Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BXT8 (RNF17_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 113. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (6) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
RING finger protein 17
Alternative name(s):
Tudor domain-containing protein 4
Gene names
Name:RNF17
Synonyms:TDRD4
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length1623 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Seems to be involved in regulation of transcriptional activity of MYC. In vitro, inhibits DNA-binding activity of Mad-MAX heterodimers. Can recruit Mad transcriptional repressors (MXD1, MXD3, MXD4 and MXI1) to the cytoplasm. May be involved in spermiogenesis By similarity.

Subunit structure

Interacts with MXD1, MXD3, MXD4, MXI1 and PIWIL1. Self-associates By similarity.

Subcellular location

Cytoplasm By similarity. Nucleus By similarity. Note: Predominantly found in the cytoplasm. Component of a nuage in male germ cells (an electron-dense spherical cytoplasmic body present in late pachytene and diplotene spermatocytes and in elonging spermatids) By similarity.

Tissue specificity

Testis specific.

Sequence similarities

Contains 1 RING-type zinc finger.

Contains 4 Tudor domains.

Sequence caution

The sequence AAH64847.1 differs from that shown. Reason: Erroneous initiation.

The sequence BAA91972.1 differs from that shown. Reason: Erroneous initiation.

Ontologies

Alternative products

This entry describes 5 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BXT8-3)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform 2 (identifier: Q9BXT8-1)

The sequence of this isoform differs from the canonical sequence as follows:
     651-653: FKS → DLI
     654-1623: Missing.
Isoform 3 (identifier: Q9BXT8-2)

The sequence of this isoform differs from the canonical sequence as follows:
     414-449: SSAELVFVSHVIDPCHFYIRKYSQIKDAKVLEKKVN → TCGTDDLGETPRYPKKPLQKNSSVPFGSKADTVTTV
     450-1623: Missing.
Isoform 4 (identifier: Q9BXT8-4)

The sequence of this isoform differs from the canonical sequence as follows:
     1326-1368: ELPKNPWEKLSIHLYFDGMSLSYFMAYYKYCTSEHTEEMLKEK → K
Isoform 5 (identifier: Q9BXT8-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1320-1325: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 16231623RING finger protein 17
PRO_0000183165

Regions

Domain726 – 78459Tudor 1
Domain962 – 102160Tudor 2
Domain1228 – 128558Tudor 3
Domain1479 – 153961Tudor 4
Zinc finger32 – 7544RING-type

Amino acid modifications

Modified residue2341N6-acetyllysine By similarity

Natural variations

Alternative sequence414 – 44936SSAEL…EKKVN → TCGTDDLGETPRYPKKPLQK NSSVPFGSKADTVTTV in isoform 3.
VSP_005753
Alternative sequence450 – 16231174Missing in isoform 3.
VSP_005754
Alternative sequence651 – 6533FKS → DLI in isoform 2.
VSP_033073
Alternative sequence654 – 1623970Missing in isoform 2.
VSP_033074
Alternative sequence1320 – 13256Missing in isoform 5.
VSP_033075
Alternative sequence1326 – 136843ELPKN…MLKEK → K in isoform 4.
VSP_033076
Natural variant3461K → N.
Corresponds to variant rs1451568 [ dbSNP | Ensembl ].
VAR_024613
Natural variant4671G → S.
Corresponds to variant rs9581180 [ dbSNP | Ensembl ].
VAR_028132
Natural variant5011S → G.
Corresponds to variant rs9507413 [ dbSNP | Ensembl ].
VAR_028133
Natural variant5731A → P.
Corresponds to variant rs10161760 [ dbSNP | Ensembl ].
VAR_052098
Natural variant6671H → R.
Corresponds to variant rs9511451 [ dbSNP | Ensembl ].
VAR_052099
Natural variant11101N → K.
Corresponds to variant rs3783082 [ dbSNP | Ensembl ].
VAR_052100
Natural variant13801E → K. Ref.3 Ref.4
Corresponds to variant rs9507425 [ dbSNP | Ensembl ].
VAR_052101

Experimental info

Sequence conflict3611P → S in AAK31981. Ref.1

Secondary structure

................... 1623
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified April 29, 2008. Version 3.
Checksum: 3E710E6DD706CDF9

FASTA1,623184,643
        10         20         30         40         50         60 
MAAEASKTGP SRSSYQRMGR KSQPWGAAEI QCTRCGRRVS RSSGHHCELQ CGHAFCELCL 

        70         80         90        100        110        120 
LMTEECTTII CPDCEVATAV NTRQRYYPMA GYIKEDSIME KLQPKTIKNC SQDFKKTADQ 

