Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BXT8

- RNF17_HUMAN

UniProt

Q9BXT8 - RNF17_HUMAN

Protein

RING finger protein 17

Gene

RNF17

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 114 (01 Oct 2014)
      Sequence version 3 (29 Apr 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Seems to be involved in regulation of transcriptional activity of MYC. In vitro, inhibits DNA-binding activity of Mad-MAX heterodimers. Can recruit Mad transcriptional repressors (MXD1, MXD3, MXD4 and MXI1) to the cytoplasm. May be involved in spermiogenesis By similarity.By similarity

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri32 – 7544RING-typePROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. hydrolase activity, acting on ester bonds Source: InterPro
    2. nucleic acid binding Source: InterPro
    3. zinc ion binding Source: InterPro

    GO - Biological processi

    1. multicellular organismal development Source: UniProtKB-KW
    2. spermatid development Source: Ensembl

    Keywords - Molecular functioni

    Developmental protein

    Keywords - Biological processi

    Differentiation, Spermatogenesis

    Keywords - Ligandi

    Metal-binding, Zinc

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    RING finger protein 17
    Alternative name(s):
    Tudor domain-containing protein 4
    Gene namesi
    Name:RNF17
    Synonyms:TDRD4
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 13

    Organism-specific databases

    HGNCiHGNC:10060. RNF17.

    Subcellular locationi

    Cytoplasm By similarity. Nucleus By similarity
    Note: Predominantly found in the cytoplasm. Component of a nuage in male germ cells (an electron-dense spherical cytoplasmic body present in late pachytene and diplotene spermatocytes and in elonging spermatids) By similarity.By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA34424.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 16231623RING finger protein 17PRO_0000183165Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei234 – 2341N6-acetyllysineBy similarity

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ9BXT8.
    PaxDbiQ9BXT8.
    PRIDEiQ9BXT8.

    PTM databases

    PhosphoSiteiQ9BXT8.

    Expressioni

    Tissue specificityi

    Testis specific.

    Gene expression databases

    ArrayExpressiQ9BXT8.
    BgeeiQ9BXT8.
    CleanExiHS_RNF17.
    GenevestigatoriQ9BXT8.

    Organism-specific databases

    HPAiHPA039699.
    HPA040111.

    Interactioni

    Subunit structurei

    Interacts with MXD1, MXD3, MXD4, MXI1 and PIWIL1. Self-associates By similarity.By similarity

    Protein-protein interaction databases

    BioGridi121096. 1 interaction.
    IntActiQ9BXT8. 3 interactions.
    MINTiMINT-7944917.
    STRINGi9606.ENSP00000255324.

    Structurei

    Secondary structure

    1
    1623
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Helixi949 – 9557
    Beta strandi968 – 9725
    Beta strandi974 – 9763
    Beta strandi979 – 9879
    Beta strandi989 – 9968
    Turni998 – 10003
    Beta strandi1003 – 10075
    Turni1008 – 10103
    Beta strandi1011 – 10133
    Helixi1016 – 10194

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2EQKNMR-A949-1026[»]
    ProteinModelPortaliQ9BXT8.
    SMRiQ9BXT8. Positions 685-862, 949-1026.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9BXT8.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini726 – 78459Tudor 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini962 – 102160Tudor 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini1228 – 128558Tudor 3PROSITE-ProRule annotationAdd
    BLAST
    Domaini1479 – 153961Tudor 4PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 1 RING-type zinc finger.PROSITE-ProRule annotation
    Contains 4 Tudor domains.PROSITE-ProRule annotation

    Zinc finger

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Zinc fingeri32 – 7544RING-typePROSITE-ProRule annotationAdd
    BLAST

    Keywords - Domaini

    Repeat, Zinc-finger

    Phylogenomic databases

    eggNOGiNOG267246.
    HOGENOMiHOG000074158.
    HOVERGENiHBG108414.
    OMAiFEDGVWY.
    OrthoDBiEOG7FFMQV.
    PhylomeDBiQ9BXT8.

    Family and domain databases

    Gene3Di2.40.50.90. 1 hit.
    InterProiIPR016071. Staphylococal_nuclease_OB-fold.
    IPR002999. Tudor.
    IPR001841. Znf_RING.
    IPR017907. Znf_RING_CS.
    [Graphical view]
    PfamiPF00567. TUDOR. 5 hits.
    [Graphical view]
    SMARTiSM00184. RING. 1 hit.
    SM00333. TUDOR. 4 hits.
    [Graphical view]
    SUPFAMiSSF50199. SSF50199. 1 hit.
    PROSITEiPS50304. TUDOR. 4 hits.
    PS00518. ZF_RING_1. 1 hit.
    PS50089. ZF_RING_2. 1 hit.
    [Graphical view]

    Sequences (5)i

    Sequence statusi: Complete.

    This entry describes 5 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BXT8-3) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MAAEASKTGP SRSSYQRMGR KSQPWGAAEI QCTRCGRRVS RSSGHHCELQ     50
    CGHAFCELCL LMTEECTTII CPDCEVATAV NTRQRYYPMA GYIKEDSIME 100
    KLQPKTIKNC SQDFKKTADQ LTTGLERSAS TDKTLLNSSA VMLDTNTAEE 150
    IDEALNTAHH SFEQLSIAGK ALEHMQKQTI EERERVIEVV EKQFDQLLAF 200
    FDSRKKNLCE EFARTTDDYL SNLIKAKSYI EEKKNNLNAA MNIARALQLS 250
    PSLRTYCDLN QIIRTLQLTS DSELAQVSSP QLRNPPRLSV NCSEIICMFN 300
    NMGKIEFRDS TKCYPQENEI RQNVQKKYNN KKELSCYDTY PPLEKKKVDM 350
    SVLTSEAPPP PLQPETNDVH LEAKNFQPQK DVATASPKTI AVLPQMGSSP 400
    DVIIEEIIED NVESSAELVF VSHVIDPCHF YIRKYSQIKD AKVLEKKVNE 450
    FCNRSSHLDP SDILELGARI FVSSIKNGMW CRGTITELIP IEGRNTRKPC 500
    SPTRLFVHEV ALIQIFMVDF GNSEVLIVTG VVDTHVRPEH SAKQHIALND 550
    LCLVLRKSEP YTEGLLKDIQ PLAQPCSLKD IVPQNSNEGW EEEAKVEFLK 600
    MVNNKAVSMK VFREEDGVLI VDLQKPPPNK ISSDMPVSLR DALVFMELAK 650
    FKSQSLRSHF EKNTTLHYHP PILPKEMTDV SVTVCHINSP GDFYLQLIEG 700
    LDILFLLKTI EEFYKSEDGE NLEILCPVQD QACVAKFEDG IWYRAKVIGL 750
    PGHQEVEVKY VDFGNTAKIT IKDVRKIKDE FLNAPEKAIK CKLAYIEPYK 800
    RTMQWSKEAK EKFEEKAQDK FMTCSVIKIL EDNVLLVELF DSLGAPEMTT 850
    TSINDQLVKE GLASYEIGYI LKDNSQKHIE VWDPSPEEII SNEVHNLNPV 900
    SAKSLPNENF QSLYNKELPV HICNVISPEK IYVQWLLTEN LLNSLEEKMI 950
    AAYENSKWEP VKWENDMHCA VKIQDKNQWR RGQIIRMVTD TLVEVLLYDV 1000
    GVELVVNVDC LRKLEENLKT MGRLSLECSL VDIRPAGGSD KWTATACDCL 1050
    SLYLTGAVAT IILQVDSEEN NTTWPLPVKI FCRDEKGERV DVSKYLIKKG 1100
    LALRERRINN LDNSHSLSEK SLEVPLEQED SVVTNCIKTN FDPDKKTADI 1150
    ISEQKVSEFQ EKILEPRTTR GYKPPAIPNM NVFEATVSCV GDDGTIFVVP 1200
    KLSEFELIKM TNEIQSNLKC LGLLEPYFWK KGEACAVRGS DTLWYRGKVM 1250
    EVVGGAVRVQ YLDHGFTEKI PQCHLYPILL YPDIPQFCIP CQLHNTTPVG 1300
    NVWQPDAIEV LQQLLSKRQV DIHIMELPKN PWEKLSIHLY FDGMSLSYFM 1350
    AYYKYCTSEH TEEMLKEKPR SDHDKKYEEE QWEIRFEELL SAETDTPLLP 1400
    PYLSSSLPSP GELYAVQVKH VVSPNEVYIC LDSIETSNQS NQHSDTDDSG 1450
    VSGESESESL DEALQRVNKK VEALPPLTDF RTEMPCLAEY DDGLWYRAKI 1500
    VAIKEFNPLS ILVQFVDYGS TAKLTLNRLC QIPSHLMRYP ARAIKVLLAG 1550
    FKPPLRDLGE TRIPYCPKWS MEALWAMIDC LQGKQLYAVS MAPAPEQIVT 1600
    LYDDEQHPVH MPLVEMGLAD KDE 1623

    Note: No experimental confirmation available.

    Length:1,623
    Mass (Da):184,643
    Last modified:April 29, 2008 - v3
    Checksum:i3E710E6DD706CDF9
    GO
    Isoform 2 (identifier: Q9BXT8-1) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         651-653: FKS → DLI
         654-1623: Missing.

    Show »
    Length:653
    Mass (Da):73,746
    Checksum:i444C911E916D20CD
    GO
    Isoform 3 (identifier: Q9BXT8-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         414-449: SSAELVFVSHVIDPCHFYIRKYSQIKDAKVLEKKVN → TCGTDDLGETPRYPKKPLQKNSSVPFGSKADTVTTV
         450-1623: Missing.

    Show »
    Length:449
    Mass (Da):50,477
    Checksum:i8F9E06F59E22DD6E
    GO
    Isoform 4 (identifier: Q9BXT8-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1326-1368: ELPKNPWEKLSIHLYFDGMSLSYFMAYYKYCTSEHTEEMLKEK → K

    Show »
    Length:1,581
    Mass (Da):179,508
    Checksum:iE290A64D77F3578B
    GO
    Isoform 5 (identifier: Q9BXT8-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1320-1325: Missing.

    Show »
    Length:1,617
    Mass (Da):183,935
    Checksum:i8D65E390C2828F2A
    GO

    Sequence cautioni

    The sequence AAH64847.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAA91972.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti361 – 3611P → S in AAK31981. (PubMed:11279525)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti346 – 3461K → N.
    Corresponds to variant rs1451568 [ dbSNP | Ensembl ].
    VAR_024613
    Natural varianti467 – 4671G → S.
    Corresponds to variant rs9581180 [ dbSNP | Ensembl ].
    VAR_028132
    Natural varianti501 – 5011S → G.
    Corresponds to variant rs9507413 [ dbSNP | Ensembl ].
    VAR_028133
    Natural varianti573 – 5731A → P.
    Corresponds to variant rs10161760 [ dbSNP | Ensembl ].
    VAR_052098
    Natural varianti667 – 6671H → R.
    Corresponds to variant rs9511451 [ dbSNP | Ensembl ].
    VAR_052099
    Natural varianti1110 – 11101N → K.
    Corresponds to variant rs3783082 [ dbSNP | Ensembl ].
    VAR_052100
    Natural varianti1380 – 13801E → K.2 Publications
    Corresponds to variant rs9507425 [ dbSNP | Ensembl ].
    VAR_052101

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei414 – 44936SSAEL…EKKVN → TCGTDDLGETPRYPKKPLQK NSSVPFGSKADTVTTV in isoform 3. 1 PublicationVSP_005753Add
    BLAST
    Alternative sequencei450 – 16231174Missing in isoform 3. 1 PublicationVSP_005754Add
    BLAST
    Alternative sequencei651 – 6533FKS → DLI in isoform 2. 1 PublicationVSP_033073
    Alternative sequencei654 – 1623970Missing in isoform 2. 1 PublicationVSP_033074Add
    BLAST
    Alternative sequencei1320 – 13256Missing in isoform 5. 1 PublicationVSP_033075
    Alternative sequencei1326 – 136843ELPKN…MLKEK → K in isoform 4. 1 PublicationVSP_033076Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF285602 mRNA. Translation: AAK31981.1.
    AF285603 mRNA. Translation: AAK31982.1.
    AL391560, AL354798 Genomic DNA. Translation: CAI15248.2.
    AL354798, AL391560 Genomic DNA. Translation: CAM23326.1.
    BC064847 mRNA. Translation: AAH64847.1. Different initiation.
    AK001907 mRNA. Translation: BAA91972.1. Different initiation.
    CCDSiCCDS9308.2. [Q9BXT8-3]
    RefSeqiNP_112567.2. NM_031277.2. [Q9BXT8-3]
    UniGeneiHs.97464.

    Genome annotation databases

    EnsembliENST00000255324; ENSP00000255324; ENSG00000132972. [Q9BXT8-3]
    ENST00000255325; ENSP00000255325; ENSG00000132972. [Q9BXT8-1]
    GeneIDi56163.
    KEGGihsa:56163.
    UCSCiuc001upq.1. human. [Q9BXT8-2]
    uc001upr.3. human. [Q9BXT8-3]
    uc010aac.3. human. [Q9BXT8-5]

    Polymorphism databases

    DMDMi187608889.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF285602 mRNA. Translation: AAK31981.1 .
    AF285603 mRNA. Translation: AAK31982.1 .
    AL391560 , AL354798 Genomic DNA. Translation: CAI15248.2 .
    AL354798 , AL391560 Genomic DNA. Translation: CAM23326.1 .
    BC064847 mRNA. Translation: AAH64847.1 . Different initiation.
    AK001907 mRNA. Translation: BAA91972.1 . Different initiation.
    CCDSi CCDS9308.2. [Q9BXT8-3 ]
    RefSeqi NP_112567.2. NM_031277.2. [Q9BXT8-3 ]
    UniGenei Hs.97464.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2EQK NMR - A 949-1026 [» ]
    ProteinModelPortali Q9BXT8.
    SMRi Q9BXT8. Positions 685-862, 949-1026.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 121096. 1 interaction.
    IntActi Q9BXT8. 3 interactions.
    MINTi MINT-7944917.
    STRINGi 9606.ENSP00000255324.

    PTM databases

    PhosphoSitei Q9BXT8.

    Polymorphism databases

    DMDMi 187608889.

    Proteomic databases

    MaxQBi Q9BXT8.
    PaxDbi Q9BXT8.
    PRIDEi Q9BXT8.

    Protocols and materials databases

    DNASUi 56163.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000255324 ; ENSP00000255324 ; ENSG00000132972 . [Q9BXT8-3 ]
    ENST00000255325 ; ENSP00000255325 ; ENSG00000132972 . [Q9BXT8-1 ]
    GeneIDi 56163.
    KEGGi hsa:56163.
    UCSCi uc001upq.1. human. [Q9BXT8-2 ]
    uc001upr.3. human. [Q9BXT8-3 ]
    uc010aac.3. human. [Q9BXT8-5 ]

    Organism-specific databases

    CTDi 56163.
    GeneCardsi GC13P025338.
    HGNCi HGNC:10060. RNF17.
    HPAi HPA039699.
    HPA040111.
    MIMi 605793. gene.
    neXtProti NX_Q9BXT8.
    PharmGKBi PA34424.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG267246.
    HOGENOMi HOG000074158.
    HOVERGENi HBG108414.
    OMAi FEDGVWY.
    OrthoDBi EOG7FFMQV.
    PhylomeDBi Q9BXT8.

    Miscellaneous databases

    EvolutionaryTracei Q9BXT8.
    GenomeRNAii 56163.
    NextBioi 61792.
    PROi Q9BXT8.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BXT8.
    Bgeei Q9BXT8.
    CleanExi HS_RNF17.
    Genevestigatori Q9BXT8.

    Family and domain databases

    Gene3Di 2.40.50.90. 1 hit.
    InterProi IPR016071. Staphylococal_nuclease_OB-fold.
    IPR002999. Tudor.
    IPR001841. Znf_RING.
    IPR017907. Znf_RING_CS.
    [Graphical view ]
    Pfami PF00567. TUDOR. 5 hits.
    [Graphical view ]
    SMARTi SM00184. RING. 1 hit.
    SM00333. TUDOR. 4 hits.
    [Graphical view ]
    SUPFAMi SSF50199. SSF50199. 1 hit.
    PROSITEi PS50304. TUDOR. 4 hits.
    PS00518. ZF_RING_1. 1 hit.
    PS50089. ZF_RING_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "An abundance of X-linked genes expressed in spermatogonia."
      Wang P.J., McCarrey J.R., Yang F., Page D.C.
      Nat. Genet. 27:422-426(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
      Tissue: Testis.
    2. "The DNA sequence and analysis of human chromosome 13."
      Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
      Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 765-1623 (ISOFORM 5), VARIANT LYS-1380.
      Tissue: Testis.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 914-1623 (ISOFORM 4), VARIANT LYS-1380.
      Tissue: Placenta.
    5. "Solution structure of the tudor domain of tudor domain-containing protein 4."
      RIKEN structural genomics initiative (RSGI)
      Submitted (OCT-2007) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 949-1026.

    Entry informationi

    Entry nameiRNF17_HUMAN
    AccessioniPrimary (citable) accession number: Q9BXT8
    Secondary accession number(s): Q5T2J9
    , Q6P1W3, Q9BXT7, Q9NUY9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 24, 2001
    Last sequence update: April 29, 2008
    Last modified: October 1, 2014
    This is version 114 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 13
      Human chromosome 13: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3