Q9BXS0 (COPA1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 85.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Collagen alpha-1(XXV) chain Alternative name(s): Alzheimer disease amyloid-associated protein Short name=AMY CLAC-P Cleaved into the following chain:
| ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 654 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Inhibits fibrillization of beta amyloid peptide during the elongation phase. Has also been shown to assemble amyloid fibrils into protease-resistant aggregates. Binds heparin. Ref.4 Ref.6 Ref.7 Ref.8 |
| Subunit structure | Forms homodimers and homotrimers. Binds to the fibrillized forms of beta amyloid peptide 40 (beta-APP40) and beta amyloid peptide 42 (beta-APP42). Found associated with beta-APP42 more frequently than with beta-APP40. Ref.1 Ref.4 Ref.5 Ref.8 |
| Subcellular location | Membrane; Single-pass type II membrane protein Potential. Note: After proteolytic cleavage, CLAC is secreted. |
| Tissue specificity | Expressed predominantly in brain. Deposited preferentially in primitive or neuritic amyloid plaques which are typical of Alzheimer disease. Ref.1 |
| Post-translational modification | Undergoes proteolytic cleavage by furin protease to yield the soluble collagen-like Alzheimer amyloid plaque component. Ref.1 Glycosylated. Ref.4 Hydroxylated on 11% of proline residues and 49% of lysine residues. Ref.1 Ref.4 |
| Sequence similarities | Contains 7 collagen-like domains. |
| Caution | The pyrrolidone carboxylic acid reported in Ref.1 probably formed artifactually from Glu-113 during the extraction procedure in 70% formic acid. In Ref.4, the protein was found to have unblocked Glu at the N-terminus. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Amyloid Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Collagen Repeat Signal-anchor Transmembrane Transmembrane helix |
| Ligand | Heparin-binding |
| PTM | Glycoprotein Hydroxylation |
| Technical term | Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | extracellular matrix organization Traceable author statement. Source: Reactome |
| Cellular_component | collagen Inferred from electronic annotation. Source: UniProtKB-KW endoplasmic reticulum lumenTraceable author statement. Source: Reactome extracellular spaceInferred from direct assay Ref.1. Source: UniProtKB integral to plasma membraneInferred from direct assay Ref.1. Source: MGI |
| Molecular_function | beta-amyloid binding Inferred from direct assay Ref.1Ref.5Ref.4Ref.8. Source: UniProtKB heparin bindingInferred from direct assay Ref.4. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.1 (identifier: Q9BXS0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.1 (identifier: Q9BXS0-2) The sequence of this isoform differs from the canonical sequence as follows: 616-654: GFRGVKGEKGEPGQPGLDGLDAPCQLGPDGLPMPGCWQK → VTSPSQHVPCLILLLLSALLFSLCDSI | ||||||
| Isoform 3 Ref.2 (identifier: Q9BXS0-3) The sequence of this isoform differs from the canonical sequence as follows: 141-146: Missing. 326-340: Missing. 589-640: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 654 | 654 | Collagen alpha-1(XXV) chain | PRO_0000259611 | |||||
| Chain | 113 – 654 | 542 | Collagen-like Alzheimer amyloid plaque component Ref.1 Ref.4 | PRO_0000259612 | |||||
Regions | |||||||||
| Topological domain | 1 – 33 | 33 | Cytoplasmic Potential | ||||||
| Transmembrane | 34 – 54 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||
| Topological domain | 55 – 654 | 600 | Extracellular Potential | ||||||
| Domain | 121 – 164 | 44 | Collagen-like 1 | ||||||
| Domain | 192 – 247 | 56 | Collagen-like 2 | ||||||
| Domain | 249 – 308 | 60 | Collagen-like 3 | ||||||
| Domain | 311 – 370 | 60 | Collagen-like 4 | ||||||
| Domain | 372 – 425 | 54 | Collagen-like 5 | ||||||
| Domain | 447 – 505 | 59 | Collagen-like 6 | ||||||
| Domain | 571 – 630 | 60 | Collagen-like 7 | ||||||
| Region | 181 – 188 | 8 | Interaction with beta amyloid peptide Ref.4 | ||||||
Sites | |||||||||
| Site | 112 – 113 | 2 | Cleavage; by furin Ref.1 | ||||||
Natural variations | |||||||||
| Alternative sequence | 141 – 146 | 6 | Missing in isoform 3. Ref.2 | VSP_052197 | |||||
| Alternative sequence | 326 – 340 | 15 | Missing in isoform 3. Ref.2 | VSP_052198 | |||||
| Alternative sequence | 589 – 640 | 52 | Missing in isoform 3. Ref.2 | VSP_052199 | |||||
| Alternative sequence | 616 – 654 | 39 | GFRGV…GCWQK → VTSPSQHVPCLILLLLSALL FSLCDSI in isoform 2. Ref.1 | VSP_052200 | |||||
Experimental info | |||||||||
| Mutagenesis | 109 | 1 | R → A: Not secreted. Ref.1 | ||||||
| Mutagenesis | 112 | 1 | R → A: Not secreted. Ref.1 | ||||||
| Mutagenesis | 181 – 188 | 8 | LIKRRLIK → VIKRRTFQ: Reduces binding to beta amyloid peptide. Ref.4 | ||||||
| Mutagenesis | 181 – 188 | 8 | Missing: Abolishes binding to beta amyloid peptide. Ref.4 | ||||||
| Sequence conflict | 28 | 1 | A → S in AAK35008. Ref.1 | ||||||
| Sequence conflict | 28 | 1 | A → S in AAK35009. Ref.2 | ||||||
| Sequence conflict | 427 | 1 | E → K in AAK35008. Ref.1 | ||||||
| Sequence conflict | 427 | 1 | E → K in AAK35009. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "CLAC: a novel Alzheimer amyloid plaque component derived from a transmembrane precursor, CLAC-P/collagen type XXV." Hashimoto T., Wakabayashi T., Watanabe A., Kowa H., Hosoda R., Nakamura A., Kanazawa I., Arai T., Takio K., Mann D.M.A., Iwatsubo T. EMBO J. 21:1524-1534(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), PROTEIN SEQUENCE OF 131-152 AND 156-214, INTERACTION WITH BETA AMYLOID PEPTIDE, TISSUE SPECIFICITY, CLEAVAGE, HYDROXYLATION, PYROGLUTAMATE FORMATION AT GLU-113, MUTAGENESIS OF ARG-109 AND ARG-112. |
| [2] | "Molecular identification of AMY, an Alzheimer disease amyloid-associated protein." Soederberg L., Zhukareva V., Bogdanovic N., Hashimoto T., Winblad B., Iwatsubo T., Lee V.M.Y., Trojanowski J.Q., Naeslund J. J. Neuropathol. Exp. Neurol. 62:1108-1117(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3). |
| [3] | "Generation and annotation of the DNA sequences of human chromosomes 2 and 4." Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. Wilson R.K.Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [4] | "Characterization of the Alzheimer's disease-associated CLAC protein and identification of an amyloid beta-peptide-binding site." Soederberg L., Kakuyama H., Moeller A., Ito A., Winblad B., Tjernberg L.O., Naeslund J. J. Biol. Chem. 280:1007-1015(2005) [PubMed] [Europe PMC] [Abstract] Cited for: PROTEIN SEQUENCE OF CLAC N-TERMINUS, PROTEIN SEQUENCE OF 182-191 AND 445-452, FUNCTION, SUBUNIT, INTERACTION WITH BETA AMYLOID PEPTIDE, GLYCOSYLATION, HYDROXYLATION, MUTAGENESIS OF 181-LEU--LYS-188. |
| [5] | "Mostly separate distributions of CLAC- versus Abeta40- or thioflavin S-reactivities in senile plaques reveal two distinct subpopulations of beta-amyloid deposits." Kowa H., Sakakura T., Matsuura Y., Wakabayashi T., Mann D.M.A., Duff K., Tsuji S., Hashimoto T., Iwatsubo T. Am. J. Pathol. 165:273-281(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH BETA AMYLOID PEPTIDE. |
| [6] | "CLAC binds to aggregated Abeta and Abeta fragments, and attenuates fibril elongation." Kakuyama H., Soederberg L., Horigome K., Winblad B., Dahlqvist C., Naeslund J., Tjernberg L.O. Biochemistry 44:15602-15609(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [7] | "Collagenous Alzheimer amyloid plaque component assembles amyloid fibrils into protease resistant aggregates." Soederberg L., Dahlqvist C., Kakuyama H., Thyberg J., Ito A., Winblad B., Naeslund J., Tjernberg L.O. FEBS J. 272:2231-2236(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [8] | "CLAC binds to amyloid beta peptides through the positively charged amino acid cluster within the collagenous domain 1 and inhibits formation of amyloid fibrils." Osada Y., Hashimoto T., Nishimura A., Matsuo Y., Wakabayashi T., Iwatsubo T. J. Biol. Chem. 280:8596-8605(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH BETA AMYLOID PEPTIDE. |
| [9] | Erratum Osada Y., Hashimoto T., Nishimura A., Matsuo Y., Wakabayashi T., Iwatsubo T. J. Biol. Chem. 280:15484-15484(2005) |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF293340 mRNA. Translation: AAK35008.1. AF293341 mRNA. Translation: AAK35009.1. AC097473 Genomic DNA. No translation available. AC073427 Genomic DNA. No translation available. AC095066 Genomic DNA. No translation available. AC004701 Genomic DNA. No translation available. AC004051 Genomic DNA. No translation available. |
| IPI | IPI00186946. IPI00942774. IPI00953070. |
| RefSeq | NP_115907.2. NM_032518.2. NP_942014.1. NM_198721.2. |
| UniGene | Hs.658842. |
3D structure databases | |
| ProteinModelPortal | Q9BXS0. |
| SMR | Q9BXS0. Positions 560-596. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000329626. |
PTM databases | |
| PhosphoSite | Q9BXS0. |
Polymorphism databases | |
| DMDM | 296434459. |
Proteomic databases | |
| PaxDb | Q9BXS0. |
| PRIDE | Q9BXS0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000399126; ENSP00000382077; ENSG00000188517. ENST00000399132; ENSP00000382083; ENSG00000188517. |
| GeneID | 84570. |
| KEGG | hsa:84570. |
| UCSC | uc003hze.1. human. uc003hzg.3. human. |
Organism-specific databases | |
| CTD | 84570. |
| GeneCards | GC04M109731. |
| H-InvDB | HIX0004434. |
| HGNC | HGNC:18603. COL25A1. |
| HPA | HPA029107. |
| MIM | 610004. gene. |
| neXtProt | NX_Q9BXS0. |
| PharmGKB | PA134912284. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG12793. |
| HOGENOM | HOG000085653. |
| HOVERGEN | HBG101380. |
| OrthoDB | EOG4K3KWH. |
Enzyme and pathway databases | |
| Reactome | REACT_118779. Extracellular matrix organization. |
Gene expression databases | |
| ArrayExpress | Q9BXS0. |
| Bgee | Q9BXS0. |
| CleanEx | HS_COL25A1. |
| Genevestigator | Q9BXS0. |
Family and domain databases | |
| InterPro | IPR008160. Collagen. [Graphical view] |
| Pfam | PF01391. Collagen. 7 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 84570. |
| NextBio | 74464. |
| SOURCE | Search... |
Entry information
| Entry name | COPA1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BXS0 Secondary accession number(s): A8MPZ6, Q9BXR9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 4 Human chromosome 4: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
