Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcyphosin-2

Gene

CAPS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Functioni

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi458 – 469121PROSITE-ProRule annotationAdd
BLAST
Calcium bindingi494 – 505122PROSITE-ProRule annotationAdd
BLAST
Calcium bindingi530 – 541123PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

Calcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Calcyphosin-2
Alternative name(s):
Calcyphosine-2
Gene namesi
Name:CAPS2
ORF Names:UG0636c06
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:16471. CAPS2.

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38405.

Polymorphism and mutation databases

BioMutaiCAPS2.
DMDMi68840161.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 557557Calcyphosin-2PRO_0000073540Add
BLAST

Proteomic databases

PaxDbiQ9BXY5.
PRIDEiQ9BXY5.

PTM databases

iPTMnetiQ9BXY5.
PhosphoSiteiQ9BXY5.

Expressioni

Tissue specificityi

Abundantly expressed in many tissues. Expressed in brain, colon, heart, kidney, liver, lung, liver, pancreas, placenta, skeletal muscle, testis and thymus. Highest expression in colon, testis, lung, placenta and brain.1 Publication

Gene expression databases

BgeeiQ9BXY5.
CleanExiHS_CAPS2.
ExpressionAtlasiQ9BXY5. baseline and differential.
GenevisibleiQ9BXY5. HS.

Organism-specific databases

HPAiHPA040004.

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000386959.

Structurei

3D structure databases

ProteinModelPortaliQ9BXY5.
SMRiQ9BXY5. Positions 451-557.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini445 – 48036EF-hand 1PROSITE-ProRule annotationAdd
BLAST
Domaini481 – 51636EF-hand 2PROSITE-ProRule annotationAdd
BLAST
Domaini517 – 55236EF-hand 3PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 3 EF-hand domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0032. Eukaryota.
ENOG410XRMJ. LUCA.
GeneTreeiENSGT00390000000679.
HOGENOMiHOG000090014.
HOVERGENiHBG080987.
InParanoidiQ9BXY5.
OMAiWTSESWT.
OrthoDBiEOG7060QG.
PhylomeDBiQ9BXY5.
TreeFamiTF323924.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS50222. EF_HAND_2. 3 hits.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BXY5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNSFCYTAV YCMINTGTQM DLEVKGVAAT SRSQIQPFFG RKKPLQQRWT
60 70 80 90 100
SESWTNQNSC PPVVPRLDLG SLVDSDDEDN FSYIPLSTAN LPNSSSTLGW
110 120 130 140 150
VTPCQTPYTQ YHLNKLDQNI IPENLPAPTD KCKLKYQQCK TEIKEGYKQY
160 170 180 190 200
SQRNAENTKS NVTHKQSPRN KIDEKCVQDE EANTDDLTTL DRKAILQQGY
210 220 230 240 250
ADNSCDKQQR ARKLDAEIVA AEKKKQIVAE QVMIDHLSRA VISDPEQNLA
260 270 280 290 300
IEQKESDHIL PDSKMTPLRF RKRTLHETKI RTHSTLTENV LSHKLQFDGR
310 320 330 340 350
IVSRNGRDAC RELIGFFFTH DQSLTIYEYR QFGKNRTNVL PFIQKSIYSH
360 370 380 390 400
QCGRRKGKQY RLGDFYVGAT LTFLSSDHLS LPESIKENTL LKLRITNIDQ
410 420 430 440 450
IALDSLKTAS MEQEDDIIIQ ETNDRLVFKA IQDVLKEKLH KRGVRILTGL
460 470 480 490 500
GKYFQQLDKE GNGLLDKADF KQALKVFHLE VSEKDFESAW LILNDNGNGK
510 520 530 540 550
VDYGEFKRGI IGEMNEYRKS YVRKAFMKLD FNKSGSVPII NIRKCYCAKK

HSQVISG
Length:557
Mass (Da):63,835
Last modified:July 5, 2005 - v2
Checksum:iF592985889A010EE
GO
Isoform 2 (identifier: Q9BXY5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-232: Missing.
     557-557: G → GHSTEEEIKSSFLETLKVACSKSDEVSYGEFEDYYEGLSIGIVDDEDFVNILRTPWGI

Show »
Length:382
Mass (Da):44,049
Checksum:iD22B09BDFE30DE52
GO
Isoform 3 (identifier: Q9BXY5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-232: Missing.
     304-335: Missing.

Show »
Length:293
Mass (Da):33,710
Checksum:iE48616FD22F3F62C
GO

Sequence cautioni

The sequence AAN76511.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC03845.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti186 – 1861D → G in AAN76511 (Ref. 4) Curated
Sequence conflicti487 – 4871E → G in BAC03845 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti125 – 1251L → F.
Corresponds to variant rs10879901 [ dbSNP | Ensembl ].
VAR_061085

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 232232Missing in isoform 2 and isoform 3. 2 PublicationsVSP_014408Add
BLAST
Alternative sequencei304 – 33532Missing in isoform 3. 1 PublicationVSP_014409Add
BLAST
Alternative sequencei557 – 5571G → GHSTEEEIKSSFLETLKVAC SKSDEVSYGEFEDYYEGLSI GIVDDEDFVNILRTPWGI in isoform 2. 1 PublicationVSP_014410

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF251056 mRNA. Translation: AAK34946.1.
AK091839 mRNA. Translation: BAC03759.1.
AK092274 mRNA. Translation: BAC03845.1. Different initiation.
BC056672 mRNA. Translation: AAH56672.1.
AF351611 mRNA. Translation: AAN76511.1. Different initiation.
CCDSiCCDS73497.1. [Q9BXY5-2]
CCDS9008.2. [Q9BXY5-1]
PIRiJC7811.
RefSeqiNP_001273476.1. NM_001286547.1.
NP_001273477.1. NM_001286548.1. [Q9BXY5-2]
NP_001273478.1. NM_001286549.1.
NP_115995.2. NM_032606.3. [Q9BXY5-1]
XP_005269251.1. XM_005269194.3. [Q9BXY5-3]
XP_011537194.1. XM_011538892.1. [Q9BXY5-2]
UniGeneiHs.733835.

Genome annotation databases

EnsembliENST00000393284; ENSP00000376963; ENSG00000180881. [Q9BXY5-2]
ENST00000409445; ENSP00000386959; ENSG00000180881. [Q9BXY5-1]
GeneIDi84698.
KEGGihsa:84698.
UCSCiuc001sxk.4. human. [Q9BXY5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF251056 mRNA. Translation: AAK34946.1.
AK091839 mRNA. Translation: BAC03759.1.
AK092274 mRNA. Translation: BAC03845.1. Different initiation.
BC056672 mRNA. Translation: AAH56672.1.
AF351611 mRNA. Translation: AAN76511.1. Different initiation.
CCDSiCCDS73497.1. [Q9BXY5-2]
CCDS9008.2. [Q9BXY5-1]
PIRiJC7811.
RefSeqiNP_001273476.1. NM_001286547.1.
NP_001273477.1. NM_001286548.1. [Q9BXY5-2]
NP_001273478.1. NM_001286549.1.
NP_115995.2. NM_032606.3. [Q9BXY5-1]
XP_005269251.1. XM_005269194.3. [Q9BXY5-3]
XP_011537194.1. XM_011538892.1. [Q9BXY5-2]
UniGeneiHs.733835.

3D structure databases

ProteinModelPortaliQ9BXY5.
SMRiQ9BXY5. Positions 451-557.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

STRINGi9606.ENSP00000386959.

PTM databases

iPTMnetiQ9BXY5.
PhosphoSiteiQ9BXY5.

Polymorphism and mutation databases

BioMutaiCAPS2.
DMDMi68840161.

Proteomic databases

PaxDbiQ9BXY5.
PRIDEiQ9BXY5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000393284; ENSP00000376963; ENSG00000180881. [Q9BXY5-2]
ENST00000409445; ENSP00000386959; ENSG00000180881. [Q9BXY5-1]
GeneIDi84698.
KEGGihsa:84698.
UCSCiuc001sxk.4. human. [Q9BXY5-1]

Organism-specific databases

CTDi84698.
GeneCardsiCAPS2.
HGNCiHGNC:16471. CAPS2.
HPAiHPA040004.
MIMi607724. gene.
neXtProtiNX_Q9BXY5.
PharmGKBiPA38405.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0032. Eukaryota.
ENOG410XRMJ. LUCA.
GeneTreeiENSGT00390000000679.
HOGENOMiHOG000090014.
HOVERGENiHBG080987.
InParanoidiQ9BXY5.
OMAiWTSESWT.
OrthoDBiEOG7060QG.
PhylomeDBiQ9BXY5.
TreeFamiTF323924.

Miscellaneous databases

GenomeRNAii84698.
PROiQ9BXY5.
SOURCEiSearch...

Gene expression databases

BgeeiQ9BXY5.
CleanExiHS_CAPS2.
ExpressionAtlasiQ9BXY5. baseline and differential.
GenevisibleiQ9BXY5. HS.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR002048. EF_hand_dom.
[Graphical view]
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS50222. EF_HAND_2. 3 hits.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning, characterization, and expression of calcyphosine 2, a novel human gene encoding an EF-hand Ca(2+)-binding protein."
    Wang S., Chen J.-Z., Zhang Z., Huang Q., Gu S., Ying K., Xie Y., Mao Y.
    Biochem. Biophys. Res. Commun. 291:414-420(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 197-557 (ISOFORMS 1/2).
    Tissue: Tongue.
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Testis.
  4. "Isolation of full-length cDNA clones from human fetal brain cDNA library."
    Mao Y., Xie Y.
    Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 33-557 (ISOFORMS 1/2).
    Tissue: Fetal brain.

Entry informationi

Entry nameiCAYP2_HUMAN
AccessioniPrimary (citable) accession number: Q9BXY5
Secondary accession number(s): Q6PH84, Q8N242, Q8NAY5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 29, 2003
Last sequence update: July 5, 2005
Last modified: June 8, 2016
This is version 124 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.