Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RING finger protein 17

Gene

RNF17

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Seems to be involved in regulation of transcriptional activity of MYC. In vitro, inhibits DNA-binding activity of Mad-MAX heterodimers. Can recruit Mad transcriptional repressors (MXD1, MXD3, MXD4 and MXI1) to the cytoplasm. May be involved in spermiogenesis (By similarity).By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri32 – 75RING-typePROSITE-ProRule annotationAdd BLAST44

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000132972-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
RING finger protein 17
Alternative name(s):
Tudor domain-containing protein 4
Gene namesi
Name:RNF17
Synonyms:TDRD4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 13

Organism-specific databases

HGNCiHGNC:10060. RNF17.

Subcellular locationi

  • Cytoplasm By similarity
  • Nucleus By similarity

  • Note: Predominantly found in the cytoplasm. Component of a nuage in male germ cells (an electron-dense spherical cytoplasmic body present in late pachytene and diplotene spermatocytes and in elonging spermatids) (By similarity).By similarity

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000132972.
PharmGKBiPA34424.

Polymorphism and mutation databases

BioMutaiRNF17.
DMDMi187608889.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00001831651 – 1623RING finger protein 17Add BLAST1623

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei234N6-acetyllysineBy similarity1

Keywords - PTMi

Acetylation

Proteomic databases

PaxDbiQ9BXT8.
PeptideAtlasiQ9BXT8.
PRIDEiQ9BXT8.

PTM databases

iPTMnetiQ9BXT8.
PhosphoSitePlusiQ9BXT8.

Expressioni

Tissue specificityi

Testis specific.

Gene expression databases

BgeeiENSG00000132972.
CleanExiHS_RNF17.
ExpressionAtlasiQ9BXT8. baseline and differential.
GenevisibleiQ9BXT8. HS.

Organism-specific databases

HPAiHPA039699.
HPA040111.

Interactioni

Subunit structurei

Interacts with MXD1, MXD3, MXD4, MXI1 and PIWIL1. Self-associates (By similarity).By similarity

Protein-protein interaction databases

BioGridi121096. 2 interactors.
IntActiQ9BXT8. 3 interactors.
MINTiMINT-7944917.
STRINGi9606.ENSP00000255324.

Structurei

Secondary structure

11623
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Helixi949 – 955Combined sources7
Beta strandi968 – 972Combined sources5
Beta strandi974 – 976Combined sources3
Beta strandi979 – 987Combined sources9
Beta strandi989 – 996Combined sources8
Turni998 – 1000Combined sources3
Beta strandi1003 – 1007Combined sources5
Turni1008 – 1010Combined sources3
Beta strandi1011 – 1013Combined sources3
Helixi1016 – 1019Combined sources4

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EQKNMR-A949-1026[»]
ProteinModelPortaliQ9BXT8.
SMRiQ9BXT8.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9BXT8.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini726 – 784Tudor 1PROSITE-ProRule annotationAdd BLAST59
Domaini962 – 1021Tudor 2PROSITE-ProRule annotationAdd BLAST60
Domaini1228 – 1285Tudor 3PROSITE-ProRule annotationAdd BLAST58
Domaini1479 – 1539Tudor 4PROSITE-ProRule annotationAdd BLAST61

Sequence similaritiesi

Contains 1 RING-type zinc finger.PROSITE-ProRule annotation
Contains 4 Tudor domains.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri32 – 75RING-typePROSITE-ProRule annotationAdd BLAST44

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiENOG410IPQY. Eukaryota.
ENOG410ZWK2. LUCA.
GeneTreeiENSGT00730000110295.
HOGENOMiHOG000074158.
HOVERGENiHBG108414.
InParanoidiQ9BXT8.
KOiK18405.
OMAiFEDGVWY.
OrthoDBiEOG091G00SE.
PhylomeDBiQ9BXT8.

Family and domain databases

Gene3Di2.40.50.90. 1 hit.
InterProiIPR016071. Staphylococal_nuclease_OB-fold.
IPR002999. Tudor.
IPR001841. Znf_RING.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF00567. TUDOR. 5 hits.
[Graphical view]
SMARTiSM00333. TUDOR. 4 hits.
[Graphical view]
SUPFAMiSSF50199. SSF50199. 1 hit.
PROSITEiPS50304. TUDOR. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BXT8-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAEASKTGP SRSSYQRMGR KSQPWGAAEI QCTRCGRRVS RSSGHHCELQ
60 70 80 90 100
CGHAFCELCL LMTEECTTII CPDCEVATAV NTRQRYYPMA GYIKEDSIME
110 120 130 140 150
KLQPKTIKNC SQDFKKTADQ LTTGLERSAS TDKTLLNSSA VMLDTNTAEE
160 170 180 190 200
IDEALNTAHH SFEQLSIAGK ALEHMQKQTI EERERVIEVV EKQFDQLLAF
210 220 230 240 250
FDSRKKNLCE EFARTTDDYL SNLIKAKSYI EEKKNNLNAA MNIARALQLS
260 270 280 290 300
PSLRTYCDLN QIIRTLQLTS DSELAQVSSP QLRNPPRLSV NCSEIICMFN
310 320 330 340 350
NMGKIEFRDS TKCYPQENEI RQNVQKKYNN KKELSCYDTY PPLEKKKVDM
360 370 380 390 400
SVLTSEAPPP PLQPETNDVH LEAKNFQPQK DVATASPKTI AVLPQMGSSP
410 420 430 440 450
DVIIEEIIED NVESSAELVF VSHVIDPCHF YIRKYSQIKD AKVLEKKVNE
460 470 480 490 500
FCNRSSHLDP SDILELGARI FVSSIKNGMW CRGTITELIP IEGRNTRKPC
510 520 530 540 550
SPTRLFVHEV ALIQIFMVDF GNSEVLIVTG VVDTHVRPEH SAKQHIALND
560 570 580 590 600
LCLVLRKSEP YTEGLLKDIQ PLAQPCSLKD IVPQNSNEGW EEEAKVEFLK
610 620 630 640 650
MVNNKAVSMK VFREEDGVLI VDLQKPPPNK ISSDMPVSLR DALVFMELAK
660 670 680 690 700
FKSQSLRSHF EKNTTLHYHP PILPKEMTDV SVTVCHINSP GDFYLQLIEG
710 720 730 740 750
LDILFLLKTI EEFYKSEDGE NLEILCPVQD QACVAKFEDG IWYRAKVIGL
760 770 780 790 800
PGHQEVEVKY VDFGNTAKIT IKDVRKIKDE FLNAPEKAIK CKLAYIEPYK
810 820 830 840 850
RTMQWSKEAK EKFEEKAQDK FMTCSVIKIL EDNVLLVELF DSLGAPEMTT
860 870 880 890 900
TSINDQLVKE GLASYEIGYI LKDNSQKHIE VWDPSPEEII SNEVHNLNPV
910 920 930 940 950
SAKSLPNENF QSLYNKELPV HICNVISPEK IYVQWLLTEN LLNSLEEKMI
960 970 980 990 1000
AAYENSKWEP VKWENDMHCA VKIQDKNQWR RGQIIRMVTD TLVEVLLYDV
1010 1020 1030 1040 1050
GVELVVNVDC LRKLEENLKT MGRLSLECSL VDIRPAGGSD KWTATACDCL
1060 1070 1080 1090 1100
SLYLTGAVAT IILQVDSEEN NTTWPLPVKI FCRDEKGERV DVSKYLIKKG
1110 1120 1130 1140 1150
LALRERRINN LDNSHSLSEK SLEVPLEQED SVVTNCIKTN FDPDKKTADI
1160 1170 1180 1190 1200
ISEQKVSEFQ EKILEPRTTR GYKPPAIPNM NVFEATVSCV GDDGTIFVVP
1210 1220 1230 1240 1250
KLSEFELIKM TNEIQSNLKC LGLLEPYFWK KGEACAVRGS DTLWYRGKVM
1260 1270 1280 1290 1300
EVVGGAVRVQ YLDHGFTEKI PQCHLYPILL YPDIPQFCIP CQLHNTTPVG
1310 1320 1330 1340 1350
NVWQPDAIEV LQQLLSKRQV DIHIMELPKN PWEKLSIHLY FDGMSLSYFM
1360 1370 1380 1390 1400
AYYKYCTSEH TEEMLKEKPR SDHDKKYEEE QWEIRFEELL SAETDTPLLP
1410 1420 1430 1440 1450
PYLSSSLPSP GELYAVQVKH VVSPNEVYIC LDSIETSNQS NQHSDTDDSG
1460 1470 1480 1490 1500
VSGESESESL DEALQRVNKK VEALPPLTDF RTEMPCLAEY DDGLWYRAKI
1510 1520 1530 1540 1550
VAIKEFNPLS ILVQFVDYGS TAKLTLNRLC QIPSHLMRYP ARAIKVLLAG
1560 1570 1580 1590 1600
FKPPLRDLGE TRIPYCPKWS MEALWAMIDC LQGKQLYAVS MAPAPEQIVT
1610 1620
LYDDEQHPVH MPLVEMGLAD KDE
Note: No experimental confirmation available.
Length:1,623
Mass (Da):184,643
Last modified:April 29, 2008 - v3
Checksum:i3E710E6DD706CDF9
GO
Isoform 2 (identifier: Q9BXT8-1) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     651-653: FKS → DLI
     654-1623: Missing.

Show »
Length:653
Mass (Da):73,746
Checksum:i444C911E916D20CD
GO
Isoform 3 (identifier: Q9BXT8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     414-449: SSAELVFVSHVIDPCHFYIRKYSQIKDAKVLEKKVN → TCGTDDLGETPRYPKKPLQKNSSVPFGSKADTVTTV
     450-1623: Missing.

Show »
Length:449
Mass (Da):50,477
Checksum:i8F9E06F59E22DD6E
GO
Isoform 4 (identifier: Q9BXT8-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1326-1368: ELPKNPWEKLSIHLYFDGMSLSYFMAYYKYCTSEHTEEMLKEK → K

Show »
Length:1,581
Mass (Da):179,508
Checksum:iE290A64D77F3578B
GO
Isoform 5 (identifier: Q9BXT8-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1320-1325: Missing.

Show »
Length:1,617
Mass (Da):183,935
Checksum:i8D65E390C2828F2A
GO

Sequence cautioni

The sequence AAH64847 differs from that shown. Reason: Erroneous initiation.Curated
The sequence BAA91972 differs from that shown. Reason: Erroneous initiation.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti361P → S in AAK31981 (PubMed:11279525).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_024613346K → N.Corresponds to variant rs1451568dbSNPEnsembl.1
Natural variantiVAR_028132467G → S.Corresponds to variant rs9581180dbSNPEnsembl.1
Natural variantiVAR_028133501S → G.Corresponds to variant rs9507413dbSNPEnsembl.1
Natural variantiVAR_052098573A → P.Corresponds to variant rs10161760dbSNPEnsembl.1
Natural variantiVAR_052099667H → R.Corresponds to variant rs9511451dbSNPEnsembl.1
Natural variantiVAR_0521001110N → K.Corresponds to variant rs3783082dbSNPEnsembl.1
Natural variantiVAR_0521011380E → K.2 PublicationsCorresponds to variant rs9507425dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_005753414 – 449SSAEL…EKKVN → TCGTDDLGETPRYPKKPLQK NSSVPFGSKADTVTTV in isoform 3. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_005754450 – 1623Missing in isoform 3. 1 PublicationAdd BLAST1174
Alternative sequenceiVSP_033073651 – 653FKS → DLI in isoform 2. 1 Publication3
Alternative sequenceiVSP_033074654 – 1623Missing in isoform 2. 1 PublicationAdd BLAST970
Alternative sequenceiVSP_0330751320 – 1325Missing in isoform 5. 1 Publication6
Alternative sequenceiVSP_0330761326 – 1368ELPKN…MLKEK → K in isoform 4. 1 PublicationAdd BLAST43

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF285602 mRNA. Translation: AAK31981.1.
AF285603 mRNA. Translation: AAK31982.1.
AL391560, AL354798 Genomic DNA. Translation: CAI15248.2.
AL354798, AL391560 Genomic DNA. Translation: CAM23326.1.
BC064847 mRNA. Translation: AAH64847.1. Different initiation.
AK001907 mRNA. Translation: BAA91972.1. Different initiation.
CCDSiCCDS9308.2. [Q9BXT8-3]
RefSeqiNP_112567.2. NM_031277.2. [Q9BXT8-3]
UniGeneiHs.572245.
Hs.97464.

Genome annotation databases

EnsembliENST00000255324; ENSP00000255324; ENSG00000132972. [Q9BXT8-3]
ENST00000255325; ENSP00000255325; ENSG00000132972. [Q9BXT8-1]
GeneIDi56163.
KEGGihsa:56163.
UCSCiuc001upr.4. human. [Q9BXT8-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF285602 mRNA. Translation: AAK31981.1.
AF285603 mRNA. Translation: AAK31982.1.
AL391560, AL354798 Genomic DNA. Translation: CAI15248.2.
AL354798, AL391560 Genomic DNA. Translation: CAM23326.1.
BC064847 mRNA. Translation: AAH64847.1. Different initiation.
AK001907 mRNA. Translation: BAA91972.1. Different initiation.
CCDSiCCDS9308.2. [Q9BXT8-3]
RefSeqiNP_112567.2. NM_031277.2. [Q9BXT8-3]
UniGeneiHs.572245.
Hs.97464.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2EQKNMR-A949-1026[»]
ProteinModelPortaliQ9BXT8.
SMRiQ9BXT8.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi121096. 2 interactors.
IntActiQ9BXT8. 3 interactors.
MINTiMINT-7944917.
STRINGi9606.ENSP00000255324.

PTM databases

iPTMnetiQ9BXT8.
PhosphoSitePlusiQ9BXT8.

Polymorphism and mutation databases

BioMutaiRNF17.
DMDMi187608889.

Proteomic databases

PaxDbiQ9BXT8.
PeptideAtlasiQ9BXT8.
PRIDEiQ9BXT8.

Protocols and materials databases

DNASUi56163.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000255324; ENSP00000255324; ENSG00000132972. [Q9BXT8-3]
ENST00000255325; ENSP00000255325; ENSG00000132972. [Q9BXT8-1]
GeneIDi56163.
KEGGihsa:56163.
UCSCiuc001upr.4. human. [Q9BXT8-3]

Organism-specific databases

CTDi56163.
GeneCardsiRNF17.
HGNCiHGNC:10060. RNF17.
HPAiHPA039699.
HPA040111.
MIMi605793. gene.
neXtProtiNX_Q9BXT8.
OpenTargetsiENSG00000132972.
PharmGKBiPA34424.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IPQY. Eukaryota.
ENOG410ZWK2. LUCA.
GeneTreeiENSGT00730000110295.
HOGENOMiHOG000074158.
HOVERGENiHBG108414.
InParanoidiQ9BXT8.
KOiK18405.
OMAiFEDGVWY.
OrthoDBiEOG091G00SE.
PhylomeDBiQ9BXT8.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000132972-MONOMER.

Miscellaneous databases

EvolutionaryTraceiQ9BXT8.
GenomeRNAii56163.
PROiQ9BXT8.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000132972.
CleanExiHS_RNF17.
ExpressionAtlasiQ9BXT8. baseline and differential.
GenevisibleiQ9BXT8. HS.

Family and domain databases

Gene3Di2.40.50.90. 1 hit.
InterProiIPR016071. Staphylococal_nuclease_OB-fold.
IPR002999. Tudor.
IPR001841. Znf_RING.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF00567. TUDOR. 5 hits.
[Graphical view]
SMARTiSM00333. TUDOR. 4 hits.
[Graphical view]
SUPFAMiSSF50199. SSF50199. 1 hit.
PROSITEiPS50304. TUDOR. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiRNF17_HUMAN
AccessioniPrimary (citable) accession number: Q9BXT8
Secondary accession number(s): Q5T2J9
, Q6P1W3, Q9BXT7, Q9NUY9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 24, 2001
Last sequence update: April 29, 2008
Last modified: November 2, 2016
This is version 133 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.