Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium-binding protein 8

Gene

CALN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at transcript leveli

Functioni

Negatively regulates Golgi-to-plasma membrane trafficking by interacting with PI4KB and inhibiting its activity (By similarity). May play a role in the physiology of neurons and is potentially important in memory and learning.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi49 – 601PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi85 – 962PROSITE-ProRule annotationAdd BLAST12

GO - Molecular functioni

Complete GO annotation...

Keywords - Ligandi

Calcium, Metal-binding

Enzyme and pathway databases

BioCyciZFISH:G66-31513-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-binding protein 8
Short name:
CaBP8
Alternative name(s):
Calneuron I
Calneuron-1
Gene namesi
Name:CALN1
Synonyms:CABP8
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:13248. CALN1.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 192CytoplasmicSequence analysisAdd BLAST192
Transmembranei193 – 213Helical; Anchor for type IV membrane proteinSequence analysisAdd BLAST21
Topological domaini214 – 219ExtracellularSequence analysis6

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Golgi apparatus, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi83698.
OpenTargetsiENSG00000183166.
PharmGKBiPA26045.

Polymorphism and mutation databases

BioMutaiCALN1.
DMDMi20177867.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000735291 – 219Calcium-binding protein 8Add BLAST219

Proteomic databases

PaxDbiQ9BXU9.
PeptideAtlasiQ9BXU9.
PRIDEiQ9BXU9.

PTM databases

PhosphoSitePlusiQ9BXU9.

Expressioni

Tissue specificityi

Brain specific.

Gene expression databases

BgeeiENSG00000183166.
CleanExiHS_CALN1.
ExpressionAtlasiQ9BXU9. baseline and differential.
GenevisibleiQ9BXU9. HS.

Organism-specific databases

HPAiHPA036278.

Interactioni

Subunit structurei

Interacts with PI4KB. This binding competes with FREQ/NCS1 binding in a calcium-dependent manner (By similarity).By similarity

Protein-protein interaction databases

BioGridi123732. 1 interactor.
IntActiQ9BXU9. 1 interactor.
STRINGi9606.ENSP00000378690.

Structurei

3D structure databases

ProteinModelPortaliQ9BXU9.
SMRiQ9BXU9.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini36 – 71EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini72 – 107EF-hand 2PROSITE-ProRule annotationAdd BLAST36

Domaini

The C-terminal transmembrane domain (TMD) is necessary and sufficient for membrane targeting.

Sequence similaritiesi

Contains 2 EF-hand domains.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0027. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00740000115520.
HOGENOMiHOG000252990.
InParanoidiQ9BXU9.
OMAiHILFYAF.
OrthoDBiEOG091G0IMT.
PhylomeDBiQ9BXU9.
TreeFamiTF331025.

Family and domain databases

CDDicd00051. EFh. 1 hit.
Gene3Di1.10.238.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR001751. S100/CaBP-9k_CS.
[Graphical view]
PfamiPF13499. EF-hand_7. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 2 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BXU9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPFHHVTAGL LYKGNYLNRS LSAGSDSEQL ANISVEELDE IREAFRVLDR
60 70 80 90 100
DGNGFISKQE LGMAMRSLGY MPSEVELAII MQRLDMDGDG QVDFDEFMTI
110 120 130 140 150
LGPKLVSSEG RDGFLGNTID SIFWQFDMQR ITLEELKHIL YHAFRDHLTM
160 170 180 190 200
KDIENIIINE EESLNETSGN CQTEFEGVHS QKQNRQTCVR KSLICAFAMA
210
FIISVMLIAA NQILRSGME
Length:219
Mass (Da):24,837
Last modified:June 1, 2001 - v1
Checksum:iEAD2BE2090F5CA0F
GO
Isoform 2 (identifier: Q9BXU9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MRLPEQPGEGKPENEKKGDGGALGGGEEPPRSQAPDFPTWEKM

Show »
Length:261
Mass (Da):29,324
Checksum:i8276320AD714FACD
GO

Sequence cautioni

The sequence AAG09620 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0471481M → MRLPEQPGEGKPENEKKGDG GALGGGEEPPRSQAPDFPTW EKM in isoform 2. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF282250 mRNA. Translation: AAK15155.1.
AY007302 mRNA. Translation: AAG09620.1. Different initiation.
BC020200 mRNA. Translation: AAH20200.1.
AC004845 Genomic DNA. No translation available.
AC004905 Genomic DNA. No translation available.
AC005011 Genomic DNA. No translation available.
AC006334 Genomic DNA. No translation available.
AC067941 Genomic DNA. No translation available.
AC092424 Genomic DNA. No translation available.
AC092785 Genomic DNA. No translation available.
CH471140 Genomic DNA. Translation: EAX07902.1.
CCDSiCCDS47603.1. [Q9BXU9-2]
CCDS5541.1. [Q9BXU9-1]
RefSeqiNP_001017440.1. NM_001017440.2. [Q9BXU9-1]
NP_113656.2. NM_031468.3. [Q9BXU9-2]
XP_011514897.1. XM_011516595.1. [Q9BXU9-1]
XP_011514898.1. XM_011516596.2. [Q9BXU9-1]
XP_011514899.1. XM_011516597.2. [Q9BXU9-1]
XP_011514901.1. XM_011516599.1. [Q9BXU9-1]
XP_016868164.1. XM_017012675.1. [Q9BXU9-2]
XP_016868165.1. XM_017012676.1. [Q9BXU9-2]
XP_016868167.1. XM_017012678.1. [Q9BXU9-1]
XP_016868168.1. XM_017012679.1. [Q9BXU9-1]
XP_016868169.1. XM_017012680.1. [Q9BXU9-1]
XP_016868170.1. XM_017012681.1. [Q9BXU9-1]
XP_016868171.1. XM_017012682.1. [Q9BXU9-1]
XP_016868172.1. XM_017012683.1. [Q9BXU9-1]
UniGeneiHs.592750.

