Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RNA helicase Mov10l1

Gene

MOV10L1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at transcript leveli

Functioni

ATP-dependent RNA helicase required during spermatogenesis to repress transposable elements and prevent their mobilization, which is essential for germline integrity. Acts via the piRNA metabolic process, which mediates the repression of transposable elements during meiosis by forming complexes composed of piRNAs and Piwi proteins and governs the methylation and subsequent repression of transposons. Involved in the primary piRNA metabolic process. Specifically binds to piRNA precursors and promotes the generation of intermediate piRNA processing fragments that are subsequently loaded to Piwi proteins. Acts via its ATP-dependent RNA helicase activity: displays 5'-3' RNA unwinding activity and probably mediates unwinding and funneling of single-stranded piRNA precursor transcripts to the endonuclease that catalyzes the first cleavage step of piRNA processing to generate piRNA intermediate fragments that are subsequently loaded to Piwi proteins.By similarity

Catalytic activityi

ATP + H2O = ADP + phosphate.By similarity

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Nucleotide bindingi770 – 777ATPSequence analysis8

GO - Molecular functioni

  • ATP binding Source: UniProtKB
  • ATP-dependent RNA helicase activity Source: UniProtKB
  • magnesium ion binding Source: UniProtKB
  • RNA binding Source: UniProtKB

GO - Biological processi

  • DNA methylation involved in gamete generation Source: UniProtKB
  • germ cell development Source: UniProtKB
  • male meiosis I Source: UniProtKB
  • multicellular organism development Source: UniProtKB-KW
  • piRNA metabolic process Source: UniProtKB
  • spermatogenesis Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Developmental protein, Helicase, Hydrolase

Keywords - Ligandi

ATP-binding, Nucleotide-binding

Enzyme and pathway databases

BioCyciZFISH:ENSG00000073146-MONOMER.
ReactomeiR-HSA-5601884. PIWI-interacting RNA (piRNA) biogenesis.

Names & Taxonomyi

Protein namesi
Recommended name:
RNA helicase Mov10l1Curated (EC:3.6.4.13By similarity)
Alternative name(s):
Moloney leukemia virus 10-like protein 1Imported
Short name:
MOV10-like protein 1Imported
Gene namesi
Name:MOV10L1Imported
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

HGNCiHGNC:7201. MOV10L1.

Subcellular locationi

  • Cytoplasm By similarity

  • Note: Component of the meiotic nuage, also named P granule, a germ-cell-specific organelle required to repress transposon activity during meiosis.By similarity

GO - Cellular componenti

  • intracellular Source: UniProtKB
  • P granule Source: UniProtKB
  • pi-body Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

DisGeNETi54456.
OpenTargetsiENSG00000073146.
PharmGKBiPA30909.

Polymorphism and mutation databases

BioMutaiMOV10L1.
DMDMi22095856.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000807061 – 1211RNA helicase Mov10l1Add BLAST1211

Proteomic databases

EPDiQ9BXT6.
PaxDbiQ9BXT6.
PeptideAtlasiQ9BXT6.
PRIDEiQ9BXT6.

PTM databases

iPTMnetiQ9BXT6.
PhosphoSitePlusiQ9BXT6.

Expressioni

Tissue specificityi

Isoform 1: Specifically expressed in testis.1 Publication

Gene expression databases

BgeeiENSG00000073146.
CleanExiHS_MOV10L1.
ExpressionAtlasiQ9BXT6. baseline and differential.
GenevisibleiQ9BXT6. HS.

Organism-specific databases

HPAiCAB005427.
HPA019034.

Interactioni

Subunit structurei

Interacts with PIWIL1. Interacts with PIWIL2. Interacts with PIWIL4. Interacts with HSPA2. Interacts with PLD6.By similarity

Protein-protein interaction databases

BioGridi119963. 1 interactor.
STRINGi9606.ENSP00000262794.

Structurei

3D structure databases

ProteinModelPortaliQ9BXT6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi886 – 889DEAG box4

Sequence similaritiesi

Phylogenomic databases

eggNOGiKOG1804. Eukaryota.
COG1112. LUCA.
GeneTreeiENSGT00800000124068.
HOGENOMiHOG000015363.
HOVERGENiHBG052382.
InParanoidiQ9BXT6.
KOiK13983.
OMAiTQEYNGH.
OrthoDBiEOG091G03T8.
PhylomeDBiQ9BXT6.
TreeFamiTF323999.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR027417. P-loop_NTPase.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Note: Additional isoforms seem to exist.
Isoform 1 (identifier: Q9BXT6-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLSLAAKLVA FFWRTADTPR EEAGQLEPEL AEGDTKLKTV RGVVTRYCSD
60 70 80 90 100
YGMIDDMIYF SSDAVTSRVL LNVGQEVIAV VEENKVSNGL KAIRVEAVSD
110 120 130 140 150
KWEDDSRNHG SPSDCGPRVL IGCVTSLVEG AGCISQTTYF SLESVCEGFE
160 170 180 190 200
PCKGDWVEAE YRIRPGTWSS EATSVKPLRY KRVDKVCISS LCGRNGVLEE
210 220 230 240 250
SIFFTLDSLK LPDGYTPRRG DVVNAVVVES SQSCYVWRAL CMTLVKRRDA
260 270 280 290 300
APVHEATHFY GTILLKNKGD IEVTQVTHFG TLKEGRSKTM VIWIENKGDI
310 320 330 340 350
PQNLVSCKLA GWDKSKQFRF QMLDKDQMCP VVSFVSVPEK ENSSDENINS
360 370 380 390 400
LNSHTKNKTS QMSESSLVNN RGISPGDCTC KGENGEKDNI LSRKQMTEPE
410 420 430 440 450
PGGLVPPGGK TFIVVICDGK NPGRCKELLL LCFSDFLIGR YLEVNVISGE
460 470 480 490 500
ESLIAAREPF SWKKLKSSQA LTSAKTTVVV TAQKRNSRRQ LPSFLPQYPI
510 520 530 540 550
PDRLRKCVEQ KIDILTFQPL LAELLNMSNY KEKFSTLLWL EEIYAEMELK
560 570 580 590 600
EYNMSGIILR RNGDLLVLEV PGLAEGRPSL YAGDKLILKT QEYNGHAIEY
610 620 630 640 650
ISYVTEIHEE DVTLKINPEF EQAYNFEPMD VEFTYNRTTS RRCHFALEHV
660 670 680 690 700
IHLGVKVLFP EEIILQSPQV TGNWNHAQDT KSSGQSTSKK NRKTMTDQAE
710 720 730 740 750
HGTEERRVGD KDLPVLAPFT AEMSDWVDEI QTPKARKMEF FNPVLNENQK
760 770 780 790 800
LAVKRILSGD CRPLPYILFG PPGTGKTVTI IEAVLQVHFA LPDSRILVCA
810 820 830 840 850
PSNSAADLVC LRLHESKVLQ PATMVRVNAT CRFEEIVIDA VKPYCRDGED
860 870 880 890 900
IWKASRFRII ITTCSSSGLF YQIGVRVGHF THVFVDEAGQ ASEPECLIPL
910 920 930 940 950
GLMSDISGQI VLAGDPMQLG PVIKSRLAMA YGLNVSFLER LMSRPAYQRD
960 970 980 990 1000
ENAFGACGAH NPLLVTKLVK NYRSHEALLM LPSRLFYHRE LEVCADPTVV
1010 1020 1030 1040 1050
TSLLGWEKLP KKGFPLIFHG VRGSEAREGK SPSWFNPAEA VQVLRYCCLL
1060 1070 1080 1090 1100
AHSISSQVSA SDIGVITPYR KQVEKIRILL RNVDLMDIKV GSVEEFQGQE
1110 1120 1130 1140 1150
YLVIIISTVR SNEDRFEDDR YFLGFLSNSK RFNVAITRPK ALLIVLGNPH
1160 1170 1180 1190 1200
VLVRDPCFGA LLEYSITNGV YMGCDLPPAL QSLQNCGEGV ADPSYPVVPE
1210
STGPEKHQEP S
Length:1,211
Mass (Da):135,293
Last modified:June 1, 2001 - v1
Checksum:i410716BDCC85F8B1
GO
Isoform 2 (identifier: Q9BXT6-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-873: Missing.
     874-875: GV → MF

Show »
Length:338
Mass (Da):37,504
Checksum:i36393089E7038F73
GO
Isoform 3 (identifier: Q9BXT6-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-902: Missing.
     910-964: Missing.
     1074-1082: EKIRILLRN → RPAQARLVL
     1083-1211: Missing.

Note: No experimental confirmation available.
Show »
Length:125
Mass (Da):13,978
Checksum:iFBC7AC28ECDC4A30
GO
Isoform 4 (identifier: Q9BXT6-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1109-1154: Missing.

Note: No experimental confirmation available.
Show »
Length:1,165
Mass (Da):129,937
Checksum:i05600F89330D9C7E
GO
Isoform 5 (identifier: Q9BXT6-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-32: MLSLAAKLVAFFWRTADTPREEAGQLEPELAE → MSFLPVRSVIGG
     1155-1211: DPCFGALLEY...TGPEKHQEPS → LWRGGGRPLLPSGARIHRTREASGAQLICSG

Note: No experimental confirmation available.
Show »
Length:1,165
Mass (Da):130,229
Checksum:i508CFAEF64928B79
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti321Q → H in BAH13697 (PubMed:14702039).Curated1
Sequence conflicti1016L → P in BAH13697 (PubMed:14702039).Curated1
Sequence conflicti1063I → V in BAA90895 (PubMed:14702039).Curated1
Sequence conflicti1096F → L in BAA90895 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_05945718T → S.Corresponds to variant rs12628964dbSNPEnsembl.1
Natural variantiVAR_03410057M → L.Corresponds to variant rs9617066dbSNPEnsembl.1
Natural variantiVAR_020148182R → C.Corresponds to variant rs3810971dbSNPEnsembl.1
Natural variantiVAR_013694454I → L.2 PublicationsCorresponds to variant rs760749dbSNPEnsembl.1
Natural variantiVAR_013695650V → I.Corresponds to variant rs2340601dbSNPEnsembl.1
Natural variantiVAR_034101683S → G.Corresponds to variant rs3736689dbSNPEnsembl.1
Natural variantiVAR_013696820Q → R.2 PublicationsCorresponds to variant rs2272837dbSNPEnsembl.1
Natural variantiVAR_0136971179A → E.1 PublicationCorresponds to variant rs2272843dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0109451 – 902Missing in isoform 3. 1 PublicationAdd BLAST902
Alternative sequenceiVSP_0033901 – 873Missing in isoform 2. 1 PublicationAdd BLAST873
Alternative sequenceiVSP_0460821 – 32MLSLA…PELAE → MSFLPVRSVIGG in isoform 5. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_003391874 – 875GV → MF in isoform 2. 1 Publication2
Alternative sequenceiVSP_010946910 – 964Missing in isoform 3. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_0109471074 – 1082EKIRILLRN → RPAQARLVL in isoform 3. 1 Publication9
Alternative sequenceiVSP_0109481083 – 1211Missing in isoform 3. 1 PublicationAdd BLAST129
Alternative sequenceiVSP_0454131109 – 1154Missing in isoform 4. 1 PublicationAdd BLAST46
Alternative sequenceiVSP_0460831155 – 1211DPCFG…HQEPS → LWRGGGRPLLPSGARIHRTR EASGAQLICSG in isoform 5. 1 PublicationAdd BLAST57

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF285604 mRNA. Translation: AAK31983.1.
AK000033 mRNA. Translation: BAA90895.1.
AK090740 mRNA. Translation: BAC03511.1.
AK302401 mRNA. Translation: BAH13697.1.
CR456466 mRNA. Translation: CAG30352.1.
AL034546, AL022328 Genomic DNA. Translation: CAI23226.1.
AL034546, AL022328 Genomic DNA. Translation: CAQ10986.1.
BC150137 mRNA. Translation: AAI50138.1.
BC152539 mRNA. Translation: AAI52540.1.
AL133068 mRNA. Translation: CAB61391.1.
CCDSiCCDS14084.1. [Q9BXT6-1]
CCDS54541.1. [Q9BXT6-4]
CCDS54542.1. [Q9BXT6-5]
CCDS54543.1. [Q9BXT6-2]
PIRiT42668.
RefSeqiNP_001157576.1. NM_001164104.1. [Q9BXT6-4]
NP_001157577.1. NM_001164105.1. [Q9BXT6-5]
NP_001157578.1. NM_001164106.1. [Q9BXT6-2]
NP_061868.1. NM_018995.2. [Q9BXT6-1]
UniGeneiHs.62880.

Genome annotation databases

EnsembliENST00000262794; ENSP00000262794; ENSG00000073146. [Q9BXT6-1]
ENST00000354853; ENSP00000346917; ENSG00000073146. [Q9BXT6-3]
ENST00000395852; ENSP00000379193; ENSG00000073146. [Q9BXT6-2]
ENST00000395858; ENSP00000379199; ENSG00000073146. [Q9BXT6-4]
ENST00000540615; ENSP00000438542; ENSG00000073146. [Q9BXT6-5]
ENST00000545383; ENSP00000438978; ENSG00000073146. [Q9BXT6-1]
GeneIDi54456.
KEGGihsa:54456.
UCSCiuc003bjj.4. human. [Q9BXT6-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF285604 mRNA. Translation: AAK31983.1.
AK000033 mRNA. Translation: BAA90895.1.
AK090740 mRNA. Translation: BAC03511.1.
AK302401 mRNA. Translation: BAH13697.1.
CR456466 mRNA. Translation: CAG30352.1.
AL034546, AL022328 Genomic DNA. Translation: CAI23226.1.
AL034546, AL022328 Genomic DNA. Translation: CAQ10986.1.
BC150137 mRNA. Translation: AAI50138.1.
BC152539 mRNA. Translation: AAI52540.1.
AL133068 mRNA. Translation: CAB61391.1.
CCDSiCCDS14084.1. [Q9BXT6-1]
CCDS54541.1. [Q9BXT6-4]
CCDS54542.1. [Q9BXT6-5]
CCDS54543.1. [Q9BXT6-2]
PIRiT42668.
RefSeqiNP_001157576.1. NM_001164104.1. [Q9BXT6-4]
NP_001157577.1. NM_001164105.1. [Q9BXT6-5]
NP_001157578.1. NM_001164106.1. [Q9BXT6-2]
NP_061868.1. NM_018995.2. [Q9BXT6-1]
UniGeneiHs.62880.

3D structure databases

ProteinModelPortaliQ9BXT6.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119963. 1 interactor.
STRINGi9606.ENSP00000262794.

PTM databases

iPTMnetiQ9BXT6.
PhosphoSitePlusiQ9BXT6.

Polymorphism and mutation databases

BioMutaiMOV10L1.
DMDMi22095856.

Proteomic databases

EPDiQ9BXT6.
PaxDbiQ9BXT6.
PeptideAtlasiQ9BXT6.
PRIDEiQ9BXT6.

Protocols and materials databases

DNASUi54456.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000262794; ENSP00000262794; ENSG00000073146. [Q9BXT6-1]
ENST00000354853; ENSP00000346917; ENSG00000073146. [Q9BXT6-3]
ENST00000395852; ENSP00000379193; ENSG00000073146. [Q9BXT6-2]
ENST00000395858; ENSP00000379199; ENSG00000073146. [Q9BXT6-4]
ENST00000540615; ENSP00000438542; ENSG00000073146. [Q9BXT6-5]
ENST00000545383; ENSP00000438978; ENSG00000073146. [Q9BXT6-1]
GeneIDi54456.
KEGGihsa:54456.
UCSCiuc003bjj.4. human. [Q9BXT6-1]

Organism-specific databases

CTDi54456.
DisGeNETi54456.
GeneCardsiMOV10L1.
HGNCiHGNC:7201. MOV10L1.
HPAiCAB005427.
HPA019034.
MIMi605794. gene.
neXtProtiNX_Q9BXT6.
OpenTargetsiENSG00000073146.
PharmGKBiPA30909.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1804. Eukaryota.
COG1112. LUCA.
GeneTreeiENSGT00800000124068.
HOGENOMiHOG000015363.
HOVERGENiHBG052382.
InParanoidiQ9BXT6.
KOiK13983.
OMAiTQEYNGH.
OrthoDBiEOG091G03T8.
PhylomeDBiQ9BXT6.
TreeFamiTF323999.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000073146-MONOMER.
ReactomeiR-HSA-5601884. PIWI-interacting RNA (piRNA) biogenesis.

Miscellaneous databases

GenomeRNAii54456.
PROiQ9BXT6.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000073146.
CleanExiHS_MOV10L1.
ExpressionAtlasiQ9BXT6. baseline and differential.
GenevisibleiQ9BXT6. HS.

Family and domain databases

Gene3Di3.40.50.300. 2 hits.
InterProiIPR027417. P-loop_NTPase.
[Graphical view]
SUPFAMiSSF52540. SSF52540. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiM10L1_HUMAN
AccessioniPrimary (citable) accession number: Q9BXT6
Secondary accession number(s): A7E211
, A8MXC6, B7WPP1, B7Z7R1, F5H403, Q5TGD5, Q8NBD4, Q9NXW3, Q9UFB3, Q9UGX9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 2, 2002
Last sequence update: June 1, 2001
Last modified: November 2, 2016
This is version 133 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 22
    Human chromosome 22: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.