Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BXT8

- RNF17_HUMAN

UniProt

Q9BXT8 - RNF17_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

RING finger protein 17

Gene

RNF17

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Seems to be involved in regulation of transcriptional activity of MYC. In vitro, inhibits DNA-binding activity of Mad-MAX heterodimers. Can recruit Mad transcriptional repressors (MXD1, MXD3, MXD4 and MXI1) to the cytoplasm. May be involved in spermiogenesis (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri32 – 7544RING-typePROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

  1. hydrolase activity, acting on ester bonds Source: InterPro
  2. nucleic acid binding Source: InterPro
  3. zinc ion binding Source: InterPro

GO - Biological processi

  1. multicellular organismal development Source: UniProtKB-KW
  2. spermatid development Source: Ensembl
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Biological processi

Differentiation, Spermatogenesis

Keywords - Ligandi

Metal-binding, Zinc

Names & Taxonomyi

Protein namesi
Recommended name:
RING finger protein 17
Alternative name(s):
Tudor domain-containing protein 4
Gene namesi
Name:RNF17
Synonyms:TDRD4
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 13

Organism-specific databases

HGNCiHGNC:10060. RNF17.

Subcellular locationi

Cytoplasm By similarity. Nucleus By similarity
Note: Predominantly found in the cytoplasm. Component of a nuage in male germ cells (an electron-dense spherical cytoplasmic body present in late pachytene and diplotene spermatocytes and in elonging spermatids) (By similarity).By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-KW
  2. nucleus Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA34424.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 16231623RING finger protein 17PRO_0000183165Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei234 – 2341N6-acetyllysineBy similarity

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ9BXT8.
PaxDbiQ9BXT8.
PRIDEiQ9BXT8.

PTM databases

PhosphoSiteiQ9BXT8.

Expressioni

Tissue specificityi

Testis specific.

Gene expression databases

BgeeiQ9BXT8.
CleanExiHS_RNF17.
ExpressionAtlasiQ9BXT8. baseline and differential.
GenevestigatoriQ9BXT8.

Organism-specific databases

HPAiHPA039699.
HPA040111.

Interactioni

Subunit structurei

Interacts with MXD1, MXD3, MXD4, MXI1 and PIWIL1. Self-associates (By similarity).By similarity

Protein-protein interaction databases

BioGridi121096. 1 interaction.
IntActiQ9BXT8. 3 interactions.
MINTiMINT-7944917.
STRINGi9606.ENSP00000255324.

Structurei

Secondary structure

1
1623
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi949 – 9557
Beta strandi968 – 9725
Beta strandi974 – 9763
Beta strandi979 – 9879
Beta strandi989 – 9968
Turni998 – 10003
Beta strandi1003 – 10075
Turni1008 – 10103
Beta strandi1011 – 10133
Helixi1016 – 10194

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2EQKNMR-A949-1026[»]
ProteinModelPortaliQ9BXT8.
SMRiQ9BXT8. Positions 685-862, 949-1026.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9BXT8.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini726 – 78459Tudor 1PROSITE-ProRule annotationAdd
BLAST
Domaini962 – 102160Tudor 2PROSITE-ProRule annotationAdd
BLAST
Domaini1228 – 128558Tudor 3PROSITE-ProRule annotationAdd
BLAST
Domaini1479 – 153961Tudor 4PROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 RING-type zinc finger.PROSITE-ProRule annotation
Contains 4 Tudor domains.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri32 – 7544RING-typePROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiNOG267246.
GeneTreeiENSGT00730000110295.
HOGENOMiHOG000074158.
HOVERGENiHBG108414.
InParanoidiQ9BXT8.
KOiK18405.
OMAiFEDGVWY.
OrthoDBiEOG7FFMQV.
PhylomeDBiQ9BXT8.

Family and domain databases

Gene3Di2.40.50.90. 1 hit.
InterProiIPR016071. Staphylococal_nuclease_OB-fold.
IPR002999. Tudor.
IPR001841. Znf_RING.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF00567. TUDOR. 5 hits.
[Graphical view]
SMARTiSM00184. RING. 1 hit.
SM00333. TUDOR. 4 hits.
[Graphical view]
SUPFAMiSSF50199. SSF50199. 1 hit.
PROSITEiPS50304. TUDOR. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BXT8-3) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAAEASKTGP SRSSYQRMGR KSQPWGAAEI QCTRCGRRVS RSSGHHCELQ
60 70 80 90 100
CGHAFCELCL LMTEECTTII CPDCEVATAV NTRQRYYPMA GYIKEDSIME
110 120 130 140 150
KLQPKTIKNC SQDFKKTADQ LTTGLERSAS TDKTLLNSSA VMLDTNTAEE
160 170 180 190 200
IDEALNTAHH SFEQLSIAGK ALEHMQKQTI EERERVIEVV EKQFDQLLAF
210 220 230 240 250
FDSRKKNLCE EFARTTDDYL SNLIKAKSYI EEKKNNLNAA MNIARALQLS
260 270 280 290 300
PSLRTYCDLN QIIRTLQLTS DSELAQVSSP QLRNPPRLSV NCSEIICMFN
310 320 330 340 350
NMGKIEFRDS TKCYPQENEI RQNVQKKYNN KKELSCYDTY PPLEKKKVDM
360 370 380 390 400
SVLTSEAPPP PLQPETNDVH LEAKNFQPQK DVATASPKTI AVLPQMGSSP
410 420 430 440 450
DVIIEEIIED NVESSAELVF VSHVIDPCHF YIRKYSQIKD AKVLEKKVNE
460 470 480 490 500
FCNRSSHLDP SDILELGARI FVSSIKNGMW CRGTITELIP IEGRNTRKPC
510 520 530 540 550
SPTRLFVHEV ALIQIFMVDF GNSEVLIVTG VVDTHVRPEH SAKQHIALND
560 570 580 590 600
LCLVLRKSEP YTEGLLKDIQ PLAQPCSLKD IVPQNSNEGW EEEAKVEFLK
610 620 630 640 650
MVNNKAVSMK VFREEDGVLI VDLQKPPPNK ISSDMPVSLR DALVFMELAK
660 670 680 690 700
FKSQSLRSHF EKNTTLHYHP PILPKEMTDV SVTVCHINSP GDFYLQLIEG
710 720 730 740 750
LDILFLLKTI EEFYKSEDGE NLEILCPVQD QACVAKFEDG IWYRAKVIGL
760 770 780 790 800
PGHQEVEVKY VDFGNTAKIT IKDVRKIKDE FLNAPEKAIK CKLAYIEPYK
810 820 830 840 850
RTMQWSKEAK EKFEEKAQDK FMTCSVIKIL EDNVLLVELF DSLGAPEMTT
860 870 880 890 900
TSINDQLVKE GLASYEIGYI LKDNSQKHIE VWDPSPEEII SNEVHNLNPV
910 920 930 940 950
SAKSLPNENF QSLYNKELPV HICNVISPEK IYVQWLLTEN LLNSLEEKMI
960 970 980 990 1000
AAYENSKWEP VKWENDMHCA VKIQDKNQWR RGQIIRMVTD TLVEVLLYDV
1010 1020 1030 1040 1050
GVELVVNVDC LRKLEENLKT MGRLSLECSL VDIRPAGGSD KWTATACDCL
1060 1070 1080 1090 1100
SLYLTGAVAT IILQVDSEEN NTTWPLPVKI FCRDEKGERV DVSKYLIKKG
1110 1120 1130 1140 1150
LALRERRINN LDNSHSLSEK SLEVPLEQED SVVTNCIKTN FDPDKKTADI
1160 1170 1180 1190 1200
ISEQKVSEFQ EKILEPRTTR GYKPPAIPNM NVFEATVSCV GDDGTIFVVP
1210 1220 1230 1240 1250
KLSEFELIKM TNEIQSNLKC LGLLEPYFWK KGEACAVRGS DTLWYRGKVM
1260 1270 1280 1290 1300
EVVGGAVRVQ YLDHGFTEKI PQCHLYPILL YPDIPQFCIP CQLHNTTPVG
1310 1320 1330 1340 1350
NVWQPDAIEV LQQLLSKRQV DIHIMELPKN PWEKLSIHLY FDGMSLSYFM
1360 1370 1380 1390 1400
AYYKYCTSEH TEEMLKEKPR SDHDKKYEEE QWEIRFEELL SAETDTPLLP
1410 1420 1430 1440 1450
PYLSSSLPSP GELYAVQVKH VVSPNEVYIC LDSIETSNQS NQHSDTDDSG
1460 1470 1480 1490 1500
VSGESESESL DEALQRVNKK VEALPPLTDF RTEMPCLAEY DDGLWYRAKI
1510 1520 1530 1540 1550
VAIKEFNPLS ILVQFVDYGS TAKLTLNRLC QIPSHLMRYP ARAIKVLLAG
1560 1570 1580 1590 1600
FKPPLRDLGE TRIPYCPKWS MEALWAMIDC LQGKQLYAVS MAPAPEQIVT
1610 1620
LYDDEQHPVH MPLVEMGLAD KDE

