Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BXY8

- BEX2_HUMAN

UniProt

Q9BXY8 - BEX2_HUMAN

Protein

Protein BEX2

Gene

BEX2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
  1. Functioni

    Regulator of mitochondrial apoptosis and G1 cell cycle in breast cancer. Protects the breast cancer cells against mitochondrial apoptosis and this effect is mediated through the modulation of BCL2 protein family, which involves the positive regulation of anti-apoptotic member BCL2 and the negative regulation of pro-apoptotic members BAD, BAK1 and PUMA. Required for the normal cell cycle progression during G1 in breast cancer cells through the regulation of CCND1 and CDKN1A. Regulates the level of PP2A regulatory subunit B and PP2A phosphatase activity.1 Publication

    GO - Biological processi

    1. apoptotic process Source: UniProtKB-KW
    2. cell cycle Source: UniProtKB-KW
    3. regulation of apoptotic process Source: UniProtKB
    4. regulation of cell cycle Source: UniProtKB

    Keywords - Biological processi

    Apoptosis, Cell cycle

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein BEX2
    Alternative name(s):
    Brain-expressed X-linked protein 2
    Short name:
    hBex2
    Gene namesi
    Name:BEX2
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:30933. BEX2.

    Subcellular locationi

    Cytoplasm By similarity. Nucleus 1 Publication

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134977614.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 128128Protein BEX2PRO_0000229777Add
    BLAST

    Proteomic databases

    PaxDbiQ9BXY8.
    PRIDEiQ9BXY8.

    PTM databases

    PhosphoSiteiQ9BXY8.

    Expressioni

    Tissue specificityi

    Expressed in central nervous system, with high level in pituitary, cerebellum and temporal lobe. Widely expressed in breast cancer cell lines.2 Publications

    Gene expression databases

    ArrayExpressiQ9BXY8.
    BgeeiQ9BXY8.
    CleanExiHS_BEX2.
    GenevestigatoriQ9BXY8.

    Organism-specific databases

    HPAiHPA042224.
    HPA045384.

    Interactioni

    Subunit structurei

    Interacts with OMP By similarity. Interacts with LMO2, possibly leading to regulate the transcriptional activity of a DNA-binding complex containing LMO2.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi124218. 4 interactions.
    IntActiQ9BXY8. 5 interactions.
    STRINGi9606.ENSP00000361759.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BXY8.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the BEX family.Curated

    Phylogenomic databases

    eggNOGiNOG244262.
    HOGENOMiHOG000236300.
    HOVERGENiHBG080240.
    InParanoidiQ9BXY8.
    OMAiRILNRRP.
    OrthoDBiEOG7XPZ7S.
    PhylomeDBiQ9BXY8.
    TreeFamiTF337909.

    Family and domain databases

    InterProiIPR007623. BEX.
    IPR021156. TF_A-like/BEX-like.
    [Graphical view]
    PfamiPF04538. BEX. 1 hit.
    [Graphical view]
    PIRSFiPIRSF008633. BEX. 1 hit.

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BXY8-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MESKEERALN NLIVENVNQE NDEKDEKEQV ANKGEPLALP LNVSEYCVPR    50
    GNRRRFRVRQ PILQYRWDIM HRLGEPQARM REENMERIGE EVRQLMEKLR 100
    EKQLSHSLRA VSTDPPHHDH HDEFCLMP 128
    Length:128
    Mass (Da):15,321
    Last modified:June 1, 2001 - v1
    Checksum:iF6302EC28F71D2A8
    GO
    Isoform 2 (identifier: Q9BXY8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MQKMVVCGAKCCGDAPHVENREEETARIGPGVM

    Note: Gene prediction based on EST data.

    Show »
    Length:160
    Mass (Da):18,719
    Checksum:i0C3D806EE0A4A527
    GO

    Sequence cautioni

    The sequence CAI43072.1 differs from that shown. Reason: Erroneous gene model prediction.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 11M → MQKMVVCGAKCCGDAPHVEN REEETARIGPGVM in isoform 2. CuratedVSP_046808

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY833560 mRNA. Translation: AAX40678.1.
    AF251053 mRNA. Translation: AAK34943.1.
    AK312085 mRNA. Translation: BAG35021.1.
    AL133348 Genomic DNA. Translation: CAI43071.1.
    AL133348 Genomic DNA. Translation: CAI43072.1. Sequence problems.
    Z70233 Genomic DNA. Translation: CAD24039.1.
    CH471190 Genomic DNA. Translation: EAW54715.1.
    CH471190 Genomic DNA. Translation: EAW54716.1.
    BC015522 mRNA. Translation: AAH15522.1.
    CCDSiCCDS14505.1. [Q9BXY8-1]
    CCDS55467.1. [Q9BXY8-2]
    RefSeqiNP_001161871.1. NM_001168399.1. [Q9BXY8-2]
    NP_001161872.1. NM_001168400.1.
    NP_001161873.1. NM_001168401.1. [Q9BXY8-1]
    NP_116010.1. NM_032621.3. [Q9BXY8-1]
    UniGeneiHs.398989.

    Genome annotation databases

    EnsembliENST00000372674; ENSP00000361759; ENSG00000133134. [Q9BXY8-1]
    ENST00000372677; ENSP00000361762; ENSG00000133134. [Q9BXY8-1]
    ENST00000536889; ENSP00000442521; ENSG00000133134. [Q9BXY8-2]
    GeneIDi84707.
    KEGGihsa:84707.
    UCSCiuc004ekb.3. human. [Q9BXY8-1]

    Polymorphism databases

    DMDMi74752443.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Web resourcesi

    Atlas of Genetics and Cytogenetics in Oncology and Haematology

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY833560 mRNA. Translation: AAX40678.1 .
    AF251053 mRNA. Translation: AAK34943.1 .
    AK312085 mRNA. Translation: BAG35021.1 .
    AL133348 Genomic DNA. Translation: CAI43071.1 .
    AL133348 Genomic DNA. Translation: CAI43072.1 . Sequence problems.
    Z70233 Genomic DNA. Translation: CAD24039.1 .
    CH471190 Genomic DNA. Translation: EAW54715.1 .
    CH471190 Genomic DNA. Translation: EAW54716.1 .
    BC015522 mRNA. Translation: AAH15522.1 .
    CCDSi CCDS14505.1. [Q9BXY8-1 ]
    CCDS55467.1. [Q9BXY8-2 ]
    RefSeqi NP_001161871.1. NM_001168399.1. [Q9BXY8-2 ]
    NP_001161872.1. NM_001168400.1.
    NP_001161873.1. NM_001168401.1. [Q9BXY8-1 ]
    NP_116010.1. NM_032621.3. [Q9BXY8-1 ]
    UniGenei Hs.398989.

    3D structure databases

    ProteinModelPortali Q9BXY8.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124218. 4 interactions.
    IntActi Q9BXY8. 5 interactions.
    STRINGi 9606.ENSP00000361759.

    PTM databases

    PhosphoSitei Q9BXY8.

    Polymorphism databases

    DMDMi 74752443.

    Proteomic databases

    PaxDbi Q9BXY8.
    PRIDEi Q9BXY8.

    Protocols and materials databases

    DNASUi 84707.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000372674 ; ENSP00000361759 ; ENSG00000133134 . [Q9BXY8-1 ]
    ENST00000372677 ; ENSP00000361762 ; ENSG00000133134 . [Q9BXY8-1 ]
    ENST00000536889 ; ENSP00000442521 ; ENSG00000133134 . [Q9BXY8-2 ]
    GeneIDi 84707.
    KEGGi hsa:84707.
    UCSCi uc004ekb.3. human. [Q9BXY8-1 ]

    Organism-specific databases

    CTDi 84707.
    GeneCardsi GC0XM102564.
    HGNCi HGNC:30933. BEX2.
    HPAi HPA042224.
    HPA045384.
    MIMi 300691. gene.
    neXtProti NX_Q9BXY8.
    PharmGKBi PA134977614.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG244262.
    HOGENOMi HOG000236300.
    HOVERGENi HBG080240.
    InParanoidi Q9BXY8.
    OMAi RILNRRP.
    OrthoDBi EOG7XPZ7S.
    PhylomeDBi Q9BXY8.
    TreeFami TF337909.

    Miscellaneous databases

    ChiTaRSi BEX2. human.
    GeneWikii BEX2.
    GenomeRNAii 84707.
    NextBioi 74802.
    PROi Q9BXY8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BXY8.
    Bgeei Q9BXY8.
    CleanExi HS_BEX2.
    Genevestigatori Q9BXY8.

    Family and domain databases

    InterProi IPR007623. BEX.
    IPR021156. TF_A-like/BEX-like.
    [Graphical view ]
    Pfami PF04538. BEX. 1 hit.
    [Graphical view ]
    PIRSFi PIRSF008633. BEX. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Characterization of the Bex gene family in humans, mice, and rats."
      Alvarez E., Zhou W., Witta S.E., Freed C.R.
      Gene 357:18-28(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY.
    2. Mao Y., Xie Y., Zhou Z., Zhao W., Zhao S., Wang W., Huang Y., Wang S., Tang R., Chen X., Wu C.
      Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA].
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
      Tissue: Thymus.
    4. "The DNA sequence of the human X chromosome."
      Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
      , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
      Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
      Tissue: Uterus.
    7. "Human Bex2 interacts with LMO2 and regulates the transcriptional activity of a novel DNA-binding complex."
      Han C., Liu H., Liu J., Yin K., Xie Y., Shen X., Wang Y., Yuan J., Qiang B., Liu Y.-J., Peng X.
      Nucleic Acids Res. 33:6555-6565(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, INTERACTION WITH LMO2.
    8. "BEX2 regulates mitochondrial apoptosis and G1 cell cycle in breast cancer."
      Naderi A., Liu J., Bennett I.C.
      Int. J. Cancer 126:1596-1610(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, TISSUE SPECIFICITY.

    Entry informationi

    Entry nameiBEX2_HUMAN
    AccessioniPrimary (citable) accession number: Q9BXY8
    Secondary accession number(s): B2R574
    , D3DXA2, F5H7H5, Q5JVV9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 4, 2006
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 99 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3