gene3Di3.40.1100.10. 1 hit.
InterProiIPR013769. Band3_cytoplasmic_dom.
IPR011531. HCO3_transpt_C.
IPR003020. HCO3_transpt_euk.
IPR003024. Na/HCO3_transpt.
IPR016152. PTrfase/Anion_transptr.
[Graphical view]
PANTHERiPTHR11453. PTHR11453. 3 hits.
PfamiPF07565. Band_3_cyto. 1 hit.
PF00955. HCO3_cotransp. 1 hit.
[Graphical view]
PRINTSiPR01231. HCO3TRNSPORT.
PR01232. NAHCO3TRSPRT.
SUPFAMiSSF55804. SSF55804. 1 hit.
TIGRFAMsiTIGR00834. ae. 1 hit.

Sequences (8)i

Sequence statusi: Complete.

This entry describes 8 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q9BY07-1) [UniParc]FASTAAdd to basket
Also known as: NBC4a1 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MKVKEEKAGV GKLDHTNHRR RFPDQKECPP IHIGLPVPTY PQRKTDQKGH
60 70 80 90 100
LSGLQKVHWG LRPDQPQQEL TGPGSGASSQ DSSMDLISRT RSPAAEQLQD
110 120 130 140 150
ILGEEDEAPN PTLFTEMDTL QHDGDQMEWK ESARWIKFEE KVEEGGERWS
160 170 180 190 200
KPHVSTLSLH SLFELRTCLQ TGTVLLDLDS GSLPQIIDDV IEKQIEDGLL
210 220 230 240 250
RPELRERVSY VLLRRHRHQT KKPIHRSLAD IGKSVSTTNR SPARSPGAGP
260 270 280 290 300
SLHHSTEDLR MRQSANYGRL CHAQSRSMND ISLTPNTDQR KNKFMKKIPK
310 320 330 340 350
DSEASNVLVG EVDFLDQPFI AFVRLIQSAM LGGVTEVPVP TRFLFILLGP
360 370 380 390 400
SGRAKSYNEI GRAIATLMVD DLFSDVAYKA RNREDLIAGI DEFLDEVIVL
410 420 430 440 450
PPGEWDPNIR IEPPKKVPSA DKRKSVFSLA ELGQMNGSVG GGGGAPGGGN
460 470 480 490 500
GGGGGGGSGG GAGSGGAGGT SSGDDGEMPA MHEIGEELIW TGRFFGGLCL
510 520 530 540 550
DIKRKLPWFP SDFYDGFHIQ SISAILFIYL GCITNAITFG GLLGDATDNY
560 570 580 590 600
QGVMESFLGT AMAGSLFCLF SGQPLIILSS TGPILIFEKL LFDFSKGNGL
610 620 630 640 650
DYMEFRLWIG LHSAVQCLIL VATDASFIIK YITRFTEEGF STLISFIFIY
660 670 680 690 700
DAIKKMIGAF KYYPINMDFK PNFITTYKCE CVAPDTVNTT VFNASAPLAP
710 720 730 740 750
DTNASLYNLL NLTALDWSLL SKKECLSYGG RLLGNSCKFI PDLALMSFIL
760 770 780 790 800
FFGTYSMTLT LKKFKFSRYF PTKVRALVAD FSIVFSILMF CGIDACFGLE
810 820 830 840 850
TPKLHVPSVI KPTRPDRGWF VAPFGKNPWW VYPASILPAL LVTILIFMDQ
860 870 880 890 900
QITAVIVNRK ENKLKKAAGY HLDLFWVGIL MALCSFMGLP WYVAATVISI
910 920 930 940 950
AHIDSLKMET ETSAPGEQPQ FLGVREQRVT GIIVFILTGI SVFLAPILKC
960 970 980 990 1000
IPLPVLYGVF LYMGVASLNG IQMGTGGSEF KIQKKLTPFW ERCKLFLMPA
1010 1020 1030 1040 1050
KHQPDHAFLR HVPLRRIHLF TLVQILCLAV LWILKSTVAA IIFPVMILGL
1060 1070 1080 1090 1100
IIVRRLLDFI FSQHDLAWID NILPEKEKKE TDKKRKRKKG AHEDCDEEPQ
1110 1120 1130
FPPPSVIKIP MESVQSDPQN GIHCIARKRS SSWSYSL
Length:1,137
Mass (Da):126,255
Last modified:April 8, 2008 - v2
Checksum:iED4E4A4DC2CA17F1
GO
Isoform 22 Publications (identifier: Q9BY07-2) [UniParc]FASTAAdd to basket
Also known as: NBC4b1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1046-1046: M → MSLSTTD

