SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BXY8

- BEX2_HUMAN

UniProt

Q9BXY8 - BEX2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein BEX2

Gene
BEX2
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5 - Experimental evidence at protein leveli

Functioni

Regulator of mitochondrial apoptosis and G1 cell cycle in breast cancer. Protects the breast cancer cells against mitochondrial apoptosis and this effect is mediated through the modulation of BCL2 protein family, which involves the positive regulation of anti-apoptotic member BCL2 and the negative regulation of pro-apoptotic members BAD, BAK1 and PUMA. Required for the normal cell cycle progression during G1 in breast cancer cells through the regulation of CCND1 and CDKN1A. Regulates the level of PP2A regulatory subunit B and PP2A phosphatase activity.1 Publication

GO - Biological processi

  1. apoptotic process Source: UniProtKB-KW
  2. cell cycle Source: UniProtKB-KW
  3. regulation of apoptotic process Source: UniProtKB
  4. regulation of cell cycle Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Apoptosis, Cell cycle

Names & Taxonomyi

Protein namesi
Recommended name:
Protein BEX2
Alternative name(s):
Brain-expressed X-linked protein 2
Short name:
hBex2
Gene namesi
Name:BEX2
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:30933. BEX2.

Subcellular locationi

Cytoplasm By similarity. Nucleus 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134977614.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 128128Protein BEX2PRO_0000229777Add
BLAST

Proteomic databases

PaxDbiQ9BXY8.
PRIDEiQ9BXY8.

PTM databases

PhosphoSiteiQ9BXY8.

Expressioni

Tissue specificityi

Expressed in central nervous system, with high level in pituitary, cerebellum and temporal lobe. Widely expressed in breast cancer cell lines.2 Publications

Gene expression databases

ArrayExpressiQ9BXY8.
BgeeiQ9BXY8.
CleanExiHS_BEX2.
GenevestigatoriQ9BXY8.

Organism-specific databases

HPAiHPA042224.
HPA045384.

Interactioni

Subunit structurei

Interacts with OMP By similarity. Interacts with LMO2, possibly leading to regulate the transcriptional activity of a DNA-binding complex containing LMO2.1 Publication

Protein-protein interaction databases

BioGridi124218. 4 interactions.
IntActiQ9BXY8. 5 interactions.
STRINGi9606.ENSP00000361759.

Structurei

3D structure databases

ProteinModelPortaliQ9BXY8.

Family & Domainsi

Sequence similaritiesi

Belongs to the BEX family.

Phylogenomic databases

eggNOGiNOG244262.
HOGENOMiHOG000236300.
HOVERGENiHBG080240.
InParanoidiQ9BXY8.
OMAiRILNRRP.
OrthoDBiEOG7XPZ7S.
PhylomeDBiQ9BXY8.
TreeFamiTF337909.

Family and domain databases

InterProiIPR007623. BEX.
IPR021156. TF_A-like/BEX-like.
[Graphical view]
PfamiPF04538. BEX. 1 hit.
[Graphical view]
PIRSFiPIRSF008633. BEX. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BXY8-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MESKEERALN NLIVENVNQE NDEKDEKEQV ANKGEPLALP LNVSEYCVPR    50
GNRRRFRVRQ PILQYRWDIM HRLGEPQARM REENMERIGE EVRQLMEKLR 100
EKQLSHSLRA VSTDPPHHDH HDEFCLMP 128
Length:128
Mass (Da):15,321
Last modified:June 1, 2001 - v1
Checksum:iF6302EC28F71D2A8
GO
Isoform 2 (identifier: Q9BXY8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQKMVVCGAKCCGDAPHVENREEETARIGPGVM

Note: Gene prediction based on EST data.

Show »
Length:160
Mass (Da):18,719
Checksum:i0C3D806EE0A4A527
GO

Sequence cautioni

The sequence CAI43072.1 differs from that shown. Reason: Erroneous gene model prediction.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MQKMVVCGAKCCGDAPHVEN REEETARIGPGVM in isoform 2. VSP_046808

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY833560 mRNA. Translation: AAX40678.1.
AF251053 mRNA. Translation: AAK34943.1.
AK312085 mRNA. Translation: BAG35021.1.
AL133348 Genomic DNA. Translation: CAI43071.1.
AL133348 Genomic DNA. Translation: CAI43072.1. Sequence problems.
Z70233 Genomic DNA. Translation: CAD24039.1.
CH471190 Genomic DNA. Translation: EAW54715.1.
CH471190 Genomic DNA. Translation: EAW54716.1.
BC015522 mRNA. Translation: AAH15522.1.
CCDSiCCDS14505.1. [Q9BXY8-1]
CCDS55467.1. [Q9BXY8-2]
RefSeqiNP_001161871.1. NM_001168399.1. [Q9BXY8-2]
NP_001161872.1. NM_001168400.1.
NP_001161873.1. NM_001168401.1. [Q9BXY8-1]
NP_116010.1. NM_032621.3. [Q9BXY8-1]
UniGeneiHs.398989.

