Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

C-type lectin domain family 7 member A

Gene

CLEC7A

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation (By similarity).By similarity3 Publications

Sites

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Metal bindingi157Divalent metal cationBy similarity1
Metal bindingi159Divalent metal cationBy similarity1
Metal bindingi163Divalent metal cationBy similarity1
Metal bindingi242Divalent metal cationBy similarity1

GO - Molecular functioni

  • carbohydrate binding Source: UniProtKB
  • metal ion binding Source: UniProtKB-KW
  • MHC protein binding Source: UniProtKB
  • signaling pattern recognition receptor activity Source: UniProtKB

GO - Biological processi

  • carbohydrate mediated signaling Source: UniProtKB
  • cell recognition Source: UniProtKB
  • cellular response to molecule of fungal origin Source: Ensembl
  • defense response to protozoan Source: UniProtKB
  • inflammatory response Source: UniProtKB-KW
  • innate immune response Source: UniProtKB-KW
  • leukocyte activation involved in immune response Source: Ensembl
  • phagocytosis, recognition Source: UniProtKB
  • stimulatory C-type lectin receptor signaling pathway Source: Reactome
  • T cell activation Source: UniProtKB
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Immunity, Inflammatory response, Innate immunity

Keywords - Ligandi

Lectin, Metal-binding

Enzyme and pathway databases

ReactomeiR-HSA-5607764. CLEC7A (Dectin-1) signaling.

Names & Taxonomyi

Protein namesi
Recommended name:
C-type lectin domain family 7 member A
Alternative name(s):
Beta-glucan receptor
C-type lectin superfamily member 12
Dendritic cell-associated C-type lectin 1
Short name:
DC-associated C-type lectin 1
Short name:
Dectin-1
Gene namesi
Name:CLEC7A
Synonyms:BGR, CLECSF12, DECTIN1
ORF Names:UNQ539/PRO1082
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:14558. CLEC7A.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 44CytoplasmicSequence analysisAdd BLAST44
Transmembranei45 – 65Helical; Signal-anchor for type II membrane proteinSequence analysisAdd BLAST21
Topological domaini66 – 247ExtracellularSequence analysisAdd BLAST182

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane

Pathology & Biotechi

Involvement in diseasei

Candidiasis, familial, 4 (CANDF4)1 Publication
The disease may be caused by mutations affecting the gene represented in this entry.
Disease descriptionA primary immunodeficiency disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans.
See also OMIM:613108

Organism-specific databases

DisGeNETi64581.
MalaCardsiCLEC7A.
MIMi613108. phenotype.
614079. phenotype.
OpenTargetsiENSG00000172243.
Orphaneti1334. Chronic mucocutaneous candidosis.
PharmGKBiPA26581.

Chemistry databases

ChEMBLiCHEMBL2034810.

Polymorphism and mutation databases

BioMutaiCLEC7A.
DMDMi74752433.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002694911 – 247C-type lectin domain family 7 member AAdd BLAST247

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi91N-linked (GlcNAc...)Sequence analysis1
Disulfide bondi120 ↔ 131PROSITE-ProRule annotation
Disulfide bondi148 ↔ 241PROSITE-ProRule annotation
Disulfide bondi220 ↔ 233PROSITE-ProRule annotation

Post-translational modificationi

Phosphorylated on tyrosine residues in response to glucan binding.By similarity

Keywords - PTMi

Disulfide bond, Glycoprotein, Phosphoprotein

Proteomic databases

PaxDbiQ9BXN2.
PeptideAtlasiQ9BXN2.
PRIDEiQ9BXN2.

PTM databases

iPTMnetiQ9BXN2.
PhosphoSitePlusiQ9BXN2.

Expressioni

Tissue specificityi

Highly expressed in peripheral blood leukocytes and dendritic cells. Detected in spleen, bone marrow, lung, muscle, stomach and placenta.5 Publications

Inductioni

Up-regulated during differentiation from monocytes into dendritic cells.1 Publication

Gene expression databases

BgeeiENSG00000172243.
ExpressionAtlasiQ9BXN2. baseline and differential.
GenevisibleiQ9BXN2. HS.

Organism-specific databases

HPAiHPA043244.
HPA050229.

Interactioni

Subunit structurei

Homodimer (By similarity). Interacts with SYK; participates in leukocyte activation in presence of fungal pathogens (By similarity). Isoform 5 interacts with RANBP9.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
Q9BRL53EBI-3939278,EBI-10296986
ADAM33Q9BZ11-23EBI-3939278,EBI-10303054
BNIP3Q129833EBI-3939278,EBI-749464
BNIP3LO602386EBI-3939278,EBI-849893
FAM3AQ9BU273EBI-3939278,EBI-10298603
IL1RL1Q016383EBI-3939278,EBI-993762
JAGN1Q8N5M93EBI-3939278,EBI-10266796
KTN1Q86UP23EBI-3939278,EBI-359761
NINJ2Q9NZG73EBI-3939278,EBI-10317425
OCLNQ166253EBI-3939278,EBI-2903088
PTTG1IPP538013EBI-3939278,EBI-3906138
SMIM3Q9BZL33EBI-3939278,EBI-741850
SYNE4Q8N2057EBI-3939278,EBI-7131783
TMEM79Q9BSE23EBI-3939278,EBI-8649725
TMPRSS4Q9NRS4-33EBI-3939278,EBI-10312990

GO - Molecular functioni

  • MHC protein binding Source: UniProtKB

Protein-protein interaction databases

BioGridi122206. 22 interactors.
DIPiDIP-61730N.
IntActiQ9BXN2. 27 interactors.
STRINGi9606.ENSP00000302569.

Structurei

3D structure databases

ProteinModelPortaliQ9BXN2.
SMRiQ9BXN2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini127 – 242C-type lectinPROSITE-ProRule annotationAdd BLAST116

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi15 – 18ITAM-like4

Sequence similaritiesi

Contains 1 C-type lectin domain.PROSITE-ProRule annotation

Keywords - Domaini

Signal-anchor, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG4297. Eukaryota.
ENOG410XPJ1. LUCA.
GeneTreeiENSGT00700000104266.
HOGENOMiHOG000151249.
HOVERGENiHBG105854.
InParanoidiQ9BXN2.
KOiK10074.
OMAiQPDNSFW.
OrthoDBiEOG091G0MM1.
PhylomeDBiQ9BXN2.
TreeFamiTF336674.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin-like.
IPR016186. C-type_lectin-like/link.
IPR016187. CTDL_fold.
[Graphical view]
PfamiPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]

Sequences (10)i

Sequence statusi: Complete.

This entry describes 10 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BXN2-1) [UniParc]FASTAAdd to basket
Also known as: A

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEYHPDLENL DEDGYTQLHF DSQSNTRIAV VSEKGSCAAS PPWRLIAVIL
60 70 80 90 100
GILCLVILVI AVVLGTMAIW RSNSGSNTLE NGYFLSRNKE NHSQPTQSSL
110 120 130 140 150
EDSVTPTKAV KTTGVLSSPC PPNWIIYEKS CYLFSMSLNS WDGSKRQCWQ
160 170 180 190 200
LGSNLLKIDS SNELGFIVKQ VSSQPDNSFW IGLSRPQTEV PWLWEDGSTF
210 220 230 240
SSNLFQIRTT ATQENPSPNC VWIHVSVIYD QLCSVPSYSI CEKKFSM
Length:247
Mass (Da):27,627
Last modified:June 1, 2001 - v1
Checksum:i98393E36976111B9
GO
Isoform 2 (identifier: Q9BXN2-2) [UniParc]FASTAAdd to basket
Also known as: Beta, B

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.

Note: Predominant isoform.
Show »
Length:201
Mass (Da):22,563
Checksum:iC6ADEE762B2CE968
GO
Isoform 3 (identifier: Q9BXN2-3) [UniParc]FASTAAdd to basket
Also known as: C

The sequence of this isoform differs from the canonical sequence as follows:
     165-189: GFIVKQVSSQPDNSFWIGLSRPQTE → ISDQNHSYPRKPISKLCMDSRVSHL
     190-247: Missing.

Show »
Length:189
Mass (Da):21,065
Checksum:iF7DF9F76EA4B6B59
GO
Isoform 4 (identifier: Q9BXN2-4) [UniParc]FASTAAdd to basket
Also known as: G

The sequence of this isoform differs from the canonical sequence as follows:
     165-196: GFIVKQVSSQPDNSFWIGLSRPQTEVPWLWED → SLTLLPKLECSEAATSQAQVILPPQLPE
     197-247: Missing.

Show »
Length:192
Mass (Da):21,130
Checksum:i6F3350B1DFBEC921
GO
Isoform 5 (identifier: Q9BXN2-5) [UniParc]FASTAAdd to basket
Also known as: E

The sequence of this isoform differs from the canonical sequence as follows:
     36-114: Missing.

Show »
Length:168
Mass (Da):19,218
Checksum:iAFD3A88F89BBFFC6
GO
Isoform 6 (identifier: Q9BXN2-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.
     165-178: GFIVKQVSSQPDNS → VSVDFCYDYLWCVS
     179-247: Missing.

Show »
Length:132
Mass (Da):14,787
Checksum:i997EEE918BC63102
GO
Isoform 7 (identifier: Q9BXN2-7) [UniParc]FASTAAdd to basket
Also known as: D

The sequence of this isoform differs from the canonical sequence as follows:
     68-113: Missing.
     165-189: GFIVKQVSSQPDNSFWIGLSRPQTE → ISDQNHSYPRKPISKLCMDSRVSHL
     190-247: Missing.

Show »
Length:143
Mass (Da):16,000
Checksum:i3BD7AE116DDB4305
GO
Isoform 8 (identifier: Q9BXN2-8) [UniParc]FASTAAdd to basket
Also known as: F

The sequence of this isoform differs from the canonical sequence as follows:
     36-45: SCAASPPWRL → IYSKTSVFPT
     46-247: Missing.

Show »
Length:45
Mass (Da):5,164
Checksum:iED83111E8DE75169
GO
Isoform 9 (identifier: Q9BXN2-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     69-77: IWRSNSGSN → GFKAVEFKG
     78-247: Missing.

Note: No experimental confirmation available.
Show »
Length:77
Mass (Da):8,363
Checksum:i488D685E42698CCB
GO
Isoform 10 (identifier: Q9BXN2-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     68-116: AIWRSNSGSN...TKAVKTTGVL → GTGQFLKDLS...RTTVNPHNHL
     117-247: Missing.

Show »
Length:116
Mass (Da):13,138
Checksum:i8DE1C6BF8C69B3A9
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti31V → I in AAL11714 (PubMed:11567029).Curated1

Polymorphismi

A stop polymorphism at position 238 may be associated with invasive aspergillosis following hematopoietic stem cell transplantation. The risk is highest when the polymorphism is present in both donors and recipients [MIMi:614079].

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_050111223I → S.Corresponds to variant rs16910527dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02204836 – 114Missing in isoform 5. 2 PublicationsAdd BLAST79
Alternative sequenceiVSP_02204936 – 45SCAASPPWRL → IYSKTSVFPT in isoform 8. 1 Publication10
Alternative sequenceiVSP_02205046 – 247Missing in isoform 8. 1 PublicationAdd BLAST202
Alternative sequenceiVSP_04758968 – 116AIWRS…TTGVL → GTGQFLKDLSFLNNRRKLFG DPIQEATHWRMATFYQEIKR TTVNPHNHL in isoform 10. 1 PublicationAdd BLAST49
Alternative sequenceiVSP_02205168 – 113Missing in isoform 2, isoform 6 and isoform 7. 8 PublicationsAdd BLAST46
Alternative sequenceiVSP_04329869 – 77IWRSNSGSN → GFKAVEFKG in isoform 9. 1 Publication9
Alternative sequenceiVSP_04329978 – 247Missing in isoform 9. 1 PublicationAdd BLAST170
Alternative sequenceiVSP_047590117 – 247Missing in isoform 10. 1 PublicationAdd BLAST131
Alternative sequenceiVSP_022052165 – 196GFIVK…WLWED → SLTLLPKLECSEAATSQAQV ILPPQLPE in isoform 4. 1 PublicationAdd BLAST32
Alternative sequenceiVSP_022053165 – 189GFIVK…RPQTE → ISDQNHSYPRKPISKLCMDS RVSHL in isoform 3 and isoform 7. 3 PublicationsAdd BLAST25
Alternative sequenceiVSP_022054165 – 178GFIVK…QPDNS → VSVDFCYDYLWCVS in isoform 6. 1 PublicationAdd BLAST14
Alternative sequenceiVSP_022055179 – 247Missing in isoform 6. 1 PublicationAdd BLAST69
Alternative sequenceiVSP_022056190 – 247Missing in isoform 3 and isoform 7. 3 PublicationsAdd BLAST58
Alternative sequenceiVSP_022057197 – 247Missing in isoform 4. 1 PublicationAdd BLAST51

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY026769 mRNA. Translation: AAK20114.2.
AY026770 mRNA. Translation: AAK20115.1.
AY026771 mRNA. Translation: AAK20116.1.
AF313468 mRNA. Translation: AAK37473.1.
AF313469 mRNA. Translation: AAK37474.1.
AF400595 mRNA. Translation: AAL11711.1.
AF400596 mRNA. Translation: AAL11712.1.
AF400597 mRNA. Translation: AAL11713.1.
AF400598 mRNA. Translation: AAL11714.1.
AF400599 mRNA. Translation: AAL11715.1.
AF400600 mRNA. Translation: AAL11716.1.
AF400601 mRNA. Translation: AAL11717.1.
AF400602 mRNA. Translation: AAL11718.1.
AJ312372 mRNA. Translation: CAC43846.1.
AJ312373 mRNA. Translation: CAC43847.1.
AY009090 mRNA. Translation: AAG33923.2.
AY359002 mRNA. Translation: AAQ89361.1.
AK297028 mRNA. Translation: BAH12480.1.
AK298679 mRNA. Translation: BAH12845.1.
AK298724 mRNA. Translation: BAH12855.1.
AK313247 mRNA. Translation: BAG36058.1.
AC024224 Genomic DNA. No translation available.
CH471094 Genomic DNA. Translation: EAW96144.1.
CH471094 Genomic DNA. Translation: EAW96145.1.
CH471094 Genomic DNA. Translation: EAW96146.1.
CH471094 Genomic DNA. Translation: EAW96150.1.
CH471094 Genomic DNA. Translation: EAW96154.1.
BC013385 mRNA. Translation: AAH13385.1.
BC071746 mRNA. Translation: AAH71746.1.
BC093829 mRNA. Translation: AAH93829.1.
BC093831 mRNA. Translation: AAH93831.1.
CCDSiCCDS41753.1. [Q9BXN2-1]
CCDS41754.1. [Q9BXN2-3]
CCDS53744.1. [Q9BXN2-7]
CCDS8613.1. [Q9BXN2-2]
CCDS8614.1. [Q9BXN2-5]
CCDS8617.1. [Q9BXN2-9]
RefSeqiNP_072092.2. NM_022570.4. [Q9BXN2-2]
NP_922938.1. NM_197947.2. [Q9BXN2-1]
NP_922939.1. NM_197948.2. [Q9BXN2-3]
NP_922940.1. NM_197949.2. [Q9BXN2-7]
NP_922941.1. NM_197950.2. [Q9BXN2-5]
NP_922945.1. NM_197954.2. [Q9BXN2-9]
XP_006719198.1. XM_006719135.3. [Q9BXN2-4]
UniGeneiHs.143929.

Genome annotation databases

EnsembliENST00000298523; ENSP00000298523; ENSG00000172243. [Q9BXN2-7]
ENST00000304084; ENSP00000302569; ENSG00000172243. [Q9BXN2-1]
ENST00000310002; ENSP00000312089; ENSG00000172243. [Q9BXN2-9]
ENST00000349926; ENSP00000344723; ENSG00000172243. [Q9BXN2-8]
ENST00000353231; ENSP00000266456; ENSG00000172243. [Q9BXN2-2]
ENST00000396484; ENSP00000379743; ENSG00000172243. [Q9BXN2-5]
ENST00000465100; ENSP00000436923; ENSG00000172243. [Q9BXN2-10]
ENST00000529761; ENSP00000432876; ENSG00000172243. [Q9BXN2-1]
ENST00000531192; ENSP00000434392; ENSG00000172243. [Q9BXN2-4]
ENST00000533022; ENSP00000431461; ENSG00000172243. [Q9BXN2-3]
GeneIDi64581.
KEGGihsa:64581.
UCSCiuc001qxe.5. human. [Q9BXN2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY026769 mRNA. Translation: AAK20114.2.
AY026770 mRNA. Translation: AAK20115.1.
AY026771 mRNA. Translation: AAK20116.1.
AF313468 mRNA. Translation: AAK37473.1.
AF313469 mRNA. Translation: AAK37474.1.
AF400595 mRNA. Translation: AAL11711.1.
AF400596 mRNA. Translation: AAL11712.1.
AF400597 mRNA. Translation: AAL11713.1.
AF400598 mRNA. Translation: AAL11714.1.
AF400599 mRNA. Translation: AAL11715.1.
AF400600 mRNA. Translation: AAL11716.1.
AF400601 mRNA. Translation: AAL11717.1.
AF400602 mRNA. Translation: AAL11718.1.
AJ312372 mRNA. Translation: CAC43846.1.
AJ312373 mRNA. Translation: CAC43847.1.
AY009090 mRNA. Translation: AAG33923.2.
AY359002 mRNA. Translation: AAQ89361.1.
AK297028 mRNA. Translation: BAH12480.1.
AK298679 mRNA. Translation: BAH12845.1.
AK298724 mRNA. Translation: BAH12855.1.
AK313247 mRNA. Translation: BAG36058.1.
AC024224 Genomic DNA. No translation available.
CH471094 Genomic DNA. Translation: EAW96144.1.
CH471094 Genomic DNA. Translation: EAW96145.1.
CH471094 Genomic DNA. Translation: EAW96146.1.
CH471094 Genomic DNA. Translation: EAW96150.1.
CH471094 Genomic DNA. Translation: EAW96154.1.
BC013385 mRNA. Translation: AAH13385.1.
BC071746 mRNA. Translation: AAH71746.1.
BC093829 mRNA. Translation: AAH93829.1.
BC093831 mRNA. Translation: AAH93831.1.
CCDSiCCDS41753.1. [Q9BXN2-1]
CCDS41754.1. [Q9BXN2-3]
CCDS53744.1. [Q9BXN2-7]
CCDS8613.1. [Q9BXN2-2]
CCDS8614.1. [Q9BXN2-5]
CCDS8617.1. [Q9BXN2-9]
RefSeqiNP_072092.2. NM_022570.4. [Q9BXN2-2]
NP_922938.1. NM_197947.2. [Q9BXN2-1]
NP_922939.1. NM_197948.2. [Q9BXN2-3]
NP_922940.1. NM_197949.2. [Q9BXN2-7]
NP_922941.1. NM_197950.2. [Q9BXN2-5]
NP_922945.1. NM_197954.2. [Q9BXN2-9]
XP_006719198.1. XM_006719135.3. [Q9BXN2-4]
UniGeneiHs.143929.

3D structure databases

ProteinModelPortaliQ9BXN2.
SMRiQ9BXN2.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122206. 22 interactors.
DIPiDIP-61730N.
IntActiQ9BXN2. 27 interactors.
STRINGi9606.ENSP00000302569.

Chemistry databases

ChEMBLiCHEMBL2034810.

PTM databases

iPTMnetiQ9BXN2.
PhosphoSitePlusiQ9BXN2.

Polymorphism and mutation databases

BioMutaiCLEC7A.
DMDMi74752433.

Proteomic databases

PaxDbiQ9BXN2.
PeptideAtlasiQ9BXN2.
PRIDEiQ9BXN2.

Protocols and materials databases

DNASUi64581.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000298523; ENSP00000298523; ENSG00000172243. [Q9BXN2-7]
ENST00000304084; ENSP00000302569; ENSG00000172243. [Q9BXN2-1]
ENST00000310002; ENSP00000312089; ENSG00000172243. [Q9BXN2-9]
ENST00000349926; ENSP00000344723; ENSG00000172243. [Q9BXN2-8]
ENST00000353231; ENSP00000266456; ENSG00000172243. [Q9BXN2-2]
ENST00000396484; ENSP00000379743; ENSG00000172243. [Q9BXN2-5]
ENST00000465100; ENSP00000436923; ENSG00000172243. [Q9BXN2-10]
ENST00000529761; ENSP00000432876; ENSG00000172243. [Q9BXN2-1]
ENST00000531192; ENSP00000434392; ENSG00000172243. [Q9BXN2-4]
ENST00000533022; ENSP00000431461; ENSG00000172243. [Q9BXN2-3]
GeneIDi64581.
KEGGihsa:64581.
UCSCiuc001qxe.5. human. [Q9BXN2-1]

Organism-specific databases

CTDi64581.
DisGeNETi64581.
GeneCardsiCLEC7A.
H-InvDBHIX0010422.
HGNCiHGNC:14558. CLEC7A.
HPAiHPA043244.
HPA050229.
MalaCardsiCLEC7A.
MIMi606264. gene.
613108. phenotype.
614079. phenotype.
neXtProtiNX_Q9BXN2.
OpenTargetsiENSG00000172243.
Orphaneti1334. Chronic mucocutaneous candidosis.
PharmGKBiPA26581.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG4297. Eukaryota.
ENOG410XPJ1. LUCA.
GeneTreeiENSGT00700000104266.
HOGENOMiHOG000151249.
HOVERGENiHBG105854.
InParanoidiQ9BXN2.
KOiK10074.
OMAiQPDNSFW.
OrthoDBiEOG091G0MM1.
PhylomeDBiQ9BXN2.
TreeFamiTF336674.

Enzyme and pathway databases

ReactomeiR-HSA-5607764. CLEC7A (Dectin-1) signaling.

Miscellaneous databases

GeneWikiiCLEC7A.
GenomeRNAii64581.
PROiQ9BXN2.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000172243.
ExpressionAtlasiQ9BXN2. baseline and differential.
GenevisibleiQ9BXN2. HS.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin-like.
IPR016186. C-type_lectin-like/link.
IPR016187. CTDL_fold.
[Graphical view]
PfamiPF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiCLC7A_HUMAN
AccessioniPrimary (citable) accession number: Q9BXN2
Secondary accession number(s): B2R861
, B7Z494, B7Z5A9, B7Z5B9, Q6IPS7, Q96D32, Q96DR9, Q96LD3, Q96PA4, Q96PA5, Q96PA6, Q96PA7, Q96PA8, Q9H1K3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 12, 2006
Last sequence update: June 1, 2001
Last modified: November 30, 2016
This is version 132 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.