       130        140        150        160        170        180 
LTTGLERSAS TDKTLLNSSA VMLDTNTAEE IDEALNTAHH SFEQLSIAGK ALEHMQKQTI 

       190        200        210        220        230        240 
EERERVIEVV EKQFDQLLAF FDSRKKNLCE EFARTTDDYL SNLIKAKSYI EEKKNNLNAA 

       250        260        270        280        290        300 
MNIARALQLS PSLRTYCDLN QIIRTLQLTS DSELAQVSSP QLRNPPRLSV NCSEIICMFN 

       310        320        330        340        350        360 
NMGKIEFRDS TKCYPQENEI RQNVQKKYNN KKELSCYDTY PPLEKKKVDM SVLTSEAPPP 

       370        380        390        400        410        420 
PLQPETNDVH LEAKNFQPQK DVATASPKTI AVLPQMGSSP DVIIEEIIED NVESSAELVF 

       430        440        450        460        470        480 
VSHVIDPCHF YIRKYSQIKD AKVLEKKVNE FCNRSSHLDP SDILELGARI FVSSIKNGMW 

       490        500        510        520        530        540 
CRGTITELIP IEGRNTRKPC SPTRLFVHEV ALIQIFMVDF GNSEVLIVTG VVDTHVRPEH 

       550        560        570        580        590        600 
SAKQHIALND LCLVLRKSEP YTEGLLKDIQ PLAQPCSLKD IVPQNSNEGW EEEAKVEFLK 

       610        620        630        640        650        660 
MVNNKAVSMK VFREEDGVLI VDLQKPPPNK ISSDMPVSLR DALVFMELAK FKSQSLRSHF 

       670        680        690        700        710        720 
EKNTTLHYHP PILPKEMTDV SVTVCHINSP GDFYLQLIEG LDILFLLKTI EEFYKSEDGE 

       730        740        750        760        770        780 
NLEILCPVQD QACVAKFEDG IWYRAKVIGL PGHQEVEVKY VDFGNTAKIT IKDVRKIKDE 

       790        800        810        820        830        840 
FLNAPEKAIK CKLAYIEPYK RTMQWSKEAK EKFEEKAQDK FMTCSVIKIL EDNVLLVELF 

       850        860        870        880        890        900 
DSLGAPEMTT TSINDQLVKE GLASYEIGYI LKDNSQKHIE VWDPSPEEII SNEVHNLNPV 

       910        920        930        940        950        960 
SAKSLPNENF QSLYNKELPV HICNVISPEK IYVQWLLTEN LLNSLEEKMI AAYENSKWEP 

       970        980        990       1000       1010       1020 
VKWENDMHCA VKIQDKNQWR RGQIIRMVTD TLVEVLLYDV GVELVVNVDC LRKLEENLKT 

      1030       1040       1050       1060       1070       1080 
MGRLSLECSL VDIRPAGGSD KWTATACDCL SLYLTGAVAT IILQVDSEEN NTTWPLPVKI 

      1090       1100       1110       1120       1130       1140 
FCRDEKGERV DVSKYLIKKG LALRERRINN LDNSHSLSEK SLEVPLEQED SVVTNCIKTN 

      1150       1160       1170       1180       1190       1200 
FDPDKKTADI ISEQKVSEFQ EKILEPRTTR GYKPPAIPNM NVFEATVSCV GDDGTIFVVP 

      1210       1220       1230       1240       1250       1260 
KLSEFELIKM TNEIQSNLKC LGLLEPYFWK KGEACAVRGS DTLWYRGKVM EVVGGAVRVQ 

      1270       1280       1290       1300       1310       1320 
YLDHGFTEKI PQCHLYPILL YPDIPQFCIP CQLHNTTPVG NVWQPDAIEV LQQLLSKRQV 

      1330       1340       1350       1360       1370       1380 
DIHIMELPKN PWEKLSIHLY FDGMSLSYFM AYYKYCTSEH TEEMLKEKPR SDHDKKYEEE 

      1390       1400       1410       1420       1430       1440 
QWEIRFEELL SAETDTPLLP PYLSSSLPSP GELYAVQVKH VVSPNEVYIC LDSIETSNQS 

      1450       1460       1470       1480       1490       1500 
NQHSDTDDSG VSGESESESL DEALQRVNKK VEALPPLTDF RTEMPCLAEY DDGLWYRAKI 

      1510       1520       1530       1540       1550       1560 
VAIKEFNPLS ILVQFVDYGS TAKLTLNRLC QIPSHLMRYP ARAIKVLLAG FKPPLRDLGE 

      1570       1580       1590       1600       1610       1620 
TRIPYCPKWS MEALWAMIDC LQGKQLYAVS MAPAPEQIVT LYDDEQHPVH MPLVEMGLAD 


KDE 

« Hide

Isoform 2 [UniParc].

Checksum: 444C911E916D20CD
Show »

FASTA65373,746
Isoform 3 [UniParc].

Checksum: 8F9E06F59E22DD6E
Show »

FASTA44950,477
Isoform 4 [UniParc].

Checksum: E290A64D77F3578B
Show »

FASTA1,581179,508
Isoform 5 [UniParc].

Checksum: 8D65E390C2828F2A
Show »

FASTA1,617183,935

References

« Hide 'large scale' references
[1]"An abundance of X-linked genes expressed in spermatogonia."
Wang P.J., McCarrey J.R., Yang F., Page D.C.
Nat. Genet. 27:422-426(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
Tissue: Testis.
[2]"The DNA sequence and analysis of human chromosome 13."
Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 765-1623 (ISOFORM 5), VARIANT LYS-1380.
Tissue: Testis.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 914-1623 (ISOFORM 4), VARIANT LYS-1380.
Tissue: Placenta.
[5]"Solution structure of the tudor domain of tudor domain-containing protein 4."
RIKEN structural genomics initiative (RSGI)
Submitted (OCT-2007) to the PDB data bank
Cited for: STRUCTURE BY NMR OF 949-1026.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF285602 mRNA. Translation: AAK31981.1.
AF285603 mRNA. Translation: AAK31982.1.
AL391560, AL354798 Genomic DNA. Translation: CAI15248.2.
AL354798, AL391560 Genomic DNA. Translation: CAM23326.1.
BC064847 mRNA. Translation: AAH64847.1. Different initiation.
AK001907 mRNA. Translation: BAA91972.1. Different initiation.
CCDSCCDS9308.2. [Q9BXT8-3]
RefSeqNP_112567.2. NM_031277.2. [Q9BXT8-3]
UniGeneHs.97464.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2EQKNMR-A949-1026[»]
ProteinModelPortalQ9BXT8.
SMRQ9BXT8. Positions 685-862, 949-1026.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid121096. 1 interaction.
IntActQ9BXT8. 3 interactions.
MINTMINT-7944917.
STRING9606.ENSP00000255324.

PTM databases

PhosphoSiteQ9BXT8.

Polymorphism databases

DMDM187608889.

Proteomic databases

MaxQBQ9BXT8.
PaxDbQ9BXT8.
PRIDEQ9BXT8.

Protocols and materials databases

DNASU56163.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000255324; ENSP00000255324; ENSG00000132972. [Q9BXT8-3]
ENST00000255325; ENSP00000255325; ENSG00000132972. [Q9BXT8-1]
ENST00000381921; ENSP00000371346; ENSG00000132972. [Q9BXT8-4]
GeneID56163.
KEGGhsa:56163.
UCSCuc001upq.1. human. [Q9BXT8-2]
uc001upr.3. human. [Q9BXT8-3]
uc010aac.3. human. [Q9BXT8-5]

Organism-specific databases

CTD56163.
GeneCardsGC13P025338.
HGNCHGNC:10060. RNF17.
HPAHPA039699.
HPA040111.
MIM605793. gene.
neXtProtNX_Q9BXT8.
PharmGKBPA34424.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG267246.
HOGENOMHOG000074158.
HOVERGENHBG108414.
OMAFEDGVWY.
OrthoDBEOG7FFMQV.
PhylomeDBQ9BXT8.

Gene expression databases

ArrayExpressQ9BXT8.
BgeeQ9BXT8.
CleanExHS_RNF17.
GenevestigatorQ9BXT8.

Family and domain databases

Gene3D2.40.50.90. 1 hit.
InterProIPR016071. Staphylococal_nuclease_OB-fold.
IPR002999. Tudor.
IPR001841. Znf_RING.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamPF00567. TUDOR. 5 hits.
[Graphical view]
SMARTSM00184. RING. 1 hit.
SM00333. TUDOR. 4 hits.
[Graphical view]
SUPFAMSSF50199. SSF50199. 1 hit.
PROSITEPS50304. TUDOR. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ9BXT8.
GenomeRNAi56163.
NextBio61792.
PROQ9BXT8.
SOURCESearch...

Entry information

Entry nameRNF17_HUMAN
AccessionPrimary (citable) accession number: Q9BXT8
Secondary accession number(s): Q5T2J9 expand/collapse secondary AC list , Q6P1W3, Q9BXT7, Q9NUY9
Entry history
Integrated into UniProtKB/Swiss-Prot: October 24, 2001
Last sequence update: April 29, 2008
Last modified: July 9, 2014
This is version 113 of the entry and version 3 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 13

Human chromosome 13: entries, gene names and cross-references to MIM