Genome annotation databases

EnsembliENST00000372674; ENSP00000361759; ENSG00000133134. [Q9BXY8-1]
ENST00000372677; ENSP00000361762; ENSG00000133134. [Q9BXY8-1]
ENST00000536889; ENSP00000442521; ENSG00000133134. [Q9BXY8-2]
GeneIDi84707.
KEGGihsa:84707.
UCSCiuc004ekb.3. human. [Q9BXY8-1]

Polymorphism databases

DMDMi74752443.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Web resourcesi

Atlas of Genetics and Cytogenetics in Oncology and Haematology

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY833560 mRNA. Translation: AAX40678.1 .
AF251053 mRNA. Translation: AAK34943.1 .
AK312085 mRNA. Translation: BAG35021.1 .
AL133348 Genomic DNA. Translation: CAI43071.1 .
AL133348 Genomic DNA. Translation: CAI43072.1 . Sequence problems.
Z70233 Genomic DNA. Translation: CAD24039.1 .
CH471190 Genomic DNA. Translation: EAW54715.1 .
CH471190 Genomic DNA. Translation: EAW54716.1 .
BC015522 mRNA. Translation: AAH15522.1 .
CCDSi CCDS14505.1. [Q9BXY8-1 ]
CCDS55467.1. [Q9BXY8-2 ]
RefSeqi NP_001161871.1. NM_001168399.1. [Q9BXY8-2 ]
NP_001161872.1. NM_001168400.1.
NP_001161873.1. NM_001168401.1. [Q9BXY8-1 ]
NP_116010.1. NM_032621.3. [Q9BXY8-1 ]
UniGenei Hs.398989.

3D structure databases

ProteinModelPortali Q9BXY8.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 124218. 4 interactions.
IntActi Q9BXY8. 5 interactions.
STRINGi 9606.ENSP00000361759.

PTM databases

PhosphoSitei Q9BXY8.

Polymorphism databases

DMDMi 74752443.

Proteomic databases

PaxDbi Q9BXY8.
PRIDEi Q9BXY8.

Protocols and materials databases

DNASUi 84707.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000372674 ; ENSP00000361759 ; ENSG00000133134 . [Q9BXY8-1 ]
ENST00000372677 ; ENSP00000361762 ; ENSG00000133134 . [Q9BXY8-1 ]
ENST00000536889 ; ENSP00000442521 ; ENSG00000133134 . [Q9BXY8-2 ]
GeneIDi 84707.
KEGGi hsa:84707.
UCSCi uc004ekb.3. human. [Q9BXY8-1 ]

Organism-specific databases

CTDi 84707.
GeneCardsi GC0XM102564.
HGNCi HGNC:30933. BEX2.
HPAi HPA042224.
HPA045384.
MIMi 300691. gene.
neXtProti NX_Q9BXY8.
PharmGKBi PA134977614.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG244262.
HOGENOMi HOG000236300.
HOVERGENi HBG080240.
InParanoidi Q9BXY8.
OMAi RILNRRP.
OrthoDBi EOG7XPZ7S.
PhylomeDBi Q9BXY8.
TreeFami TF337909.

Miscellaneous databases

ChiTaRSi BEX2. human.
GeneWikii BEX2.
GenomeRNAii 84707.
NextBioi 74802.
PROi Q9BXY8.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9BXY8.
Bgeei Q9BXY8.
CleanExi HS_BEX2.
Genevestigatori Q9BXY8.

