Q9BXT8 (RNF17_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 102.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: RING finger protein 17 Alternative name(s): Tudor domain-containing protein 4 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1623 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Seems to be involved in regulation of transcriptional activity of MYC. In vitro, inhibits DNA-binding activity of Mad-MAX heterodimers. Can recruit Mad transcriptional repressors (MXD1, MXD3, MXD4 and MXI1) to the cytoplasm. May be involved in spermiogenesis By similarity. |
| Subunit structure | Interacts with MXD1, MXD3, MXD4, MXI1 and PIWIL1. Self-associates By similarity. |
| Subcellular location | Cytoplasm By similarity. Nucleus By similarity. Note: Predominantly found in the cytoplasm. Component of a nuage in male germ cells (an electron-dense spherical cytoplasmic body present in late pachytene and diplotene spermatocytes and in elonging spermatids) By similarity. |
| Tissue specificity | Testis specific. |
| Sequence similarities | Contains 1 RING-type zinc finger. Contains 4 Tudor domains. |
| Sequence caution | The sequence AAH64847.1 differs from that shown. Reason: Erroneous initiation. The sequence BAA91972.1 differs from that shown. Reason: Erroneous initiation. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Differentiation Spermatogenesis |
| Cellular component | Cytoplasm Nucleus |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Repeat Zinc-finger |
| Ligand | Metal-binding Zinc |
| Molecular function | Developmental protein |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | multicellular organismal development Inferred from electronic annotation. Source: UniProtKB-KW spermatid developmentInferred from electronic annotation. Source: Compara |
| Cellular_component | cytoplasm Inferred from electronic annotation. Source: UniProtKB-SubCell nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | nucleic acid binding Inferred from electronic annotation. Source: InterPro zinc ion bindingInferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 5 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BXT8-3) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: Q9BXT8-1) The sequence of this isoform differs from the canonical sequence as follows: 651-653: FKS → DLI 654-1623: Missing. | ||||||
| Isoform 3 (identifier: Q9BXT8-2) The sequence of this isoform differs from the canonical sequence as follows: 414-449: SSAELVFVSHVIDPCHFYIRKYSQIKDAKVLEKKVN → TCGTDDLGETPRYPKKPLQKNSSVPFGSKADTVTTV 450-1623: Missing. | ||||||
| Isoform 4 (identifier: Q9BXT8-4) The sequence of this isoform differs from the canonical sequence as follows: 1326-1368: ELPKNPWEKLSIHLYFDGMSLSYFMAYYKYCTSEHTEEMLKEK → K | ||||||
| Isoform 5 (identifier: Q9BXT8-5) The sequence of this isoform differs from the canonical sequence as follows: 1320-1325: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1623 | 1623 | RING finger protein 17 | PRO_0000183165 | |||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||
| Domain | 726 – 784 | 59 | Tudor 1 | ||||||||||||||||||||||||
| Domain | 962 – 1021 | 60 | Tudor 2 | ||||||||||||||||||||||||
| Domain | 1228 – 1285 | 58 | Tudor 3 | ||||||||||||||||||||||||
| Domain | 1479 – 1539 | 61 | Tudor 4 | ||||||||||||||||||||||||
| Zinc finger | 32 – 75 | 44 | RING-type | ||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||
| Alternative sequence | 414 – 449 | 36 | SSAEL…EKKVN → TCGTDDLGETPRYPKKPLQK NSSVPFGSKADTVTTV in isoform 3. | VSP_005753 | |||||||||||||||||||||||
| Alternative sequence | 450 – 1623 | 1174 | Missing in isoform 3. | VSP_005754 | |||||||||||||||||||||||
| Alternative sequence | 651 – 653 | 3 | FKS → DLI in isoform 2. | VSP_033073 | |||||||||||||||||||||||
| Alternative sequence | 654 – 1623 | 970 | Missing in isoform 2. | VSP_033074 | |||||||||||||||||||||||
| Alternative sequence | 1320 – 1325 | 6 | Missing in isoform 5. | VSP_033075 | |||||||||||||||||||||||
| Alternative sequence | 1326 – 1368 | 43 | ELPKN…MLKEK → K in isoform 4. | VSP_033076 | |||||||||||||||||||||||
| Natural variant | 346 | 1 | K → N. Corresponds to variant rs1451568 [ dbSNP | Ensembl ]. | VAR_024613 | |||||||||||||||||||||||
| Natural variant | 467 | 1 | G → S. Corresponds to variant rs9581180 [ dbSNP | Ensembl ]. | VAR_028132 | |||||||||||||||||||||||
| Natural variant | 501 | 1 | S → G. Corresponds to variant rs9507413 [ dbSNP | Ensembl ]. | VAR_028133 | |||||||||||||||||||||||
| Natural variant | 573 | 1 | A → P. Corresponds to variant rs10161760 [ dbSNP | Ensembl ]. | VAR_052098 | |||||||||||||||||||||||
| Natural variant | 667 | 1 | H → R. Corresponds to variant rs9511451 [ dbSNP | Ensembl ]. | VAR_052099 | |||||||||||||||||||||||
| Natural variant | 1110 | 1 | N → K. Corresponds to variant rs3783082 [ dbSNP | Ensembl ]. | VAR_052100 | |||||||||||||||||||||||
| Natural variant | 1380 | 1 | E → K. Ref.3 Ref.4 Corresponds to variant rs9507425 [ dbSNP | Ensembl ]. | VAR_052101 | |||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||
| Sequence conflict | 361 | 1 | P → S in AAK31981. Ref.1 | ||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||
| Helix | 949 – 955 | 7 | |||||||||||||||||||||||||
| Beta strand | 968 – 972 | 5 | |||||||||||||||||||||||||
| Beta strand | 974 – 976 | 3 | |||||||||||||||||||||||||
| Beta strand | 979 – 987 | 9 | |||||||||||||||||||||||||
| Beta strand | 989 – 996 | 8 | |||||||||||||||||||||||||
| Turn | 998 – 1000 | 3 | |||||||||||||||||||||||||
| Beta strand | 1003 – 1007 | 5 | |||||||||||||||||||||||||
| Turn | 1008 – 1010 | 3 | |||||||||||||||||||||||||
| Beta strand | 1011 – 1013 | 3 | |||||||||||||||||||||||||
| Helix | 1016 – 1019 | 4 | |||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "An abundance of X-linked genes expressed in spermatogonia." Wang P.J., McCarrey J.R., Yang F., Page D.C. Nat. Genet. 27:422-426(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3). Tissue: Testis. |
| [2] | "The DNA sequence and analysis of human chromosome 13." Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T. Ross M.T.Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [3] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 765-1623 (ISOFORM 5), VARIANT LYS-1380. Tissue: Testis. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 914-1623 (ISOFORM 4), VARIANT LYS-1380. Tissue: Placenta. |
| [5] | "Solution structure of the tudor domain of tudor domain-containing protein 4." RIKEN structural genomics initiative (RSGI) Submitted (OCT-2007) to the PDB data bank Cited for: STRUCTURE BY NMR OF 949-1026. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF285602 mRNA. Translation: AAK31981.1. AF285603 mRNA. Translation: AAK31982.1. AL391560, AL354798 Genomic DNA. Translation: CAI15248.2. AL354798, AL391560 Genomic DNA. Translation: CAM23326.1. BC064847 mRNA. Translation: AAH64847.1. Different initiation. AK001907 mRNA. Translation: BAA91972.1. Different initiation. | ||||||||||||
| IPI | IPI00005061. IPI00797087. IPI00827865. IPI00890741. IPI00890818. | ||||||||||||
| RefSeq | NP_112567.2. NM_031277.2. | ||||||||||||
| UniGene | Hs.97464. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9BXT8. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9BXT8. 1 interaction. | ||||||||||||
| MINT | MINT-7944917. | ||||||||||||
| STRING | 9606.ENSP00000255324. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9BXT8. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 187608889. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9BXT8. | ||||||||||||
| PRIDE | Q9BXT8. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 56163. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000255324; ENSP00000255324; ENSG00000132972. ENST00000255326; ENSP00000255326; ENSG00000132972. ENST00000381921; ENSP00000371346; ENSG00000132972. | ||||||||||||
| GeneID | 56163. | ||||||||||||
| KEGG | hsa:56163. | ||||||||||||
| UCSC | uc001upq.1. human. uc001upr.3. human. uc010aac.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 56163. | ||||||||||||
| GeneCards | GC13P025338. | ||||||||||||
| HGNC | HGNC:10060. RNF17. | ||||||||||||
| HPA | HPA039699. HPA040111. | ||||||||||||
| MIM | 605793. gene. | ||||||||||||
| neXtProt | NX_Q9BXT8. | ||||||||||||
| PharmGKB | PA34424. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG267246. | ||||||||||||
| HOGENOM | HOG000074158. | ||||||||||||
| HOVERGEN | HBG108414. | ||||||||||||
| OMA | GVWYRAK. | ||||||||||||
| OrthoDB | EOG4NZTSK. | ||||||||||||
| PhylomeDB | Q9BXT8. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9BXT8. | ||||||||||||
| Bgee | Q9BXT8. | ||||||||||||
| CleanEx | HS_RNF17. | ||||||||||||
| Genevestigator | Q9BXT8. | ||||||||||||
| GermOnline | ENSG00000132972. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.40.50.90. 1 hit. | ||||||||||||
| InterPro | IPR006021. Staphylococcal_nuclease. IPR002999. Tudor. IPR001841. Znf_RING. IPR017907. Znf_RING_CS. [Graphical view] | ||||||||||||
| Pfam | PF00567. TUDOR. 5 hits. [Graphical view] | ||||||||||||
| SMART | SM00184. RING. 1 hit. SM00333. TUDOR. 4 hits. [Graphical view] | ||||||||||||
| PROSITE | PS50304. TUDOR. 4 hits. PS00518. ZF_RING_1. 1 hit. PS50089. ZF_RING_2. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q9BXT8. | ||||||||||||
| GenomeRNAi | 56163. | ||||||||||||
| NextBio | 61792. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | RNF17_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BXT8 Secondary accession number(s): Q5T2J9 Q9NUY9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 13 Human chromosome 13: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
