Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BXN2 (CLC7A_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 108. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
C-type lectin domain family 7 member A
Alternative name(s):
Beta-glucan receptor
C-type lectin superfamily member 12
Dendritic cell-associated C-type lectin 1
Short name=DC-associated C-type lectin 1
Short name=Dectin-1
Gene names
Name:CLEC7A
Synonyms:BGR, CLECSF12, DECTIN1
ORF Names:UNQ539/PRO1082
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length247 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation By similarity. Ref.4 Ref.5 Ref.12

Subunit structure

Homodimer By similarity. Interacts with SYK; participates in leukocyte activation in presence of fungal pathogens By similarity. Isoform 5 interacts with RANBP9. Ref.11

Subcellular location

Cell membrane; Single-pass type II membrane protein Ref.1 Ref.11 Ref.12.

Isoform 5: Cytoplasm Ref.1 Ref.11 Ref.12.

Isoform 6: Cytoplasm Probable Ref.1 Ref.11 Ref.12.

Isoform 7: Cytoplasm Probable Ref.1 Ref.11 Ref.12.

Tissue specificity

Highly expressed in peripheral blood leukocytes and dendritic cells. Detected in spleen, bone marrow, lung, muscle, stomach and placenta. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5

Induction

Up-regulated during differentiation from monocytes into dendritic cells. Ref.5

Post-translational modification

Phosphorylated on tyrosine residues in response to glucan binding By similarity.

Polymorphism

A stop polymorphism at position 238 may be associated with invasive aspergillosis following hematopoietic stem cell transplantation. The risk is highest when the polymorphism is present in both donors and recipients [MIM:614079].

Involvement in disease

Candidiasis, familial, 4 (CANDF4) [MIM:613108]: A primary immunodeficiency disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans.
Note: The disease may be caused by mutations affecting the gene represented in this entry. Ref.13

Sequence similarities

Contains 1 C-type lectin domain.

Ontologies

Keywords
   Biological processImmunity
Inflammatory response
Innate immunity
   Cellular componentCell membrane
Cytoplasm
Membrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainSignal-anchor
Transmembrane
Transmembrane helix
   LigandLectin
Metal-binding
   Molecular functionReceptor
   PTMDisulfide bond
Glycoprotein
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processT cell activation

Traceable author statement Ref.4. Source: UniProtKB

carbohydrate mediated signaling

Traceable author statement Ref.4. Source: UniProtKB

cell recognition

Inferred from direct assay Ref.4. Source: UniProtKB

cell surface pattern recognition receptor signaling pathway

Inferred from electronic annotation. Source: Ensembl

cell-cell adhesion

Inferred from electronic annotation. Source: Ensembl

cellular response to molecule of fungal origin

Inferred from electronic annotation. Source: Ensembl

defense response to protozoan

Non-traceable author statement Ref.4. Source: UniProtKB

detection of yeast

Inferred from electronic annotation. Source: Ensembl

inflammatory response

Inferred from electronic annotation. Source: UniProtKB-KW

innate immune response

Inferred from electronic annotation. Source: UniProtKB-KW

leukocyte activation involved in immune response

Inferred from electronic annotation. Source: Ensembl

phagocytosis, engulfment

Inferred from electronic annotation. Source: Ensembl

phagocytosis, recognition

Inferred from direct assay Ref.4. Source: UniProtKB

positive regulation of phagocytosis

Inferred from electronic annotation. Source: Ensembl

positive regulation of tumor necrosis factor production

Inferred from electronic annotation. Source: Ensembl

   Cellular_componentcytoplasm

Inferred from electronic annotation. Source: UniProtKB-SubCell

external side of plasma membrane

Inferred from electronic annotation. Source: Ensembl

integral component of membrane

Traceable author statement Ref.4. Source: UniProtKB

   Molecular_function(1->3)-beta-D-glucan binding

Inferred from electronic annotation. Source: Ensembl

(1->3)-beta-D-glucan receptor activity

Inferred from electronic annotation. Source: Ensembl

MHC protein binding

Non-traceable author statement Ref.4. Source: UniProtKB

carbohydrate binding

Inferred from direct assay Ref.4. Source: UniProtKB

metal ion binding

Inferred from electronic annotation. Source: UniProtKB-KW

signaling pattern recognition receptor activity

Inferred from direct assay Ref.4. Source: UniProtKB

Complete GO annotation...

Alternative products

This entry describes 10 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BXN2-1)

Also known as: A;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9BXN2-2)

Also known as: Beta; B;

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.
Note: Predominant isoform.
Isoform 3 (identifier: Q9BXN2-3)

Also known as: C;

The sequence of this isoform differs from the canonical sequence as follows:
     165-189: GFIVKQVSSQPDNSFWIGLSRPQTE → ISDQNHSYPRKPISKLCMDSRVSHL
     190-247: Missing.
Isoform 4 (identifier: Q9BXN2-4)

Also known as: G;

The sequence of this isoform differs from the canonical sequence as follows:
     165-196: GFIVKQVSSQPDNSFWIGLSRPQTEVPWLWED → SLTLLPKLECSEAATSQAQVILPPQLPE
     197-247: Missing.
Isoform 5 (identifier: Q9BXN2-5)

Also known as: E;

The sequence of this isoform differs from the canonical sequence as follows:
     36-114: Missing.
Isoform 6 (identifier: Q9BXN2-6)

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.
     165-178: GFIVKQVSSQPDNS → VSVDFCYDYLWCVS
     179-247: Missing.
Isoform 7 (identifier: Q9BXN2-7)

Also known as: D;

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.
     165-189: GFIVKQVSSQPDNSFWIGLSRPQTE → ISDQNHSYPRKPISKLCMDSRVSHL
     190-247: Missing.
Isoform 8 (identifier: Q9BXN2-8)

Also known as: F;

The sequence of this isoform differs from the canonical sequence as follows:
     36-45: SCAASPPWRL → IYSKTSVFPT
     46-247: Missing.
Isoform 9 (identifier: Q9BXN2-9)

The sequence of this isoform differs from the canonical sequence as follows:
     69-77: IWRSNSGSN → GFKAVEFKG
     78-247: Missing.
Note: No experimental confirmation available.
Isoform 10 (identifier: Q9BXN2-10)

The sequence of this isoform differs from the canonical sequence as follows:
     68-116: AIWRSNSGSN...TKAVKTTGVL → GTGQFLKDLS...RTTVNPHNHL
     117-247: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 247247C-type lectin domain family 7 member A
PRO_0000269491

Regions

Topological domain1 – 4444Cytoplasmic Potential
Transmembrane45 – 6521Helical; Signal-anchor for type II membrane protein; Potential
Topological domain66 – 247182Extracellular Potential
Domain127 – 242116C-type lectin
Motif15 – 184ITAM-like

Sites

Metal binding1571Divalent metal cation By similarity
Metal binding1591Divalent metal cation By similarity
Metal binding1631Divalent metal cation By similarity
Metal binding2421Divalent metal cation By similarity

Amino acid modifications

Glycosylation911N-linked (GlcNAc...) Potential
Disulfide bond120 ↔ 131 By similarity
Disulfide bond148 ↔ 241 By similarity
Disulfide bond220 ↔ 233 By similarity

Natural variations

Alternative sequence36 – 11479Missing in isoform 5.
VSP_022048
Alternative sequence36 – 4510SCAASPPWRL → IYSKTSVFPT in isoform 8.
VSP_022049
Alternative sequence46 – 247202Missing in isoform 8.
VSP_022050
Alternative sequence68 – 11649AIWRS…TTGVL → GTGQFLKDLSFLNNRRKLFG DPIQEATHWRMATFYQEIKR TTVNPHNHL in isoform 10.
VSP_047589
Alternative sequence68 – 11346Missing in isoform 2, isoform 6 and isoform 7.
VSP_022051
Alternative sequence69 – 779IWRSNSGSN → GFKAVEFKG in isoform 9.
VSP_043298
Alternative sequence78 – 247170Missing in isoform 9.
VSP_043299
Alternative sequence117 – 247131Missing in isoform 10.
VSP_047590
Alternative sequence165 – 19632GFIVK…WLWED → SLTLLPKLECSEAATSQAQV ILPPQLPE in isoform 4.
VSP_022052
Alternative sequence165 – 18925GFIVK…RPQTE → ISDQNHSYPRKPISKLCMDS RVSHL in isoform 3 and isoform 7.
VSP_022053
Alternative sequence165 – 17814GFIVK…QPDNS → VSVDFCYDYLWCVS in isoform 6.
VSP_022054
Alternative sequence179 – 24769Missing in isoform 6.
VSP_022055
Alternative sequence190 – 24758Missing in isoform 3 and isoform 7.
VSP_022056
Alternative sequence197 – 24751Missing in isoform 4.
VSP_022057
Natural variant2231I → S.
Corresponds to variant rs16910527 [ dbSNP | Ensembl ].
VAR_050111

Experimental info

Sequence conflict311V → I in AAL11714. Ref.4

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (A) [UniParc].

Last modified June 1, 2001. Version 1.
Checksum: 98393E36976111B9

FASTA24727,627
        10         20         30         40         50         60 
MEYHPDLENL DEDGYTQLHF DSQSNTRIAV VSEKGSCAAS PPWRLIAVIL GILCLVILVI 

        70         80         90        100        110        120 
AVVLGTMAIW RSNSGSNTLE NGYFLSRNKE NHSQPTQSSL EDSVTPTKAV KTTGVLSSPC 

       130        140        150        160        170        180 
PPNWIIYEKS CYLFSMSLNS WDGSKRQCWQ LGSNLLKIDS SNELGFIVKQ VSSQPDNSFW 

       190        200        210        220        230        240 
IGLSRPQTEV PWLWEDGSTF SSNLFQIRTT ATQENPSPNC VWIHVSVIYD QLCSVPSYSI 


CEKKFSM 

« Hide

Isoform 2 (Beta) (B) [UniParc].

Checksum: C6ADEE762B2CE968
Show »

FASTA20122,563
Isoform 3 (C) [UniParc].

Checksum: F7DF9F76EA4B6B59
Show »

FASTA18921,065
Isoform 4 (G) [UniParc].

Checksum: 6F3350B1DFBEC921
Show »

FASTA19221,130
Isoform 5 (E) [UniParc].

Checksum: AFD3A88F89BBFFC6
Show »

FASTA16819,218
Isoform 6 [UniParc].

Checksum: 997EEE918BC63102
Show »

FASTA13214,787
Isoform 7 (D) [UniParc].

Checksum: 3BD7AE116DDB4305
Show »

FASTA14316,000
Isoform 8 (F) [UniParc].

Checksum: ED83111E8DE75169
Show »

FASTA455,164
Isoform 9 [UniParc].

Checksum: 488D685E42698CCB
Show »

FASTA778,363
Isoform 10 [UniParc].

Checksum: 8DE1C6BF8C69B3A9
Show »

FASTA11613,138

References

« Hide 'large scale' references
[1]"A novel cluster of lectin-like receptor genes expressed in monocytic, dendritic and endothelial cells maps close to the NK receptor genes in the human NK gene complex."
Sobanov Y., Bernreiter A., Derdak S., Mechtcheriakova D., Schweighofer B., Duechler M., Kalthoff F., Hofer E.
Eur. J. Immunol. 31:3493-3503(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[2]"Identification of a human homologue of the dendritic cell-associated C-type lectin-1, dectin-1."
Yokota K., Takashima A., Bergstresser P.R., Ariizumi K.
Gene 272:51-60(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
Tissue: Peripheral blood leukocyte.
[3]"Cloning of human DECTIN-1, a novel C-type lectin-like receptor gene expressed on dendritic cells."
Hermanz-Falcon P., Arce I., Roda-Navarro P., Fernandez-Ruiz E.
Immunogenetics 53:288-295(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 7), TISSUE SPECIFICITY.
Tissue: Peripheral blood leukocyte.
[4]"Characterization of the human beta-glucan receptor and its alternatively spliced isoforms."
Willment J.A., Gordon S., Brown G.D.
J. Biol. Chem. 276:43818-43823(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 7; 8 AND 10), FUNCTION, TISSUE SPECIFICITY.
Tissue: Peripheral blood leukocyte.
[5]"Molecular and functional characterization of human Dectin-1."
Gruenebach F., Weck M.M., Reichert J., Brossart P.
Exp. Hematol. 30:1309-1315(2002) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INDUCTION, TISSUE SPECIFICITY.
Tissue: Dendritic cell.
[6]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[7]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 5 AND 7).
Tissue: Umbilical cord blood.
[8]"The finished DNA sequence of human chromosome 12."
Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R. expand/collapse author list , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[9]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[10]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 6 AND 9).
Tissue: Colon, Lung and Urinary bladder.
[11]"Human Dectin-1 isoform E is a cytoplasmic protein and interacts with RanBPM."
Xie J., Sun M., Guo L., Liu W., Jiang J., Chen X., Zhou L., Gu J.
Biochem. Biophys. Res. Commun. 347:1067-1073(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: INTERACTION WITH RANBP9, SUBCELLULAR LOCATION.
[12]"Dectin-1 promotes fungicidal activity of human neutrophils."
Kennedy A.D., Willment J.A., Dorward D.W., Williams D.L., Brown G.D., DeLeo F.R.
Eur. J. Immunol. 37:467-478(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION.
[13]"Human dectin-1 deficiency and mucocutaneous fungal infections."
Ferwerda B., Ferwerda G., Plantinga T.S., Willment J.A., van Spriel A.B., Venselaar H., Elbers C.C., Johnson M.D., Cambi A., Huysamen C., Jacobs L., Jansen T., Verheijen K., Masthoff L., Morre S.A., Vriend G., Williams D.L., Perfect J.R. expand/collapse author list , Joosten L.A., Wijmenga C., van der Meer J.W., Adema G.J., Kullberg B.J., Brown G.D., Netea M.G.
N. Engl. J. Med. 361:1760-1767(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: INVOLVEMENT IN CANDF4.
[14]"Dectin-1 Y238X polymorphism associates with susceptibility to invasive aspergillosis in hematopoietic transplantation through impairment of both recipient- and donor-dependent mechanisms of antifungal immunity."
Cunha C., Di Ianni M., Bozza S., Giovannini G., Zagarella S., Zelante T., D'Angelo C., Pierini A., Pitzurra L., Falzetti F., Carotti A., Perruccio K., Latge J.P., Rodrigues F., Velardi A., Aversa F., Romani L., Carvalho A.
Blood 116:5394-5402(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: POLYMORPHISM.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AY026769 mRNA. Translation: AAK20114.2.
AY026770 mRNA. Translation: AAK20115.1.
AY026771 mRNA. Translation: AAK20116.1.
AF313468 mRNA. Translation: AAK37473.1.
AF313469 mRNA. Translation: AAK37474.1.
AF400595 mRNA. Translation: AAL11711.1.
AF400596 mRNA. Translation: AAL11712.1.
AF400597 mRNA. Translation: AAL11713.1.
AF400598 mRNA. Translation: AAL11714.1.
AF400599 mRNA. Translation: AAL11715.1.
AF400600 mRNA. Translation: AAL11716.1.
AF400601 mRNA. Translation: AAL11717.1.
AF400602 mRNA. Translation: AAL11718.1.
AJ312372 mRNA. Translation: CAC43846.1.
AJ312373 mRNA. Translation: CAC43847.1.
AY009090 mRNA. Translation: AAG33923.2.
AY359002 mRNA. Translation: AAQ89361.1.
AK297028 mRNA. Translation: BAH12480.1.
AK298679 mRNA. Translation: BAH12845.1.
AK298724 mRNA. Translation: BAH12855.1.
AK313247 mRNA. Translation: BAG36058.1.
AC024224 Genomic DNA. No translation available.
CH471094 Genomic DNA. Translation: EAW96144.1.
CH471094 Genomic DNA. Translation: EAW96145.1.
CH471094 Genomic DNA. Translation: EAW96146.1.
CH471094 Genomic DNA. Translation: EAW96150.1.
CH471094 Genomic DNA. Translation: EAW96154.1.
BC013385 mRNA. Translation: AAH13385.1.
BC071746 mRNA. Translation: AAH71746.1.
BC093829 mRNA. Translation: AAH93829.1.
BC093831 mRNA. Translation: AAH93831.1.
RefSeqNP_072092.2. NM_022570.4.
NP_922938.1. NM_197947.2.
NP_922939.1. NM_197948.2.
NP_922940.1. NM_197949.2.
NP_922941.1. NM_197950.2.
NP_922945.1. NM_197954.2.
XP_005253524.1. XM_005253467.2.
XP_005253525.1. XM_005253468.1.
UniGeneHs.143929.

3D structure databases

ProteinModelPortalQ9BXN2.
SMRQ9BXN2. Positions 120-245.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122206. 6 interactions.
IntActQ9BXN2. 5 interactions.

Chemistry

ChEMBLCHEMBL2034810.

PTM databases

PhosphoSiteQ9BXN2.

Polymorphism databases

DMDM74752433.

Proteomic databases

PaxDbQ9BXN2.
PRIDEQ9BXN2.

Protocols and materials databases

DNASU64581.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000298523; ENSP00000298523; ENSG00000172243. [Q9BXN2-7]
ENST00000304084; ENSP00000302569; ENSG00000172243. [Q9BXN2-1]
ENST00000310002; ENSP00000312089; ENSG00000172243. [Q9BXN2-9]
ENST00000349926; ENSP00000344723; ENSG00000172243. [Q9BXN2-8]
ENST00000353231; ENSP00000266456; ENSG00000172243. [Q9BXN2-2]
ENST00000396484; ENSP00000379743; ENSG00000172243. [Q9BXN2-5]
ENST00000465100; ENSP00000436923; ENSG00000172243. [Q9BXN2-10]
ENST00000529761; ENSP00000432876; ENSG00000172243. [Q9BXN2-1]
ENST00000531192; ENSP00000434392; ENSG00000172243. [Q9BXN2-4]
ENST00000533022; ENSP00000431461; ENSG00000172243. [Q9BXN2-3]
GeneID64581.
KEGGhsa:64581.
UCSCuc001qxf.2. human. [Q9BXN2-2]
uc001qxg.2. human. [Q9BXN2-1]
uc001qxh.2. human. [Q9BXN2-7]
uc001qxi.2. human. [Q9BXN2-3]
uc001qxj.2. human. [Q9BXN2-5]
uc001qxn.3. human. [Q9BXN2-9]
uc021quz.1. human. [Q9BXN2-6]

Organism-specific databases

CTD64581.
GeneCardsGC12M010269.
H-InvDBHIX0010422.
HGNCHGNC:14558. CLEC7A.
HPAHPA043244.
MIM606264. gene.
613108. phenotype.
614079. phenotype.
neXtProtNX_Q9BXN2.
Orphanet1334. Chronic mucocutaneous candidiasis.
PharmGKBPA26581.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG327853.
HOGENOMHOG000151249.
HOVERGENHBG105854.
InParanoidQ9BXN2.
KOK10074.
OMAQPDNSFW.
OrthoDBEOG747PJT.
PhylomeDBQ9BXN2.
TreeFamTF336674.

Gene expression databases

ArrayExpressQ9BXN2.
BgeeQ9BXN2.
GenevestigatorQ9BXN2.

Family and domain databases

Gene3D3.10.100.10. 1 hit.
InterProIPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR016187. C-type_lectin_fold.
[Graphical view]
PfamPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMSSF56436. SSF56436. 1 hit.
PROSITEPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiCLEC7A.
GenomeRNAi64581.
NextBio66517.
PROQ9BXN2.
SOURCESearch...

Entry information

Entry nameCLC7A_HUMAN
AccessionPrimary (citable) accession number: Q9BXN2
Secondary accession number(s): B2R861 expand/collapse secondary AC list , B7Z494, B7Z5A9, B7Z5B9, Q6IPS7, Q96D32, Q96DR9, Q96LD3, Q96PA4, Q96PA5, Q96PA6, Q96PA7, Q96PA8, Q9H1K3
Entry history
Integrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: June 1, 2001
Last modified: April 16, 2014
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 12

Human chromosome 12: entries, gene names and cross-references to MIM