Family and domain databases

InterProi IPR007623. BEX.
IPR021156. TF_A-like/BEX-like.
[Graphical view ]
Pfami PF04538. BEX. 1 hit.
[Graphical view ]
PIRSFi PIRSF008633. BEX. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Characterization of the Bex gene family in humans, mice, and rats."
    Alvarez E., Zhou W., Witta S.E., Freed C.R.
    Gene 357:18-28(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA], TISSUE SPECIFICITY.
  2. Mao Y., Xie Y., Zhou Z., Zhao W., Zhao S., Wang W., Huang Y., Wang S., Tang R., Chen X., Wu C.
    Submitted (MAR-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA].
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Thymus.
  4. "The DNA sequence of the human X chromosome."
    Ross M.T., Grafham D.V., Coffey A.J., Scherer S., McLay K., Muzny D., Platzer M., Howell G.R., Burrows C., Bird C.P., Frankish A., Lovell F.L., Howe K.L., Ashurst J.L., Fulton R.S., Sudbrak R., Wen G., Jones M.C.
    , Hurles M.E., Andrews T.D., Scott C.E., Searle S., Ramser J., Whittaker A., Deadman R., Carter N.P., Hunt S.E., Chen R., Cree A., Gunaratne P., Havlak P., Hodgson A., Metzker M.L., Richards S., Scott G., Steffen D., Sodergren E., Wheeler D.A., Worley K.C., Ainscough R., Ambrose K.D., Ansari-Lari M.A., Aradhya S., Ashwell R.I., Babbage A.K., Bagguley C.L., Ballabio A., Banerjee R., Barker G.E., Barlow K.F., Barrett I.P., Bates K.N., Beare D.M., Beasley H., Beasley O., Beck A., Bethel G., Blechschmidt K., Brady N., Bray-Allen S., Bridgeman A.M., Brown A.J., Brown M.J., Bonnin D., Bruford E.A., Buhay C., Burch P., Burford D., Burgess J., Burrill W., Burton J., Bye J.M., Carder C., Carrel L., Chako J., Chapman J.C., Chavez D., Chen E., Chen G., Chen Y., Chen Z., Chinault C., Ciccodicola A., Clark S.Y., Clarke G., Clee C.M., Clegg S., Clerc-Blankenburg K., Clifford K., Cobley V., Cole C.G., Conquer J.S., Corby N., Connor R.E., David R., Davies J., Davis C., Davis J., Delgado O., Deshazo D., Dhami P., Ding Y., Dinh H., Dodsworth S., Draper H., Dugan-Rocha S., Dunham A., Dunn M., Durbin K.J., Dutta I., Eades T., Ellwood M., Emery-Cohen A., Errington H., Evans K.L., Faulkner L., Francis F., Frankland J., Fraser A.E., Galgoczy P., Gilbert J., Gill R., Gloeckner G., Gregory S.G., Gribble S., Griffiths C., Grocock R., Gu Y., Gwilliam R., Hamilton C., Hart E.A., Hawes A., Heath P.D., Heitmann K., Hennig S., Hernandez J., Hinzmann B., Ho S., Hoffs M., Howden P.J., Huckle E.J., Hume J., Hunt P.J., Hunt A.R., Isherwood J., Jacob L., Johnson D., Jones S., de Jong P.J., Joseph S.S., Keenan S., Kelly S., Kershaw J.K., Khan Z., Kioschis P., Klages S., Knights A.J., Kosiura A., Kovar-Smith C., Laird G.K., Langford C., Lawlor S., Leversha M., Lewis L., Liu W., Lloyd C., Lloyd D.M., Loulseged H., Loveland J.E., Lovell J.D., Lozado R., Lu J., Lyne R., Ma J., Maheshwari M., Matthews L.H., McDowall J., McLaren S., McMurray A., Meidl P., Meitinger T., Milne S., Miner G., Mistry S.L., Morgan M., Morris S., Mueller I., Mullikin J.C., Nguyen N., Nordsiek G., Nyakatura G., O'dell C.N., Okwuonu G., Palmer S., Pandian R., Parker D., Parrish J., Pasternak S., Patel D., Pearce A.V., Pearson D.M., Pelan S.E., Perez L., Porter K.M., Ramsey Y., Reichwald K., Rhodes S., Ridler K.A., Schlessinger D., Schueler M.G., Sehra H.K., Shaw-Smith C., Shen H., Sheridan E.M., Shownkeen R., Skuce C.D., Smith M.L., Sotheran E.C., Steingruber H.E., Steward C.A., Storey R., Swann R.M., Swarbreck D., Tabor P.E., Taudien S., Taylor T., Teague B., Thomas K., Thorpe A., Timms K., Tracey A., Trevanion S., Tromans A.C., d'Urso M., Verduzco D., Villasana D., Waldron L., Wall M., Wang Q., Warren J., Warry G.L., Wei X., West A., Whitehead S.L., Whiteley M.N., Wilkinson J.E., Willey D.L., Williams G., Williams L., Williamson A., Williamson H., Wilming L., Woodmansey R.L., Wray P.W., Yen J., Zhang J., Zhou J., Zoghbi H., Zorilla S., Buck D., Reinhardt R., Poustka A., Rosenthal A., Lehrach H., Meindl A., Minx P.J., Hillier L.W., Willard H.F., Wilson R.K., Waterston R.H., Rice C.M., Vaudin M., Coulson A., Nelson D.L., Weinstock G., Sulston J.E., Durbin R.M., Hubbard T., Gibbs R.A., Beck S., Rogers J., Bentley D.R.
    Nature 434:325-337(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Uterus.
  7. "Human Bex2 interacts with LMO2 and regulates the transcriptional activity of a novel DNA-binding complex."
    Han C., Liu H., Liu J., Yin K., Xie Y., Shen X., Wang Y., Yuan J., Qiang B., Liu Y.-J., Peng X.
    Nucleic Acids Res. 33:6555-6565(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, INTERACTION WITH LMO2.
  8. "BEX2 regulates mitochondrial apoptosis and G1 cell cycle in breast cancer."
    Naderi A., Liu J., Bennett I.C.
    Int. J. Cancer 126:1596-1610(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.

Entry informationi

Entry nameiBEX2_HUMAN
AccessioniPrimary (citable) accession number: Q9BXY8
Secondary accession number(s): B2R574
, D3DXA2, F5H7H5, Q5JVV9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 4, 2006
Last sequence update: June 1, 2001
Last modified: July 9, 2014
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi