Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Protein BEX2

Gene

BEX2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Regulator of mitochondrial apoptosis and G1 cell cycle in breast cancer. Protects the breast cancer cells against mitochondrial apoptosis and this effect is mediated through the modulation of BCL2 protein family, which involves the positive regulation of anti-apoptotic member BCL2 and the negative regulation of pro-apoptotic members BAD, BAK1 and PUMA. Required for the normal cell cycle progression during G1 in breast cancer cells through the regulation of CCND1 and CDKN1A. Regulates the level of PP2A regulatory subunit B and PP2A phosphatase activity.1 Publication

GO - Biological processi

  • apoptotic process Source: UniProtKB-KW
  • cell cycle Source: UniProtKB-KW
  • regulation of apoptotic process Source: UniProtKB
  • regulation of cell cycle Source: UniProtKB

Keywordsi

Biological processApoptosis, Cell cycle

Names & Taxonomyi

Protein namesi
Recommended name:
Protein BEX2
Alternative name(s):
Brain-expressed X-linked protein 2
Short name:
hBex2
Gene namesi
Name:BEX2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome X

Organism-specific databases

EuPathDBiHostDB:ENSG00000133134.11.
HGNCiHGNC:30933. BEX2.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi84707.
OpenTargetsiENSG00000133134.
PharmGKBiPA134977614.

Polymorphism and mutation databases

BioMutaiBEX2.
DMDMi74752443.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002297771 – 128Protein BEX2Add BLAST128

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei50Omega-N-methylarginineBy similarity1

Keywords - PTMi

Methylation

Proteomic databases

PaxDbiQ9BXY8.
PeptideAtlasiQ9BXY8.
PRIDEiQ9BXY8.

PTM databases

iPTMnetiQ9BXY8.
PhosphoSitePlusiQ9BXY8.

Expressioni

Tissue specificityi

Expressed in central nervous system, with high level in pituitary, cerebellum and temporal lobe. Widely expressed in breast cancer cell lines.2 Publications

Gene expression databases

BgeeiENSG00000133134.
CleanExiHS_BEX2.
ExpressionAtlasiQ9BXY8. baseline and differential.
GenevisibleiQ9BXY8. HS.

Organism-specific databases

HPAiHPA045384.

Interactioni

Subunit structurei

Interacts with OMP (By similarity). Interacts with LMO2, possibly leading to regulate the transcriptional activity of a DNA-binding complex containing LMO2.By similarity1 Publication

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi124218. 33 interactors.
CORUMiQ9BXY8.
IntActiQ9BXY8. 77 interactors.
STRINGi9606.ENSP00000442521.

Structurei

3D structure databases

ProteinModelPortaliQ9BXY8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the BEX family.Curated

Phylogenomic databases

eggNOGiENOG410JBJY. Eukaryota.
ENOG4111DNW. LUCA.
GeneTreeiENSGT00810000125540.
HOGENOMiHOG000236300.
HOVERGENiHBG080240.
InParanoidiQ9BXY8.
OMAiRWDIMHR.
OrthoDBiEOG091G0ZN3.
PhylomeDBiQ9BXY8.
TreeFamiTF337909.

Family and domain databases

InterProiView protein in InterPro
IPR007623. BEX.
IPR021156. TF_A-like/BEX.
PfamiView protein in Pfam
PF04538. BEX. 1 hit.
PIRSFiPIRSF008633. BEX. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BXY8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MESKEERALN NLIVENVNQE NDEKDEKEQV ANKGEPLALP LNVSEYCVPR
60 70 80 90 100
GNRRRFRVRQ PILQYRWDIM HRLGEPQARM REENMERIGE EVRQLMEKLR
110 120
EKQLSHSLRA VSTDPPHHDH HDEFCLMP
Length:128
Mass (Da):15,321
Last modified:June 1, 2001 - v1
Checksum:iF6302EC28F71D2A8
GO
Isoform 2 (identifier: Q9BXY8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQKMVVCGAKCCGDAPHVENREEETARIGPGVM

Note: Gene prediction based on EST data.
Show »
Length:160
Mass (Da):18,719
Checksum:i0C3D806EE0A4A527
GO

Sequence cautioni

The sequence CAI43072 differs from that shown. Reason: Erroneous gene model prediction.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0468081M → MQKMVVCGAKCCGDAPHVEN REEETARIGPGVM in isoform 2. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY833560 mRNA. Translation: AAX40678.1.
AF251053 mRNA. Translation: AAK34943.1.
AK312085 mRNA. Translation: BAG35021.1.
AL133348 Genomic DNA. Translation: CAI43071.1.
AL133348 Genomic DNA. Translation: CAI43072.1. Sequence problems.
Z70233 Genomic DNA. Translation: CAD24039.1.
CH471190 Genomic DNA. Translation: EAW54715.1.
CH471190 Genomic DNA. Translation: EAW54716.1.
BC015522 mRNA. Translation: AAH15522.1.
CCDSiCCDS14505.1. [Q9BXY8-1]
CCDS55467.1. [Q9BXY8-2]
RefSeqiNP_001161871.1. NM_001168399.1. [Q9BXY8-2]
NP_001161872.1. NM_001168400.1.
NP_001161873.1. NM_001168401.1. [Q9BXY8-1]
NP_116010.1. NM_032621.3. [Q9BXY8-1]
UniGeneiHs.398989.

Genome annotation databases

EnsembliENST00000372674; ENSP00000361759; ENSG00000133134. [Q9BXY8-1]
ENST00000372677; ENSP00000361762; ENSG00000133134. [Q9BXY8-1]
ENST00000536889; ENSP00000442521; ENSG00000133134. [Q9BXY8-2]
GeneIDi84707.
KEGGihsa:84707.
UCSCiuc004eka.4. human. [Q9BXY8-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiBEX2_HUMAN
AccessioniPrimary (citable) accession number: Q9BXY8
Secondary accession number(s): B2R574
, D3DXA2, F5H7H5, Q5JVV9
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 4, 2006
Last sequence update: June 1, 2001
Last modified: September 27, 2017
This is version 121 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Was named BEX1 by some authors.Curated

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families