Note: No experimental confirmation available.

Length:1,623
Mass (Da):184,643
Last modified:April 29, 2008 - v3
Checksum:i3E710E6DD706CDF9
GO
Isoform 2 (identifier: Q9BXT8-1) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     651-653: FKS → DLI
     654-1623: Missing.

Show »
Length:653
Mass (Da):73,746
Checksum:i444C911E916D20CD
GO
Isoform 3 (identifier: Q9BXT8-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     414-449: SSAELVFVSHVIDPCHFYIRKYSQIKDAKVLEKKVN → TCGTDDLGETPRYPKKPLQKNSSVPFGSKADTVTTV
     450-1623: Missing.

Show »
Length:449
Mass (Da):50,477
Checksum:i8F9E06F59E22DD6E
GO
Isoform 4 (identifier: Q9BXT8-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1326-1368: ELPKNPWEKLSIHLYFDGMSLSYFMAYYKYCTSEHTEEMLKEK → K

Show »
Length:1,581
Mass (Da):179,508
Checksum:iE290A64D77F3578B
GO
Isoform 5 (identifier: Q9BXT8-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1320-1325: Missing.

Show »
Length:1,617
Mass (Da):183,935
Checksum:i8D65E390C2828F2A
GO

Sequence cautioni

The sequence AAH64847.1 differs from that shown. Reason: Erroneous initiation.
The sequence BAA91972.1 differs from that shown. Reason: Erroneous initiation.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti361 – 3611P → S in AAK31981. (PubMed:11279525)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti346 – 3461K → N.
Corresponds to variant rs1451568 [ dbSNP | Ensembl ].
VAR_024613
Natural varianti467 – 4671G → S.
Corresponds to variant rs9581180 [ dbSNP | Ensembl ].
VAR_028132
Natural varianti501 – 5011S → G.
Corresponds to variant rs9507413 [ dbSNP | Ensembl ].
VAR_028133
Natural varianti573 – 5731A → P.
Corresponds to variant rs10161760 [ dbSNP | Ensembl ].
VAR_052098
Natural varianti667 – 6671H → R.
Corresponds to variant rs9511451 [ dbSNP | Ensembl ].
VAR_052099
Natural varianti1110 – 11101N → K.
Corresponds to variant rs3783082 [ dbSNP | Ensembl ].
VAR_052100
Natural varianti1380 – 13801E → K.2 Publications
Corresponds to variant rs9507425 [ dbSNP | Ensembl ].
VAR_052101

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei414 – 44936SSAEL…EKKVN → TCGTDDLGETPRYPKKPLQK NSSVPFGSKADTVTTV in isoform 3. 1 PublicationVSP_005753Add
BLAST
Alternative sequencei450 – 16231174Missing in isoform 3. 1 PublicationVSP_005754Add
BLAST
Alternative sequencei651 – 6533FKS → DLI in isoform 2. 1 PublicationVSP_033073
Alternative sequencei654 – 1623970Missing in isoform 2. 1 PublicationVSP_033074Add
BLAST
Alternative sequencei1320 – 13256Missing in isoform 5. 1 PublicationVSP_033075
Alternative sequencei1326 – 136843ELPKN…MLKEK → K in isoform 4. 1 PublicationVSP_033076Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF285602 mRNA. Translation: AAK31981.1.
AF285603 mRNA. Translation: AAK31982.1.
AL391560, AL354798 Genomic DNA. Translation: CAI15248.2.
AL354798, AL391560 Genomic DNA. Translation: CAM23326.1.
BC064847 mRNA. Translation: AAH64847.1. Different initiation.
AK001907 mRNA. Translation: BAA91972.1. Different initiation.
CCDSiCCDS9308.2. [Q9BXT8-3]
RefSeqiNP_112567.2. NM_031277.2. [Q9BXT8-3]
UniGeneiHs.97464.

Genome annotation databases

EnsembliENST00000255324; ENSP00000255324; ENSG00000132972. [Q9BXT8-3]
ENST00000255325; ENSP00000255325; ENSG00000132972. [Q9BXT8-1]
GeneIDi56163.
KEGGihsa:56163.
UCSCiuc001upq.1. human. [Q9BXT8-2]
uc001upr.3. human. [Q9BXT8-3]
uc010aac.3. human. [Q9BXT8-5]

Polymorphism databases

DMDMi187608889.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF285602 mRNA. Translation: AAK31981.1 .
AF285603 mRNA. Translation: AAK31982.1 .
AL391560 , AL354798 Genomic DNA. Translation: CAI15248.2 .
AL354798 , AL391560 Genomic DNA. Translation: CAM23326.1 .
BC064847 mRNA. Translation: AAH64847.1 . Different initiation.
AK001907 mRNA. Translation: BAA91972.1 . Different initiation.
CCDSi CCDS9308.2. [Q9BXT8-3 ]
RefSeqi NP_112567.2. NM_031277.2. [Q9BXT8-3 ]
UniGenei Hs.97464.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2EQK NMR - A 949-1026 [» ]
ProteinModelPortali Q9BXT8.
SMRi Q9BXT8. Positions 685-862, 949-1026.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 121096. 1 interaction.
IntActi Q9BXT8. 3 interactions.
MINTi MINT-7944917.
STRINGi 9606.ENSP00000255324.

PTM databases

PhosphoSitei Q9BXT8.

Polymorphism databases

DMDMi 187608889.

Proteomic databases

MaxQBi Q9BXT8.
PaxDbi Q9BXT8.
PRIDEi Q9BXT8.

Protocols and materials databases

DNASUi 56163.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000255324 ; ENSP00000255324 ; ENSG00000132972 . [Q9BXT8-3 ]
ENST00000255325 ; ENSP00000255325 ; ENSG00000132972 . [Q9BXT8-1 ]
GeneIDi 56163.
KEGGi hsa:56163.
UCSCi uc001upq.1. human. [Q9BXT8-2 ]
uc001upr.3. human. [Q9BXT8-3 ]
uc010aac.3. human. [Q9BXT8-5 ]

Organism-specific databases

CTDi 56163.
GeneCardsi GC13P025338.
HGNCi HGNC:10060. RNF17.
HPAi HPA039699.
HPA040111.
MIMi 605793. gene.
neXtProti NX_Q9BXT8.
PharmGKBi PA34424.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG267246.
GeneTreei ENSGT00730000110295.
HOGENOMi HOG000074158.
HOVERGENi HBG108414.
InParanoidi Q9BXT8.
KOi K18405.
OMAi FEDGVWY.
OrthoDBi EOG7FFMQV.
PhylomeDBi Q9BXT8.

Miscellaneous databases

EvolutionaryTracei Q9BXT8.
GenomeRNAii 56163.
NextBioi 61792.
PROi Q9BXT8.
SOURCEi Search...

Gene expression databases

Bgeei Q9BXT8.
CleanExi HS_RNF17.
ExpressionAtlasi Q9BXT8. baseline and differential.
Genevestigatori Q9BXT8.

Family and domain databases

Gene3Di 2.40.50.90. 1 hit.
InterProi IPR016071. Staphylococal_nuclease_OB-fold.
IPR002999. Tudor.
IPR001841. Znf_RING.
IPR017907. Znf_RING_CS.
[Graphical view ]
Pfami PF00567. TUDOR. 5 hits.
[Graphical view ]
SMARTi SM00184. RING. 1 hit.
SM00333. TUDOR. 4 hits.
[Graphical view ]
SUPFAMi SSF50199. SSF50199. 1 hit.
PROSITEi PS50304. TUDOR. 4 hits.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "An abundance of X-linked genes expressed in spermatogonia."
    Wang P.J., McCarrey J.R., Yang F., Page D.C.
    Nat. Genet. 27:422-426(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2 AND 3).
    Tissue: Testis.
  2. "The DNA sequence and analysis of human chromosome 13."
    Dunham A., Matthews L.H., Burton J., Ashurst J.L., Howe K.L., Ashcroft K.J., Beare D.M., Burford D.C., Hunt S.E., Griffiths-Jones S., Jones M.C., Keenan S.J., Oliver K., Scott C.E., Ainscough R., Almeida J.P., Ambrose K.D., Andrews D.T.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Bannerjee R., Barlow K.F., Bates K., Beasley H., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burrill W., Carder C., Carter N.P., Chapman J.C., Clamp M.E., Clark S.Y., Clarke G., Clee C.M., Clegg S.C., Cobley V., Collins J.E., Corby N., Coville G.J., Deloukas P., Dhami P., Dunham I., Dunn M., Earthrowl M.E., Ellington A.G., Faulkner L., Frankish A.G., Frankland J., French L., Garner P., Garnett J., Gilbert J.G.R., Gilson C.J., Ghori J., Grafham D.V., Gribble S.M., Griffiths C., Hall R.E., Hammond S., Harley J.L., Hart E.A., Heath P.D., Howden P.J., Huckle E.J., Hunt P.J., Hunt A.R., Johnson C., Johnson D., Kay M., Kimberley A.M., King A., Laird G.K., Langford C.J., Lawlor S., Leongamornlert D.A., Lloyd D.M., Lloyd C., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., McLaren S.J., McMurray A., Milne S., Moore M.J.F., Nickerson T., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K.M., Rice C.M., Searle S., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Steward C.A., Sycamore N., Tester J., Thomas D.W., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Wilming L., Wray P.W., Wright M.W., Young L., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Beck S., Bentley D.R., Rogers J., Ross M.T.
    Nature 428:522-528(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 765-1623 (ISOFORM 5), VARIANT LYS-1380.
    Tissue: Testis.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 914-1623 (ISOFORM 4), VARIANT LYS-1380.
    Tissue: Placenta.
  5. "Solution structure of the tudor domain of tudor domain-containing protein 4."
    RIKEN structural genomics initiative (RSGI)
    Submitted (OCT-2007) to the PDB data bank
    Cited for: STRUCTURE BY NMR OF 949-1026.

Entry informationi

Entry nameiRNF17_HUMAN
AccessioniPrimary (citable) accession number: Q9BXT8
Secondary accession number(s): Q5T2J9
, Q6P1W3, Q9BXT7, Q9NUY9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 24, 2001
Last sequence update: April 29, 2008
Last modified: October 29, 2014
This is version 115 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 13
    Human chromosome 13: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3