Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcyphosin-2

Gene

CAPS2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at transcript leveli

Functioni

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi458 – 4691PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi494 – 5052PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi530 – 5413PROSITE-ProRule annotationAdd BLAST12

GO - Molecular functioni

GO - Biological processi

Keywordsi

LigandCalcium, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Calcyphosin-2
Alternative name(s):
Calcyphosine-2
Gene namesi
Name:CAPS2
ORF Names:UG0636c06
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

EuPathDBiHostDB:ENSG00000180881.19
HGNCiHGNC:16471 CAPS2
MIMi607724 gene
neXtProtiNX_Q9BXY5

Pathology & Biotechi

Organism-specific databases

DisGeNETi84698
OpenTargetsiENSG00000180881
PharmGKBiPA38405

Polymorphism and mutation databases

BioMutaiCAPS2
DMDMi68840161

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000735401 – 557Calcyphosin-2Add BLAST557

Proteomic databases

PaxDbiQ9BXY5
PeptideAtlasiQ9BXY5
PRIDEiQ9BXY5

PTM databases

iPTMnetiQ9BXY5
PhosphoSitePlusiQ9BXY5

Expressioni

Tissue specificityi

Abundantly expressed in many tissues. Expressed in brain, colon, heart, kidney, liver, lung, liver, pancreas, placenta, skeletal muscle, testis and thymus. Highest expression in colon, testis, lung, placenta and brain.1 Publication

Gene expression databases

BgeeiENSG00000180881
CleanExiHS_CAPS2
ExpressionAtlasiQ9BXY5 baseline and differential
GenevisibleiQ9BXY5 HS

Organism-specific databases

HPAiHPA040004

Interactioni

Protein-protein interaction databases

STRINGi9606.ENSP00000386959

Structurei

3D structure databases

ProteinModelPortaliQ9BXY5
SMRiQ9BXY5
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini445 – 480EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini481 – 516EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini517 – 552EF-hand 3PROSITE-ProRule annotationAdd BLAST36

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG0032 Eukaryota
ENOG410XRMJ LUCA
GeneTreeiENSGT00390000000679
HOGENOMiHOG000090014
HOVERGENiHBG080987
InParanoidiQ9BXY5
OMAiVQFDGRI
OrthoDBiEOG091G05C0
PhylomeDBiQ9BXY5
TreeFamiTF323924

Family and domain databases

CDDicd00051 EFh, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR002048 EF_hand_dom
SMARTiView protein in SMART
SM00054 EFh, 2 hits
SUPFAMiSSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS50222 EF_HAND_2, 3 hits

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BXY5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGNSFCYTAV YCMINTGTQM DLEVKGVAAT SRSQIQPFFG RKKPLQQRWT
60 70 80 90 100
SESWTNQNSC PPVVPRLDLG SLVDSDDEDN FSYIPLSTAN LPNSSSTLGW
110 120 130 140 150
VTPCQTPYTQ YHLNKLDQNI IPENLPAPTD KCKLKYQQCK TEIKEGYKQY
160 170 180 190 200
SQRNAENTKS NVTHKQSPRN KIDEKCVQDE EANTDDLTTL DRKAILQQGY
210 220 230 240 250
ADNSCDKQQR ARKLDAEIVA AEKKKQIVAE QVMIDHLSRA VISDPEQNLA
260 270 280 290 300
IEQKESDHIL PDSKMTPLRF RKRTLHETKI RTHSTLTENV LSHKLQFDGR
310 320 330 340 350
IVSRNGRDAC RELIGFFFTH DQSLTIYEYR QFGKNRTNVL PFIQKSIYSH
360 370 380 390 400
QCGRRKGKQY RLGDFYVGAT LTFLSSDHLS LPESIKENTL LKLRITNIDQ
410 420 430 440 450
IALDSLKTAS MEQEDDIIIQ ETNDRLVFKA IQDVLKEKLH KRGVRILTGL
460 470 480 490 500
GKYFQQLDKE GNGLLDKADF KQALKVFHLE VSEKDFESAW LILNDNGNGK
510 520 530 540 550
VDYGEFKRGI IGEMNEYRKS YVRKAFMKLD FNKSGSVPII NIRKCYCAKK

HSQVISG
Length:557
Mass (Da):63,835
Last modified:July 5, 2005 - v2
Checksum:iF592985889A010EE
GO
Isoform 2 (identifier: Q9BXY5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-232: Missing.
     557-557: G → GHSTEEEIKSSFLETLKVACSKSDEVSYGEFEDYYEGLSIGIVDDEDFVNILRTPWGI

Show »
Length:382
Mass (Da):44,049
Checksum:iD22B09BDFE30DE52
GO
Isoform 3 (identifier: Q9BXY5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-232: Missing.
     304-335: Missing.

Show »
Length:293
Mass (Da):33,710
Checksum:iE48616FD22F3F62C
GO

Sequence cautioni

The sequence AAN76511 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAC03845 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti186D → G in AAN76511 (Ref. 4) Curated1
Sequence conflicti487E → G in BAC03845 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_061085125L → F. Corresponds to variant dbSNP:rs10879901Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0144081 – 232Missing in isoform 2 and isoform 3. 2 PublicationsAdd BLAST232
Alternative sequenceiVSP_014409304 – 335Missing in isoform 3. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_014410557G → GHSTEEEIKSSFLETLKVAC SKSDEVSYGEFEDYYEGLSI GIVDDEDFVNILRTPWGI in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF251056 mRNA Translation: AAK34946.1
AK091839 mRNA Translation: BAC03759.1
AK092274 mRNA Translation: BAC03845.1 Different initiation.
BC056672 mRNA Translation: AAH56672.1
AF351611 mRNA Translation: AAN76511.1 Different initiation.
CCDSiCCDS73497.1 [Q9BXY5-2]
CCDS9008.2 [Q9BXY5-1]
PIRiJC7811
RefSeqiNP_001273477.1, NM_001286548.1 [Q9BXY5-2]
NP_115995.2, NM_032606.3 [Q9BXY5-1]
XP_005269251.1, XM_005269194.3 [Q9BXY5-3]
XP_011537194.1, XM_011538892.1
XP_016875525.1, XM_017020036.1 [Q9BXY5-2]
XP_016875526.1, XM_017020037.1
XP_016875527.1, XM_017020038.1
UniGeneiHs.733835

Genome annotation databases

EnsembliENST00000393284; ENSP00000376963; ENSG00000180881 [Q9BXY5-2]
ENST00000409445; ENSP00000386959; ENSG00000180881 [Q9BXY5-1]
GeneIDi84698
KEGGihsa:84698
UCSCiuc001sxk.4 human [Q9BXY5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCAYP2_HUMAN
AccessioniPrimary (citable) accession number: Q9BXY5
Secondary accession number(s): Q6PH84, Q8N242, Q8NAY5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: August 29, 2003
Last sequence update: July 5, 2005
Last modified: February 28, 2018
This is version 137 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome