Q9BXN2 (CLC7A_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 98.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: C-type lectin domain family 7 member A Alternative name(s): Beta-glucan receptor C-type lectin superfamily member 12 Dendritic cell-associated C-type lectin 1 Short name=DC-associated C-type lectin 1 Short name=Dectin-1 | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 247 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation By similarity. Ref.4 Ref.5 Ref.12 |
| Subunit structure | Homodimer By similarity. Interacts with SYK; participates in leukocyte activation in presence of fungal pathogens By similarity. Isoform 5 interacts with RANBP9. Ref.11 |
| Subcellular location | Cell membrane; Single-pass type II membrane protein Ref.1 Ref.11 Ref.12. Isoform 5: Cytoplasm Ref.1 Ref.11 Ref.12. |
| Tissue specificity | Highly expressed in peripheral blood leukocytes and dendritic cells. Detected in spleen, bone marrow, lung, muscle, stomach and placenta. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 |
| Induction | Up-regulated during differentiation from monocytes into dendritic cells. Ref.5 |
| Post-translational modification | Phosphorylated on tyrosine residues in response to glucan binding By similarity. |
| Polymorphism | A stop polymorphism at position 238 may be associated with invasive aspergillosis following hematopoietic stem cell transplantation. The risk is highest when the polymorphism is present in both donors and recipients [MIM:614079]. |
| Involvement in disease | Familial candidiasis 4 (CANDF4) [MIM:613108]: A primary immunodeficiency disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans. |
| Sequence similarities | Contains 1 C-type lectin domain. |
Ontologies
Alternative products
| This entry describes 9 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BXN2-1) Also known as: A; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BXN2-2) Also known as: Beta; B; The sequence of this isoform differs from the canonical sequence as follows: 68-113: Missing. | ||||||
| Note: Predominant isoform. | ||||||
| Isoform 3 (identifier: Q9BXN2-3) Also known as: C; The sequence of this isoform differs from the canonical sequence as follows: 165-189: GFIVKQVSSQPDNSFWIGLSRPQTE → ISDQNHSYPRKPISKLCMDSRVSHL 190-247: Missing. | ||||||
| Isoform 4 (identifier: Q9BXN2-4) Also known as: G; The sequence of this isoform differs from the canonical sequence as follows: 165-196: GFIVKQVSSQPDNSFWIGLSRPQTEVPWLWED → SLTLLPKLECSEAATSQAQVILPPQLPE 197-247: Missing. | ||||||
| Isoform 5 (identifier: Q9BXN2-5) Also known as: E; The sequence of this isoform differs from the canonical sequence as follows: 36-114: Missing. | ||||||
| Isoform 6 (identifier: Q9BXN2-6) The sequence of this isoform differs from the canonical sequence as follows: 68-113: Missing. 165-178: GFIVKQVSSQPDNS → VSVDFCYDYLWCVS 179-247: Missing. | ||||||
| Isoform 7 (identifier: Q9BXN2-7) Also known as: D; The sequence of this isoform differs from the canonical sequence as follows: 68-113: Missing. 165-189: GFIVKQVSSQPDNSFWIGLSRPQTE → ISDQNHSYPRKPISKLCMDSRVSHL 190-247: Missing. | ||||||
| Isoform 8 (identifier: Q9BXN2-8) Also known as: F; The sequence of this isoform differs from the canonical sequence as follows: 36-45: SCAASPPWRL → IYSKTSVFPT 46-247: Missing. | ||||||
| Isoform 9 (identifier: Q9BXN2-9) The sequence of this isoform differs from the canonical sequence as follows: 69-77: IWRSNSGSN → GFKAVEFKG 78-247: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 247 | 247 | C-type lectin domain family 7 member A | PRO_0000269491 | |||||||
Regions | |||||||||||
| Topological domain | 1 – 44 | 44 | Cytoplasmic Potential | ||||||||
| Transmembrane | 45 – 65 | 21 | Helical; Signal-anchor for type II membrane protein; Potential | ||||||||
| Topological domain | 66 – 247 | 182 | Extracellular Potential | ||||||||
| Domain | 127 – 242 | 116 | C-type lectin | ||||||||
| Motif | 15 – 18 | 4 | ITAM-like | ||||||||
Sites | |||||||||||
| Metal binding | 157 | 1 | Divalent metal cation By similarity | ||||||||
| Metal binding | 159 | 1 | Divalent metal cation By similarity | ||||||||
| Metal binding | 163 | 1 | Divalent metal cation By similarity | ||||||||
| Metal binding | 242 | 1 | Divalent metal cation By similarity | ||||||||
Amino acid modifications | |||||||||||
| Glycosylation | 91 | 1 | N-linked (GlcNAc...) Potential | ||||||||
| Disulfide bond | 120 ↔ 131 | By similarity | |||||||||
| Disulfide bond | 148 ↔ 241 | By similarity | |||||||||
| Disulfide bond | 220 ↔ 233 | By similarity | |||||||||
Natural variations | |||||||||||
| Alternative sequence | 36 – 114 | 79 | Missing in isoform 5. | VSP_022048 | |||||||
| Alternative sequence | 36 – 45 | 10 | SCAASPPWRL → IYSKTSVFPT in isoform 8. | VSP_022049 | |||||||
| Alternative sequence | 46 – 247 | 202 | Missing in isoform 8. | VSP_022050 | |||||||
| Alternative sequence | 68 – 113 | 46 | Missing in isoform 2, isoform 6 and isoform 7. | VSP_022051 | |||||||
| Alternative sequence | 69 – 77 | 9 | IWRSNSGSN → GFKAVEFKG in isoform 9. | VSP_043298 | |||||||
| Alternative sequence | 78 – 247 | 170 | Missing in isoform 9. | VSP_043299 | |||||||
| Alternative sequence | 165 – 196 | 32 | GFIVK…WLWED → SLTLLPKLECSEAATSQAQV ILPPQLPE in isoform 4. | VSP_022052 | |||||||
| Alternative sequence | 165 – 189 | 25 | GFIVK…RPQTE → ISDQNHSYPRKPISKLCMDS RVSHL in isoform 3 and isoform 7. | VSP_022053 | |||||||
| Alternative sequence | 165 – 178 | 14 | GFIVK…QPDNS → VSVDFCYDYLWCVS in isoform 6. | VSP_022054 | |||||||
| Alternative sequence | 179 – 247 | 69 | Missing in isoform 6. | VSP_022055 | |||||||
| Alternative sequence | 190 – 247 | 58 | Missing in isoform 3 and isoform 7. | VSP_022056 | |||||||
| Alternative sequence | 197 – 247 | 51 | Missing in isoform 4. | VSP_022057 | |||||||
| Natural variant | 223 | 1 | I → S. Corresponds to variant rs16910527 [ dbSNP | Ensembl ]. | VAR_050111 | |||||||
Experimental info | |||||||||||
| Sequence conflict | 31 | 1 | V → I in AAL11714. Ref.4 | ||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel cluster of lectin-like receptor genes expressed in monocytic, dendritic and endothelial cells maps close to the NK receptor genes in the human NK gene complex." Sobanov Y., Bernreiter A., Derdak S., Mechtcheriakova D., Schweighofer B., Duechler M., Kalthoff F., Hofer E. Eur. J. Immunol. 31:3493-3503(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [2] | "Identification of a human homologue of the dendritic cell-associated C-type lectin-1, dectin-1." Yokota K., Takashima A., Bergstresser P.R., Ariizumi K. Gene 272:51-60(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY. Tissue: Peripheral blood leukocyte. |
| [3] | "Cloning of human DECTIN-1, a novel C-type lectin-like receptor gene expressed on dendritic cells." Hermanz-Falcon P., Arce I., Roda-Navarro P., Fernandez-Ruiz E. Immunogenetics 53:288-295(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 7), TISSUE SPECIFICITY. Tissue: Peripheral blood leukocyte. |
| [4] | "Characterization of the human beta-glucan receptor and its alternatively spliced isoforms." Willment J.A., Gordon S., Brown G.D. J. Biol. Chem. 276:43818-43823(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 7 AND 8), FUNCTION, TISSUE SPECIFICITY. Tissue: Peripheral blood leukocyte. |
| [5] | "Molecular and functional characterization of human Dectin-1." Gruenebach F., Weck M.M., Reichert J., Brossart P. Exp. Hematol. 30:1309-1315(2002) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INDUCTION, TISSUE SPECIFICITY. Tissue: Dendritic cell. |
| [6] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [7] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 5 AND 7). Tissue: Umbilical cord blood. |
| [8] | "The finished DNA sequence of human chromosome 12." Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. Gibbs R.A.Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 6 AND 9). Tissue: Colon, Lung and Urinary bladder. |
| [11] | "Human Dectin-1 isoform E is a cytoplasmic protein and interacts with RanBPM." Xie J., Sun M., Guo L., Liu W., Jiang J., Chen X., Zhou L., Gu J. Biochem. Biophys. Res. Commun. 347:1067-1073(2006) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH RANBP9, SUBCELLULAR LOCATION. |
| [12] | "Dectin-1 promotes fungicidal activity of human neutrophils." Kennedy A.D., Willment J.A., Dorward D.W., Williams D.L., Brown G.D., DeLeo F.R. Eur. J. Immunol. 37:467-478(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION. |
| [13] | "Human dectin-1 deficiency and mucocutaneous fungal infections." Ferwerda B., Ferwerda G., Plantinga T.S., Willment J.A., van Spriel A.B., Venselaar H., Elbers C.C., Johnson M.D., Cambi A., Huysamen C., Jacobs L., Jansen T., Verheijen K., Masthoff L., Morre S.A., Vriend G., Williams D.L., Perfect J.R. Netea M.G.N. Engl. J. Med. 361:1760-1767(2009) [PubMed] [Europe PMC] [Abstract] Cited for: INVOLVEMENT IN CANDF4. |
| [14] | "Dectin-1 Y238X polymorphism associates with susceptibility to invasive aspergillosis in hematopoietic transplantation through impairment of both recipient- and donor-dependent mechanisms of antifungal immunity." Cunha C., Di Ianni M., Bozza S., Giovannini G., Zagarella S., Zelante T., D'Angelo C., Pierini A., Pitzurra L., Falzetti F., Carotti A., Perruccio K., Latge J.P., Rodrigues F., Velardi A., Aversa F., Romani L., Carvalho A. Blood 116:5394-5402(2010) [PubMed] [Europe PMC] [Abstract] Cited for: POLYMORPHISM. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AY026769 mRNA. Translation: AAK20114.2. AY026770 mRNA. Translation: AAK20115.1. AY026771 mRNA. Translation: AAK20116.1. AF313468 mRNA. Translation: AAK37473.1. AF313469 mRNA. Translation: AAK37474.1. AF400595 mRNA. Translation: AAL11711.1. AF400596 mRNA. Translation: AAL11712.1. AF400597 mRNA. Translation: AAL11713.1. AF400598 mRNA. Translation: AAL11714.1. AF400599 mRNA. Translation: AAL11715.1. AF400600 mRNA. Translation: AAL11716.1. AF400601 mRNA. Translation: AAL11717.1. AJ312372 mRNA. Translation: CAC43846.1. AJ312373 mRNA. Translation: CAC43847.1. AY009090 mRNA. Translation: AAG33923.2. AY359002 mRNA. Translation: AAQ89361.1. AK297028 mRNA. Translation: BAH12480.1. AK298679 mRNA. Translation: BAH12845.1. AK298724 mRNA. Translation: BAH12855.1. AK313247 mRNA. Translation: BAG36058.1. AC024224 Genomic DNA. No translation available. CH471094 Genomic DNA. Translation: EAW96144.1. CH471094 Genomic DNA. Translation: EAW96145.1. CH471094 Genomic DNA. Translation: EAW96146.1. CH471094 Genomic DNA. Translation: EAW96150.1. BC013385 mRNA. Translation: AAH13385.1. BC071746 mRNA. Translation: AAH71746.1. BC093829 mRNA. Translation: AAH93829.1. BC093831 mRNA. Translation: AAH93831.1. |
| IPI | IPI00021735. IPI00044331. IPI00044332. IPI00060623. IPI00155858. IPI00170475. IPI00186897. IPI00411381. IPI00815987. |
| RefSeq | NP_072092.2. NM_022570.4. NP_922938.1. NM_197947.2. NP_922939.1. NM_197948.2. NP_922940.1. NM_197949.2. NP_922941.1. NM_197950.2. NP_922945.1. NM_197954.2. |
| UniGene | Hs.143929. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1KCG based on UniProtKB P26718. |
| ProteinModelPortal | Q9BXN2. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9BXN2. 3 interactions. |
PTM databases | |
| PhosphoSite | Q9BXN2. |
Polymorphism databases | |
| DMDM | 74752433. |
Proteomic databases | |
| PaxDb | Q9BXN2. |
| PRIDE | Q9BXN2. |
Protocols and materials databases | |
| DNASU | 64581. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000298523; ENSP00000298523; ENSG00000172243. ENST00000304084; ENSP00000302569; ENSG00000172243. ENST00000310002; ENSP00000312089; ENSG00000172243. ENST00000349926; ENSP00000344723; ENSG00000172243. ENST00000353231; ENSP00000266456; ENSG00000172243. ENST00000396484; ENSP00000379743; ENSG00000172243. ENST00000529761; ENSP00000432876; ENSG00000172243. ENST00000531192; ENSP00000434392; ENSG00000172243. ENST00000533022; ENSP00000431461; ENSG00000172243. |
| GeneID | 64581. |
| KEGG | hsa:64581. |
| UCSC | uc001qxf.2. human. uc001qxg.2. human. uc001qxh.2. human. uc001qxi.2. human. uc001qxj.2. human. uc021quz.1. human. |
Organism-specific databases | |
| CTD | 64581. |
| GeneCards | GC12M010269. |
| H-InvDB | HIX0010422. |
| HGNC | HGNC:14558. CLEC7A. |
| HPA | HPA043244. |
| MIM | 606264. gene. 613108. phenotype. 614079. phenotype. |
| neXtProt | NX_Q9BXN2. |
| Orphanet | 1334. Chronic mucocutaneous candidiasis. |
| PharmGKB | PA26581. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG327853. |
| HOGENOM | HOG000151249. |
| HOVERGEN | HBG105854. |
| InParanoid | Q9BXN2. |
| KO | K10074. |
| OMA | QPDNSFW. |
Gene expression databases | |
| ArrayExpress | Q9BXN2. |
| Bgee | Q9BXN2. |
| Genevestigator | Q9BXN2. |
Family and domain databases | |
| Gene3D | 3.10.100.10. 1 hit. |
| InterPro | IPR001304. C-type_lectin. IPR016186. C-type_lectin-like. IPR016187. C-type_lectin_fold. [Graphical view] |
| Pfam | PF00059. Lectin_C. 1 hit. [Graphical view] |
| SMART | SM00034. CLECT. 1 hit. [Graphical view] |
| SUPFAM | SSF56436. C-type_lectin_fold. 1 hit. |
| PROSITE | PS00615. C_TYPE_LECTIN_1. False negative. PS50041. C_TYPE_LECTIN_2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 64581. |
| NextBio | 66517. |
| SOURCE | Search... |
Entry information
| Entry name | CLC7A_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BXN2 Secondary accession number(s): B2R861 Q9H1K3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