Genome annotation databases

EnsembliENST00000329008; ENSP00000332498; ENSG00000183166. [Q9BXU9-1]
ENST00000395275; ENSP00000378690; ENSG00000183166. [Q9BXU9-2]
ENST00000395276; ENSP00000378691; ENSG00000183166. [Q9BXU9-1]
ENST00000431984; ENSP00000410704; ENSG00000183166. [Q9BXU9-1]
GeneIDi83698.
KEGGihsa:83698.
UCSCiuc003twa.5. human. [Q9BXU9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF282250 mRNA. Translation: AAK15155.1.
AY007302 mRNA. Translation: AAG09620.1. Different initiation.
BC020200 mRNA. Translation: AAH20200.1.
AC004845 Genomic DNA. No translation available.
AC004905 Genomic DNA. No translation available.
AC005011 Genomic DNA. No translation available.
AC006334 Genomic DNA. No translation available.
AC067941 Genomic DNA. No translation available.
AC092424 Genomic DNA. No translation available.
AC092785 Genomic DNA. No translation available.
CH471140 Genomic DNA. Translation: EAX07902.1.
CCDSiCCDS47603.1. [Q9BXU9-2]
CCDS5541.1. [Q9BXU9-1]
RefSeqiNP_001017440.1. NM_001017440.2. [Q9BXU9-1]
NP_113656.2. NM_031468.3. [Q9BXU9-2]
XP_011514897.1. XM_011516595.1. [Q9BXU9-1]
XP_011514898.1. XM_011516596.2. [Q9BXU9-1]
XP_011514899.1. XM_011516597.2. [Q9BXU9-1]
XP_011514901.1. XM_011516599.1. [Q9BXU9-1]
XP_016868164.1. XM_017012675.1. [Q9BXU9-2]
XP_016868165.1. XM_017012676.1. [Q9BXU9-2]
XP_016868167.1. XM_017012678.1. [Q9BXU9-1]
XP_016868168.1. XM_017012679.1. [Q9BXU9-1]
XP_016868169.1. XM_017012680.1. [Q9BXU9-1]
XP_016868170.1. XM_017012681.1. [Q9BXU9-1]
XP_016868171.1. XM_017012682.1. [Q9BXU9-1]
XP_016868172.1. XM_017012683.1. [Q9BXU9-1]
UniGeneiHs.592750.

3D structure databases

ProteinModelPortaliQ9BXU9.
SMRiQ9BXU9.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123732. 1 interactor.
IntActiQ9BXU9. 1 interactor.
STRINGi9606.ENSP00000378690.

PTM databases

PhosphoSitePlusiQ9BXU9.

Polymorphism and mutation databases

BioMutaiCALN1.
DMDMi20177867.

Proteomic databases

PaxDbiQ9BXU9.
PeptideAtlasiQ9BXU9.
PRIDEiQ9BXU9.

Protocols and materials databases

DNASUi83698.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000329008; ENSP00000332498; ENSG00000183166. [Q9BXU9-1]
ENST00000395275; ENSP00000378690; ENSG00000183166. [Q9BXU9-2]
ENST00000395276; ENSP00000378691; ENSG00000183166. [Q9BXU9-1]
ENST00000431984; ENSP00000410704; ENSG00000183166. [Q9BXU9-1]
GeneIDi83698.
KEGGihsa:83698.
UCSCiuc003twa.5. human. [Q9BXU9-1]

Organism-specific databases

CTDi83698.
DisGeNETi83698.
GeneCardsiCALN1.
HGNCiHGNC:13248. CALN1.
HPAiHPA036278.
MIMi607176. gene.
neXtProtiNX_Q9BXU9.
OpenTargetsiENSG00000183166.
PharmGKBiPA26045.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0027. Eukaryota.
COG5126. LUCA.
GeneTreeiENSGT00740000115520.
HOGENOMiHOG000252990.
InParanoidiQ9BXU9.
OMAiHILFYAF.
OrthoDBiEOG091G0IMT.
PhylomeDBiQ9BXU9.
TreeFamiTF331025.

Enzyme and pathway databases

BioCyciZFISH:G66-31513-MONOMER.

Miscellaneous databases

ChiTaRSiCALN1. human.
GeneWikiiCALN1.
GenomeRNAii83698.
PROiQ9BXU9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000183166.
CleanExiHS_CALN1.
ExpressionAtlasiQ9BXU9. baseline and differential.
GenevisibleiQ9BXU9. HS.

Family and domain databases

CDDicd00051. EFh. 1 hit.
Gene3Di1.10.238.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR001751. S100/CaBP-9k_CS.
[Graphical view]
PfamiPF13499. EF-hand_7. 1 hit.
[Graphical view]
SMARTiSM00054. EFh. 2 hits.
[Graphical view]
SUPFAMiSSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 2 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCABP8_HUMAN
AccessioniPrimary (citable) accession number: Q9BXU9
Secondary accession number(s): J3KQA7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 16, 2002
Last sequence update: June 1, 2001
Last modified: November 30, 2016
This is version 131 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.