Show »
Length:1,143
Mass (Da):126,860
Checksum:i3C32B411955873FD
GO
Isoform 31 Publication (identifier: Q9BY07-3) [UniParc]FASTAAdd to basket
Also known as: NBC4c1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     973-988: Missing.

Show »
Length:1,121
Mass (Da):124,551
Checksum:iDC17DB7C69ABD27D
GO
Isoform 41 Publication (identifier: Q9BY07-4) [UniParc]FASTAAdd to basket
Also known as: NBC4d1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     950-1046: Missing.

Show »
Length:1,040
Mass (Da):115,240
Checksum:iFEE31CEF13F4F57B
GO
Isoform 5 (identifier: Q9BY07-5) [UniParc]FASTAAdd to basket
Also known as: isoform d variant

The sequence of this isoform differs from the canonical sequence as follows:
     88-91: SRTR → EHKG
     866-993: KAAGYHLDLF...KKLTPFWERC → GTESNRHHRL...HLFPARPGLD
     994-1137: Missing.

Note: No experimental confirmation available. Incomplete sequence.Curated
Show »
Length:993
Mass (Da):108,663
Checksum:i9C45DA4AC127035F
GO
Isoform 61 Publication (identifier: Q9BY07-6) [UniParc]FASTAAdd to basket
Also known as: NBC4f1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     774-811: Missing.
     866-924: Missing.
     973-988: Missing.
     1046-1046: M → MSLSTTD
     1071-1075: NILPE → KIEFP
     1076-1137: Missing.

Show »
Length:968
Mass (Da):107,526
Checksum:i61243CD7DF614154
GO
Isoform 71 Publication (identifier: Q9BY07-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     27-91: ECPPIHIGLPVPTYPQRKTDQKGHLSGLQKVHWGLRPDQPQQELTGPGSGASSQDSSMDLISRTR → G
     774-811: Missing.
     973-988: Missing.

Note: No experimental confirmation available.Curated
Show »
Length:1,019
Mass (Da):113,390
Checksum:i93AAC3C3E0649931
GO
Isoform 81 Publication (identifier: Q9BY07-8) [UniParc]FASTAAdd to basket
Also known as: NBC4e1 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1068-1137: Missing.

Show »
Length:1,067
Mass (Da):118,125
Checksum:i7D1BA0C19F65AC3F
GO

Sequence cautioni

The sequence AAG18492 differs from that shown. Reason: Frameshift at position 1047.Curated
The sequence AAL50802 differs from that shown. Reason: Frameshift at positions 760, 925 and 1047.Curated
The sequence EAW99691 differs from that shown. Reason: Frameshift at position 1047.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti612H → Y in AAL48291 (PubMed:12388414).Curated1
Sequence conflicti612H → Y in AAL50802 (PubMed:12388414).Curated1
Sequence conflicti699A → T in AAL48291 (PubMed:12388414).Curated1
Sequence conflicti759L → R in AAL50802 (PubMed:12388414).Curated1
Sequence conflicti813T → P in AAK26741 (PubMed:11087115).Curated1
Sequence conflicti896T → M in AAL48291 (PubMed:12388414).Curated1
Sequence conflicti923G → R in AAL48291 (PubMed:12388414).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_048350251S → N.Corresponds to variant rs17009792dbSNPEnsembl.1
Natural variantiVAR_061032253H → Y.1 PublicationCorresponds to variant rs55651232dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_05277027 – 91ECPPI…ISRTR → G in isoform 7. 1 PublicationAdd BLAST65
Alternative sequenceiVSP_05277188 – 91SRTR → EHKG in isoform 5. 1 Publication4
Alternative sequenceiVSP_052772774 – 811Missing in isoform 6 and isoform 7. 2 PublicationsAdd BLAST38
Alternative sequenceiVSP_052773866 – 993KAAGY…FWERC → GTESNRHHRLHPDGNLCLPG SHPKVYPPAGAVRSLPLHGR GLPEWHPVLGTLQALPDASQ APAGPCLPAARAAAPDPPLH PGADPLPGGALDPQIHGGCH HLPGHDPGPHHRSKASGFHL FPARPGLD in isoform 5. 1 PublicationAdd BLAST128
Alternative sequenceiVSP_052774866 – 924Missing in isoform 6. 1 PublicationAdd BLAST59
Alternative sequenceiVSP_052775950 – 1046Missing in isoform 4. 1 PublicationAdd BLAST97
Alternative sequenceiVSP_052776973 – 988Missing in isoform 3, isoform 6 and isoform 7. 4 PublicationsAdd BLAST16
Alternative sequenceiVSP_052777994 – 1137Missing in isoform 5. 1 PublicationAdd BLAST144
Alternative sequenceiVSP_0527781046M → MSLSTTD in isoform 2 and isoform 6. 3 Publications1
Alternative sequenceiVSP_0527791068 – 1137Missing in isoform 8. 1 PublicationAdd BLAST70
Alternative sequenceiVSP_0527801071 – 1075NILPE → KIEFP in isoform 6. 1 Publication5
Alternative sequenceiVSP_0527811076 – 1137Missing in isoform 6. 1 PublicationAdd BLAST62

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF207661 mRNA. Translation: AAG18492.1. Frameshift.
AF243499 mRNA. Translation: AAK26741.1.
AF293338 mRNA. Translation: AAK97073.1.
AF293337 mRNA. Translation: AAK97072.1.
AF452248 mRNA. Translation: AAL48291.1.
AF453528 mRNA. Translation: AAL50802.1. Frameshift.
CH471053 Genomic DNA. Translation: EAW99690.1.
CH471053 Genomic DNA. Translation: EAW99691.1. Frameshift.
CH471053 Genomic DNA. Translation: EAW99693.1.
BC109221 mRNA. Translation: AAI09222.1.
AB209752 mRNA. Translation: BAD92989.1.
CCDSiCCDS1936.1. [Q9BY07-1]
CCDS1937.1. [Q9BY07-3]
RefSeqiNP_067019.3. NM_021196.3. [Q9BY07-1]
NP_597812.1. NM_133478.2. [Q9BY07-3]
UniGeneiHs.594099.

Genome annotation databases

EnsembliENST00000346834; ENSP00000251768; ENSG00000188687. [Q9BY07-1]
ENST00000358683; ENSP00000351513; ENSG00000188687. [Q9BY07-7]
ENST00000377632; ENSP00000366859; ENSG00000188687. [Q9BY07-4]
ENST00000377634; ENSP00000366861; ENSG00000188687. [Q9BY07-1]
ENST00000394019; ENSP00000377587; ENSG00000188687. [Q9BY07-3]
ENST00000423644; ENSP00000395804; ENSG00000188687. [Q9BY07-3]
GeneIDi57835.
KEGGihsa:57835.
UCSCiuc002skn.3. human. [Q9BY07-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF207661 mRNA. Translation: AAG18492.1. Frameshift.
AF243499 mRNA. Translation: AAK26741.1.
AF293338 mRNA. Translation: AAK97073.1.
AF293337 mRNA. Translation: AAK97072.1.
AF452248 mRNA. Translation: AAL48291.1.
AF453528 mRNA. Translation: AAL50802.1. Frameshift.
CH471053 Genomic DNA. Translation: EAW99690.1.
CH471053 Genomic DNA. Translation: EAW99691.1. Frameshift.
CH471053 Genomic DNA. Translation: EAW99693.1.
BC109221 mRNA. Translation: AAI09222.1.
AB209752 mRNA. Translation: BAD92989.1.
CCDSiCCDS1936.1. [Q9BY07-1]
CCDS1937.1. [Q9BY07-3]
RefSeqiNP_067019.3. NM_021196.3. [Q9BY07-1]
NP_597812.1. NM_133478.2. [Q9BY07-3]
UniGeneiHs.594099.

3D structure databases

ProteinModelPortaliQ9BY07.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

IntActiQ9BY07. 1 interactor.
MINTiMINT-6489517.
STRINGi9606.ENSP00000350475.

Chemistry databases

DrugBankiDB01390. Sodium bicarbonate.

Protein family/group databases

TCDBi2.A.31.2.8. the anion exchanger (ae) family.

PTM databases

iPTMnetiQ9BY07.
PhosphoSitePlusiQ9BY07.

Polymorphism and mutation databases

BioMutaiSLC4A5.
DMDMi182691595.

Proteomic databases

MaxQBiQ9BY07.
PaxDbiQ9BY07.
PeptideAtlasiQ9BY07.
PRIDEiQ9BY07.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000346834; ENSP00000251768; ENSG00000188687. [Q9BY07-1]
ENST00000358683; ENSP00000351513; ENSG00000188687. [Q9BY07-7]
ENST00000377632; ENSP00000366859; ENSG00000188687. [Q9BY07-4]
ENST00000377634; ENSP00000366861; ENSG00000188687. [Q9BY07-1]
ENST00000394019; ENSP00000377587; ENSG00000188687. [Q9BY07-3]
ENST00000423644; ENSP00000395804; ENSG00000188687. [Q9BY07-3]
GeneIDi57835.
KEGGihsa:57835.
UCSCiuc002skn.3. human. [Q9BY07-1]

Organism-specific databases

CTDi57835.
DisGeNETi57835.
GeneCardsiSLC4A5.
HGNCiHGNC:18168. SLC4A5.
MalaCardsiSLC4A5.
MIMi606757. gene.
neXtProtiNX_Q9BY07.
OpenTargetsiENSG00000188687.
PharmGKBiPA164742397.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1172. Eukaryota.
ENOG410XPHD. LUCA.
GeneTreeiENSGT00760000119021.
HOVERGENiHBG004326.
InParanoidiQ9BY07.
KOiK13857.
OMAiELIWTGR.
OrthoDBiEOG091G01FT.
PhylomeDBiQ9BY07.
TreeFamiTF313630.

Enzyme and pathway databases

BioCyciZFISH:G66-32365-MONOMER.
ReactomeiR-HSA-425381. Bicarbonate transporters.

Miscellaneous databases

ChiTaRSiSLC4A5. human.
GeneWikiiSLC4A5.
GenomeRNAii57835.
PROiQ9BY07.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000188687.
CleanExiHS_SLC4A5.
ExpressionAtlasiQ9BY07. baseline and differential.
GenevisibleiQ9BY07. HS.

Family and domain databases

Gene3Di3.40.1100.10. 1 hit.
InterProiIPR013769. Band3_cytoplasmic_dom.
IPR011531. HCO3_transpt_C.
IPR003020. HCO3_transpt_euk.
IPR003024. Na/HCO3_transpt.
IPR016152. PTrfase/Anion_transptr.
[Graphical view]
PANTHERiPTHR11453. PTHR11453. 3 hits.
PfamiPF07565. Band_3_cyto. 1 hit.
PF00955. HCO3_cotransp. 1 hit.
[Graphical view]
PRINTSiPR01231. HCO3TRNSPORT.
PR01232. NAHCO3TRSPRT.
SUPFAMiSSF55804. SSF55804. 1 hit.
TIGRFAMsiTIGR00834. ae. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiS4A5_HUMAN
AccessioniPrimary (citable) accession number: Q9BY07
Secondary accession number(s): Q32MA7
, Q59EQ9, Q8WXD3, Q8WXD7, Q96DS7, Q96DS8, Q9HBU5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: April 8, 2008
Last modified: November 30, 2016
This is version 119 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.