SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BXN2

- CLC7A_HUMAN

UniProt

Q9BXN2 - CLC7A_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

C-type lectin domain family 7 member A

Gene
CLEC7A, BGR, CLECSF12, DECTIN1, UNQ539/PRO1082
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation By similarity.3 Publications

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi157 – 1571Divalent metal cation By similarity
Metal bindingi159 – 1591Divalent metal cation By similarity
Metal bindingi163 – 1631Divalent metal cation By similarity
Metal bindingi242 – 2421Divalent metal cation By similarity

GO - Molecular functioni

  1. (1->3)-beta-D-glucan binding Source: Ensembl
  2. (1->3)-beta-D-glucan receptor activity Source: Ensembl
  3. carbohydrate binding Source: UniProtKB
  4. metal ion binding Source: UniProtKB-KW
  5. MHC protein binding Source: UniProtKB
  6. signaling pattern recognition receptor activity Source: UniProtKB

GO - Biological processi

  1. carbohydrate mediated signaling Source: UniProtKB
  2. cell recognition Source: UniProtKB
  3. cell surface pattern recognition receptor signaling pathway Source: Ensembl
  4. cellular response to molecule of fungal origin Source: Ensembl
  5. defense response to protozoan Source: UniProtKB
  6. detection of yeast Source: Ensembl
  7. inflammatory response Source: UniProtKB-KW
  8. innate immune response Source: UniProtKB-KW
  9. leukocyte activation involved in immune response Source: Ensembl
  10. phagocytosis, engulfment Source: Ensembl
  11. phagocytosis, recognition Source: UniProtKB
  12. positive regulation of phagocytosis Source: Ensembl
  13. positive regulation of tumor necrosis factor production Source: Ensembl
  14. single organismal cell-cell adhesion Source: Ensembl
  15. T cell activation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Immunity, Inflammatory response, Innate immunity

Keywords - Ligandi

Lectin, Metal-binding

Names & Taxonomyi

Protein namesi
Recommended name:
C-type lectin domain family 7 member A
Alternative name(s):
Beta-glucan receptor
C-type lectin superfamily member 12
Dendritic cell-associated C-type lectin 1
Short name:
DC-associated C-type lectin 1
Short name:
Dectin-1
Gene namesi
Name:CLEC7A
Synonyms:BGR, CLECSF12, DECTIN1
ORF Names:UNQ539/PRO1082
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 12

Organism-specific databases

HGNCiHGNC:14558. CLEC7A.

Subcellular locationi

Cell membrane; Single-pass type II membrane protein 3 Publications
Isoform 5 : Cytoplasm 3 Publications
Isoform 6 : Cytoplasm Inferred 3 Publications
Isoform 7 : Cytoplasm Inferred 3 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 4444Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei45 – 6521Helical; Signal-anchor for type II membrane protein; Reviewed predictionAdd
BLAST
Topological domaini66 – 247182Extracellular Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. external side of plasma membrane Source: Ensembl
  3. integral component of membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Involvement in diseasei

Candidiasis, familial, 4 (CANDF4) [MIM:613108]: A primary immunodeficiency disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans.
Note: The disease may be caused by mutations affecting the gene represented in this entry.1 Publication

Organism-specific databases

MIMi613108. phenotype.
614079. phenotype.
Orphaneti1334. Chronic mucocutaneous candidiasis.
PharmGKBiPA26581.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 247247C-type lectin domain family 7 member APRO_0000269491Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi91 – 911N-linked (GlcNAc...) Reviewed prediction
Disulfide bondi120 ↔ 131 By similarity
Disulfide bondi148 ↔ 241 By similarity
Disulfide bondi220 ↔ 233 By similarity

Post-translational modificationi

Phosphorylated on tyrosine residues in response to glucan binding By similarity.

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ9BXN2.
PRIDEiQ9BXN2.

PTM databases

PhosphoSiteiQ9BXN2.

Expressioni

Tissue specificityi

Highly expressed in peripheral blood leukocytes and dendritic cells. Detected in spleen, bone marrow, lung, muscle, stomach and placenta.5 Publications

Inductioni

Up-regulated during differentiation from monocytes into dendritic cells.1 Publication

Gene expression databases

ArrayExpressiQ9BXN2.
BgeeiQ9BXN2.
GenevestigatoriQ9BXN2.

Organism-specific databases

HPAiHPA043244.

Interactioni

Subunit structurei

Homodimer By similarity. Interacts with SYK; participates in leukocyte activation in presence of fungal pathogens By similarity. Isoform 5 interacts with RANBP9.1 Publication

Protein-protein interaction databases

BioGridi122206. 6 interactions.
IntActiQ9BXN2. 5 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9BXN2.
SMRiQ9BXN2. Positions 120-245.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini127 – 242116C-type lectinAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi15 – 184ITAM-like

Sequence similaritiesi

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG327853.
HOGENOMiHOG000151249.
HOVERGENiHBG105854.
InParanoidiQ9BXN2.
KOiK10074.
OMAiTEGPWLW.
OrthoDBiEOG747PJT.
PhylomeDBiQ9BXN2.
TreeFamiTF336674.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR016187. C-type_lectin_fold.
[Graphical view]
PfamiPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]

Sequences (10)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BXN2-1) [UniParc]FASTAAdd to Basket

Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEYHPDLENL DEDGYTQLHF DSQSNTRIAV VSEKGSCAAS PPWRLIAVIL    50
GILCLVILVI AVVLGTMAIW RSNSGSNTLE NGYFLSRNKE NHSQPTQSSL 100
EDSVTPTKAV KTTGVLSSPC PPNWIIYEKS CYLFSMSLNS WDGSKRQCWQ 150
LGSNLLKIDS SNELGFIVKQ VSSQPDNSFW IGLSRPQTEV PWLWEDGSTF 200
SSNLFQIRTT ATQENPSPNC VWIHVSVIYD QLCSVPSYSI CEKKFSM 247
Length:247
Mass (Da):27,627
Last modified:June 1, 2001 - v1
Checksum:i98393E36976111B9
GO
Isoform 2 (identifier: Q9BXN2-2) [UniParc]FASTAAdd to Basket

Also known as: Beta, B

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.

Note: Predominant isoform.

Show »
Length:201
Mass (Da):22,563
Checksum:iC6ADEE762B2CE968
GO
Isoform 3 (identifier: Q9BXN2-3) [UniParc]FASTAAdd to Basket

Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     165-189: GFIVKQVSSQPDNSFWIGLSRPQTE → ISDQNHSYPRKPISKLCMDSRVSHL
     190-247: Missing.

Show »
Length:189
Mass (Da):21,065
Checksum:iF7DF9F76EA4B6B59
GO
Isoform 4 (identifier: Q9BXN2-4) [UniParc]FASTAAdd to Basket

Also known as: G

The sequence of this isoform differs from the canonical sequence as follows:
     165-196: GFIVKQVSSQPDNSFWIGLSRPQTEVPWLWED → SLTLLPKLECSEAATSQAQVILPPQLPE
     197-247: Missing.

Show »
Length:192
Mass (Da):21,130
Checksum:i6F3350B1DFBEC921
GO
Isoform 5 (identifier: Q9BXN2-5) [UniParc]FASTAAdd to Basket

Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     36-114: Missing.

Show »
Length:168
Mass (Da):19,218
Checksum:iAFD3A88F89BBFFC6
GO
Isoform 6 (identifier: Q9BXN2-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.
     165-178: GFIVKQVSSQPDNS → VSVDFCYDYLWCVS
     179-247: Missing.

Show »
Length:132
Mass (Da):14,787
Checksum:i997EEE918BC63102
GO
Isoform 7 (identifier: Q9BXN2-7) [UniParc]FASTAAdd to Basket

Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.
     165-189: GFIVKQVSSQPDNSFWIGLSRPQTE → ISDQNHSYPRKPISKLCMDSRVSHL
     190-247: Missing.

Show »
Length:143
Mass (Da):16,000
Checksum:i3BD7AE116DDB4305
GO
Isoform 8 (identifier: Q9BXN2-8) [UniParc]FASTAAdd to Basket

Also known as: F

The sequence of this isoform differs from the canonical sequence as follows:
     36-45: SCAASPPWRL → IYSKTSVFPT
     46-247: Missing.

Show »
Length:45
Mass (Da):5,164
Checksum:iED83111E8DE75169
GO
Isoform 9 (identifier: Q9BXN2-9) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-77: IWRSNSGSN → GFKAVEFKG
     78-247: Missing.

Note: No experimental confirmation available.

Show »
Length:77
Mass (Da):8,363
Checksum:i488D685E42698CCB
GO
Isoform 10 (identifier: Q9BXN2-10) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-116: AIWRSNSGSN...TKAVKTTGVL → GTGQFLKDLS...RTTVNPHNHL
     117-247: Missing.

Show »
Length:116
Mass (Da):13,138
Checksum:i8DE1C6BF8C69B3A9
GO

Polymorphismi

A stop polymorphism at position 238 may be associated with invasive aspergillosis following hematopoietic stem cell transplantation. The risk is highest when the polymorphism is present in both donors and recipients [MIMi:614079].

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti223 – 2231I → S.
Corresponds to variant rs16910527 [ dbSNP | Ensembl ].
VAR_050111

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei36 – 11479Missing in isoform 5. VSP_022048Add
BLAST
Alternative sequencei36 – 4510SCAASPPWRL → IYSKTSVFPT in isoform 8. VSP_022049
Alternative sequencei46 – 247202Missing in isoform 8. VSP_022050Add
BLAST
Alternative sequencei68 – 11649AIWRS…TTGVL → GTGQFLKDLSFLNNRRKLFG DPIQEATHWRMATFYQEIKR TTVNPHNHL in isoform 10. VSP_047589Add
BLAST
Alternative sequencei68 – 11346Missing in isoform 2, isoform 6 and isoform 7. VSP_022051Add
BLAST
Alternative sequencei69 – 779IWRSNSGSN → GFKAVEFKG in isoform 9. VSP_043298
Alternative sequencei78 – 247170Missing in isoform 9. VSP_043299Add
BLAST
Alternative sequencei117 – 247131Missing in isoform 10. VSP_047590Add
BLAST
Alternative sequencei165 – 19632GFIVK…WLWED → SLTLLPKLECSEAATSQAQV ILPPQLPE in isoform 4. VSP_022052Add
BLAST
Alternative sequencei165 – 18925GFIVK…RPQTE → ISDQNHSYPRKPISKLCMDS RVSHL in isoform 3 and isoform 7. VSP_022053Add
BLAST
Alternative sequencei165 – 17814GFIVK…QPDNS → VSVDFCYDYLWCVS in isoform 6. VSP_022054Add
BLAST
Alternative sequencei179 – 24769Missing in isoform 6. VSP_022055Add
BLAST
Alternative sequencei190 – 24758Missing in isoform 3 and isoform 7. VSP_022056Add
BLAST
Alternative sequencei197 – 24751Missing in isoform 4. VSP_022057Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti31 – 311V → I in AAL11714. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY026769 mRNA. Translation: AAK20114.2.
AY026770 mRNA. Translation: AAK20115.1.
AY026771 mRNA. Translation: AAK20116.1.
AF313468 mRNA. Translation: AAK37473.1.
AF313469 mRNA. Translation: AAK37474.1.
AF400595 mRNA. Translation: AAL11711.1.
AF400596 mRNA. Translation: AAL11712.1.
AF400597 mRNA. Translation: AAL11713.1.
AF400598 mRNA. Translation: AAL11714.1.
AF400599 mRNA. Translation: AAL11715.1.
AF400600 mRNA. Translation: AAL11716.1.
AF400601 mRNA. Translation: AAL11717.1.
AF400602 mRNA. Translation: AAL11718.1.
AJ312372 mRNA. Translation: CAC43846.1.
AJ312373 mRNA. Translation: CAC43847.1.
AY009090 mRNA. Translation: AAG33923.2.
AY359002 mRNA. Translation: AAQ89361.1.
AK297028 mRNA. Translation: BAH12480.1.
AK298679 mRNA. Translation: BAH12845.1.
AK298724 mRNA. Translation: BAH12855.1.
AK313247 mRNA. Translation: BAG36058.1.
AC024224 Genomic DNA. No translation available.
CH471094 Genomic DNA. Translation: EAW96144.1.
CH471094 Genomic DNA. Translation: EAW96145.1.
CH471094 Genomic DNA. Translation: EAW96146.1.
CH471094 Genomic DNA. Translation: EAW96150.1.
CH471094 Genomic DNA. Translation: EAW96154.1.
BC013385 mRNA. Translation: AAH13385.1.
BC071746 mRNA. Translation: AAH71746.1.
BC093829 mRNA. Translation: AAH93829.1.
BC093831 mRNA. Translation: AAH93831.1.
CCDSiCCDS41753.1. [Q9BXN2-1]
CCDS41754.1. [Q9BXN2-3]
CCDS53744.1. [Q9BXN2-7]
CCDS8613.1. [Q9BXN2-2]
CCDS8614.1. [Q9BXN2-5]
CCDS8617.1. [Q9BXN2-9]
RefSeqiNP_072092.2. NM_022570.4. [Q9BXN2-2]
NP_922938.1. NM_197947.2. [Q9BXN2-1]
NP_922939.1. NM_197948.2. [Q9BXN2-3]
NP_922940.1. NM_197949.2. [Q9BXN2-7]
NP_922941.1. NM_197950.2. [Q9BXN2-5]
NP_922945.1. NM_197954.2. [Q9BXN2-9]
XP_005253524.1. XM_005253467.2. [Q9BXN2-1]
XP_005253525.1. XM_005253468.1. [Q9BXN2-10]
XP_006719198.1. XM_006719135.1. [Q9BXN2-4]
XP_006719199.1. XM_006719136.1. [Q9BXN2-10]
UniGeneiHs.143929.

Genome annotation databases

EnsembliENST00000298523; ENSP00000298523; ENSG00000172243. [Q9BXN2-7]
ENST00000304084; ENSP00000302569; ENSG00000172243. [Q9BXN2-1]
ENST00000310002; ENSP00000312089; ENSG00000172243. [Q9BXN2-9]
ENST00000349926; ENSP00000344723; ENSG00000172243. [Q9BXN2-8]
ENST00000353231; ENSP00000266456; ENSG00000172243. [Q9BXN2-2]
ENST00000396484; ENSP00000379743; ENSG00000172243. [Q9BXN2-5]
ENST00000465100; ENSP00000436923; ENSG00000172243. [Q9BXN2-10]
ENST00000529761; ENSP00000432876; ENSG00000172243. [Q9BXN2-1]
ENST00000531192; ENSP00000434392; ENSG00000172243. [Q9BXN2-4]
ENST00000533022; ENSP00000431461; ENSG00000172243. [Q9BXN2-3]
GeneIDi64581.
KEGGihsa:64581.
UCSCiuc001qxf.2. human. [Q9BXN2-2]
uc001qxg.2. human. [Q9BXN2-1]
uc001qxh.2. human. [Q9BXN2-7]
uc001qxi.2. human. [Q9BXN2-3]
uc001qxj.2. human. [Q9BXN2-5]
uc001qxn.3. human. [Q9BXN2-9]
uc021quz.1. human. [Q9BXN2-6]

Polymorphism databases

DMDMi74752433.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY026769 mRNA. Translation: AAK20114.2 .
AY026770 mRNA. Translation: AAK20115.1 .
AY026771 mRNA. Translation: AAK20116.1 .
AF313468 mRNA. Translation: AAK37473.1 .
AF313469 mRNA. Translation: AAK37474.1 .
AF400595 mRNA. Translation: AAL11711.1 .
AF400596 mRNA. Translation: AAL11712.1 .
AF400597 mRNA. Translation: AAL11713.1 .
AF400598 mRNA. Translation: AAL11714.1 .
AF400599 mRNA. Translation: AAL11715.1 .
AF400600 mRNA. Translation: AAL11716.1 .
AF400601 mRNA. Translation: AAL11717.1 .
AF400602 mRNA. Translation: AAL11718.1 .
AJ312372 mRNA. Translation: CAC43846.1 .
AJ312373 mRNA. Translation: CAC43847.1 .
AY009090 mRNA. Translation: AAG33923.2 .
AY359002 mRNA. Translation: AAQ89361.1 .
AK297028 mRNA. Translation: BAH12480.1 .
AK298679 mRNA. Translation: BAH12845.1 .
AK298724 mRNA. Translation: BAH12855.1 .
AK313247 mRNA. Translation: BAG36058.1 .
AC024224 Genomic DNA. No translation available.
CH471094 Genomic DNA. Translation: EAW96144.1 .
CH471094 Genomic DNA. Translation: EAW96145.1 .
CH471094 Genomic DNA. Translation: EAW96146.1 .
CH471094 Genomic DNA. Translation: EAW96150.1 .
CH471094 Genomic DNA. Translation: EAW96154.1 .
BC013385 mRNA. Translation: AAH13385.1 .
BC071746 mRNA. Translation: AAH71746.1 .
BC093829 mRNA. Translation: AAH93829.1 .
BC093831 mRNA. Translation: AAH93831.1 .
CCDSi CCDS41753.1. [Q9BXN2-1 ]
CCDS41754.1. [Q9BXN2-3 ]
CCDS53744.1. [Q9BXN2-7 ]
CCDS8613.1. [Q9BXN2-2 ]
CCDS8614.1. [Q9BXN2-5 ]
CCDS8617.1. [Q9BXN2-9 ]
RefSeqi NP_072092.2. NM_022570.4. [Q9BXN2-2 ]
NP_922938.1. NM_197947.2. [Q9BXN2-1 ]
NP_922939.1. NM_197948.2. [Q9BXN2-3 ]
NP_922940.1. NM_197949.2. [Q9BXN2-7 ]
NP_922941.1. NM_197950.2. [Q9BXN2-5 ]
NP_922945.1. NM_197954.2. [Q9BXN2-9 ]
XP_005253524.1. XM_005253467.2. [Q9BXN2-1 ]
XP_005253525.1. XM_005253468.1. [Q9BXN2-10 ]
XP_006719198.1. XM_006719135.1. [Q9BXN2-4 ]
XP_006719199.1. XM_006719136.1. [Q9BXN2-10 ]
UniGenei Hs.143929.

3D structure databases

ProteinModelPortali Q9BXN2.
SMRi Q9BXN2. Positions 120-245.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122206. 6 interactions.
IntActi Q9BXN2. 5 interactions.

Chemistry

ChEMBLi CHEMBL2034810.

PTM databases

PhosphoSitei Q9BXN2.

Polymorphism databases

DMDMi 74752433.

Proteomic databases

PaxDbi Q9BXN2.
PRIDEi Q9BXN2.

Protocols and materials databases

DNASUi 64581.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000298523 ; ENSP00000298523 ; ENSG00000172243 . [Q9BXN2-7 ]
ENST00000304084 ; ENSP00000302569 ; ENSG00000172243 . [Q9BXN2-1 ]
ENST00000310002 ; ENSP00000312089 ; ENSG00000172243 . [Q9BXN2-9 ]
ENST00000349926 ; ENSP00000344723 ; ENSG00000172243 . [Q9BXN2-8 ]
ENST00000353231 ; ENSP00000266456 ; ENSG00000172243 . [Q9BXN2-2 ]
ENST00000396484 ; ENSP00000379743 ; ENSG00000172243 . [Q9BXN2-5 ]
ENST00000465100 ; ENSP00000436923 ; ENSG00000172243 . [Q9BXN2-10 ]
ENST00000529761 ; ENSP00000432876 ; ENSG00000172243 . [Q9BXN2-1 ]
ENST00000531192 ; ENSP00000434392 ; ENSG00000172243 . [Q9BXN2-4 ]
ENST00000533022 ; ENSP00000431461 ; ENSG00000172243 . [Q9BXN2-3 ]
GeneIDi 64581.
KEGGi hsa:64581.
UCSCi uc001qxf.2. human. [Q9BXN2-2 ]
uc001qxg.2. human. [Q9BXN2-1 ]
uc001qxh.2. human. [Q9BXN2-7 ]
uc001qxi.2. human. [Q9BXN2-3 ]
uc001qxj.2. human. [Q9BXN2-5 ]
uc001qxn.3. human. [Q9BXN2-9 ]
uc021quz.1. human. [Q9BXN2-6 ]

Organism-specific databases

CTDi 64581.
GeneCardsi GC12M010269.
H-InvDB HIX0010422.
HGNCi HGNC:14558. CLEC7A.
HPAi HPA043244.
MIMi 606264. gene.
613108. phenotype.
614079. phenotype.
neXtProti NX_Q9BXN2.
Orphaneti 1334. Chronic mucocutaneous candidiasis.
PharmGKBi PA26581.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG327853.
HOGENOMi HOG000151249.
HOVERGENi HBG105854.
InParanoidi Q9BXN2.
KOi K10074.
OMAi TEGPWLW.
OrthoDBi EOG747PJT.
PhylomeDBi Q9BXN2.
TreeFami TF336674.

Miscellaneous databases

GeneWikii CLEC7A.
GenomeRNAii 64581.
NextBioi 66517.
PROi Q9BXN2.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9BXN2.
Bgeei Q9BXN2.
Genevestigatori Q9BXN2.

Family and domain databases

Gene3Di 3.10.100.10. 1 hit.
InterProi IPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR016187. C-type_lectin_fold.
[Graphical view ]
Pfami PF00059. Lectin_C. 1 hit.
[Graphical view ]
SMARTi SM00034. CLECT. 1 hit.
[Graphical view ]
SUPFAMi SSF56436. SSF56436. 1 hit.
PROSITEi PS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "A novel cluster of lectin-like receptor genes expressed in monocytic, dendritic and endothelial cells maps close to the NK receptor genes in the human NK gene complex."
    Sobanov Y., Bernreiter A., Derdak S., Mechtcheriakova D., Schweighofer B., Duechler M., Kalthoff F., Hofer E.
    Eur. J. Immunol. 31:3493-3503(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  2. "Identification of a human homologue of the dendritic cell-associated C-type lectin-1, dectin-1."
    Yokota K., Takashima A., Bergstresser P.R., Ariizumi K.
    Gene 272:51-60(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
    Tissue: Peripheral blood leukocyte.
  3. "Cloning of human DECTIN-1, a novel C-type lectin-like receptor gene expressed on dendritic cells."
    Hermanz-Falcon P., Arce I., Roda-Navarro P., Fernandez-Ruiz E.
    Immunogenetics 53:288-295(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 7), TISSUE SPECIFICITY.
    Tissue: Peripheral blood leukocyte.
  4. "Characterization of the human beta-glucan receptor and its alternatively spliced isoforms."
    Willment J.A., Gordon S., Brown G.D.
    J. Biol. Chem. 276:43818-43823(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 7; 8 AND 10), FUNCTION, TISSUE SPECIFICITY.
    Tissue: Peripheral blood leukocyte.
  5. "Molecular and functional characterization of human Dectin-1."
    Gruenebach F., Weck M.M., Reichert J., Brossart P.
    Exp. Hematol. 30:1309-1315(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INDUCTION, TISSUE SPECIFICITY.
    Tissue: Dendritic cell.
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 5 AND 7).
    Tissue: Umbilical cord blood.
  8. "The finished DNA sequence of human chromosome 12."
    Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
    , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
    Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 6 AND 9).
    Tissue: Colon, Lung and Urinary bladder.
  11. "Human Dectin-1 isoform E is a cytoplasmic protein and interacts with RanBPM."
    Xie J., Sun M., Guo L., Liu W., Jiang J., Chen X., Zhou L., Gu J.
    Biochem. Biophys. Res. Commun. 347:1067-1073(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: INTERACTION WITH RANBP9, SUBCELLULAR LOCATION.
  12. Cited for: FUNCTION, SUBCELLULAR LOCATION.
  13. Cited for: INVOLVEMENT IN CANDF4.
  14. "Dectin-1 Y238X polymorphism associates with susceptibility to invasive aspergillosis in hematopoietic transplantation through impairment of both recipient- and donor-dependent mechanisms of antifungal immunity."
    Cunha C., Di Ianni M., Bozza S., Giovannini G., Zagarella S., Zelante T., D'Angelo C., Pierini A., Pitzurra L., Falzetti F., Carotti A., Perruccio K., Latge J.P., Rodrigues F., Velardi A., Aversa F., Romani L., Carvalho A.
    Blood 116:5394-5402(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: POLYMORPHISM.

Entry informationi

Entry nameiCLC7A_HUMAN
AccessioniPrimary (citable) accession number: Q9BXN2
Secondary accession number(s): B2R861
, B7Z494, B7Z5A9, B7Z5B9, Q6IPS7, Q96D32, Q96DR9, Q96LD3, Q96PA4, Q96PA5, Q96PA6, Q96PA7, Q96PA8, Q9H1K3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: June 1, 2001
Last modified: July 9, 2014
This is version 111 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi