Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BXN2

- CLC7A_HUMAN

UniProt

Q9BXN2 - CLC7A_HUMAN

Protein

C-type lectin domain family 7 member A

Gene

CLEC7A

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 112 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Lectin that functions as pattern receptor specific for beta-1,3-linked and beta-1,6-linked glucans, such as cell wall constituents from pathogenic bacteria and fungi. Necessary for the TLR2-mediated inflammatory response and for TLR2-mediated activation of NF-kappa-B. Enhances cytokine production in macrophages and dendritic cells. Mediates production of reactive oxygen species in the cell. Mediates phagocytosis of C.albicans conidia. Binds T-cells in a way that does not involve their surface glycans and plays a role in T-cell activation. Stimulates T-cell proliferation By similarity.By similarity

    Sites

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Metal bindingi157 – 1571Divalent metal cationBy similarity
    Metal bindingi159 – 1591Divalent metal cationBy similarity
    Metal bindingi163 – 1631Divalent metal cationBy similarity
    Metal bindingi242 – 2421Divalent metal cationBy similarity

    GO - Molecular functioni

    1. (1->3)-beta-D-glucan binding Source: Ensembl
    2. (1->3)-beta-D-glucan receptor activity Source: Ensembl
    3. carbohydrate binding Source: UniProtKB
    4. metal ion binding Source: UniProtKB-KW
    5. MHC protein binding Source: UniProtKB
    6. signaling pattern recognition receptor activity Source: UniProtKB

    GO - Biological processi

    1. carbohydrate mediated signaling Source: UniProtKB
    2. cell recognition Source: UniProtKB
    3. cell surface pattern recognition receptor signaling pathway Source: Ensembl
    4. cellular response to molecule of fungal origin Source: Ensembl
    5. defense response to protozoan Source: UniProtKB
    6. detection of yeast Source: Ensembl
    7. inflammatory response Source: UniProtKB-KW
    8. innate immune response Source: UniProtKB-KW
    9. leukocyte activation involved in immune response Source: Ensembl
    10. phagocytosis, engulfment Source: Ensembl
    11. phagocytosis, recognition Source: UniProtKB
    12. positive regulation of phagocytosis Source: Ensembl
    13. positive regulation of tumor necrosis factor production Source: Ensembl
    14. single organismal cell-cell adhesion Source: Ensembl
    15. T cell activation Source: UniProtKB

    Keywords - Molecular functioni

    Receptor

    Keywords - Biological processi

    Immunity, Inflammatory response, Innate immunity

    Keywords - Ligandi

    Lectin, Metal-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    C-type lectin domain family 7 member A
    Alternative name(s):
    Beta-glucan receptor
    C-type lectin superfamily member 12
    Dendritic cell-associated C-type lectin 1
    Short name:
    DC-associated C-type lectin 1
    Short name:
    Dectin-1
    Gene namesi
    Name:CLEC7A
    Synonyms:BGR, CLECSF12, DECTIN1
    ORF Names:UNQ539/PRO1082
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 12

    Organism-specific databases

    HGNCiHGNC:14558. CLEC7A.

    Subcellular locationi

    Cell membrane 3 Publications; Single-pass type II membrane protein 3 Publications

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. external side of plasma membrane Source: Ensembl
    3. integral component of membrane Source: UniProtKB

    Keywords - Cellular componenti

    Cell membrane, Cytoplasm, Membrane

    Pathology & Biotechi

    Involvement in diseasei

    Candidiasis, familial, 4 (CANDF4) [MIM:613108]: A primary immunodeficiency disorder with altered immune responses and impaired clearance of fungal infections, selective against Candida. It is characterized by persistent and/or recurrent infections of the skin, nails and mucous membranes caused by organisms of the genus Candida, mainly Candida albicans.1 Publication
    Note: The disease may be caused by mutations affecting the gene represented in this entry.

    Organism-specific databases

    MIMi613108. phenotype.
    614079. phenotype.
    Orphaneti1334. Chronic mucocutaneous candidiasis.
    PharmGKBiPA26581.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 247247C-type lectin domain family 7 member APRO_0000269491Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi91 – 911N-linked (GlcNAc...)Sequence Analysis
    Disulfide bondi120 ↔ 131PROSITE-ProRule annotation
    Disulfide bondi148 ↔ 241PROSITE-ProRule annotation
    Disulfide bondi220 ↔ 233PROSITE-ProRule annotation

    Post-translational modificationi

    Phosphorylated on tyrosine residues in response to glucan binding.By similarity

    Keywords - PTMi

    Disulfide bond, Glycoprotein, Phosphoprotein

    Proteomic databases

    PaxDbiQ9BXN2.
    PRIDEiQ9BXN2.

    PTM databases

    PhosphoSiteiQ9BXN2.

    Expressioni

    Tissue specificityi

    Highly expressed in peripheral blood leukocytes and dendritic cells. Detected in spleen, bone marrow, lung, muscle, stomach and placenta.5 Publications

    Inductioni

    Up-regulated during differentiation from monocytes into dendritic cells.1 Publication

    Gene expression databases

    ArrayExpressiQ9BXN2.
    BgeeiQ9BXN2.
    GenevestigatoriQ9BXN2.

    Organism-specific databases

    HPAiHPA043244.

    Interactioni

    Subunit structurei

    Homodimer By similarity. Interacts with SYK; participates in leukocyte activation in presence of fungal pathogens By similarity. Isoform 5 interacts with RANBP9.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi122206. 6 interactions.
    IntActiQ9BXN2. 5 interactions.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BXN2.
    SMRiQ9BXN2. Positions 120-245.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 4444CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini66 – 247182ExtracellularSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei45 – 6521Helical; Signal-anchor for type II membrane proteinSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini127 – 242116C-type lectinPROSITE-ProRule annotationAdd
    BLAST

    Motif

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Motifi15 – 184ITAM-like

    Sequence similaritiesi

    Contains 1 C-type lectin domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Signal-anchor, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG327853.
    HOGENOMiHOG000151249.
    HOVERGENiHBG105854.
    InParanoidiQ9BXN2.
    KOiK10074.
    OMAiTEGPWLW.
    OrthoDBiEOG747PJT.
    PhylomeDBiQ9BXN2.
    TreeFamiTF336674.

    Family and domain databases

    Gene3Di3.10.100.10. 1 hit.
    InterProiIPR001304. C-type_lectin.
    IPR016186. C-type_lectin-like.
    IPR016187. C-type_lectin_fold.
    [Graphical view]
    PfamiPF00059. Lectin_C. 1 hit.
    [Graphical view]
    SMARTiSM00034. CLECT. 1 hit.
    [Graphical view]
    SUPFAMiSSF56436. SSF56436. 1 hit.
    PROSITEiPS50041. C_TYPE_LECTIN_2. 1 hit.
    [Graphical view]

    Sequences (10)i

    Sequence statusi: Complete.

    This entry describes 10 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BXN2-1) [UniParc]FASTAAdd to Basket

    Also known as: A

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEYHPDLENL DEDGYTQLHF DSQSNTRIAV VSEKGSCAAS PPWRLIAVIL    50
    GILCLVILVI AVVLGTMAIW RSNSGSNTLE NGYFLSRNKE NHSQPTQSSL 100
    EDSVTPTKAV KTTGVLSSPC PPNWIIYEKS CYLFSMSLNS WDGSKRQCWQ 150
    LGSNLLKIDS SNELGFIVKQ VSSQPDNSFW IGLSRPQTEV PWLWEDGSTF 200
    SSNLFQIRTT ATQENPSPNC VWIHVSVIYD QLCSVPSYSI CEKKFSM 247
    Length:247
    Mass (Da):27,627
    Last modified:June 1, 2001 - v1
    Checksum:i98393E36976111B9
    GO
    Isoform 2 (identifier: Q9BXN2-2) [UniParc]FASTAAdd to Basket

    Also known as: Beta, B

    The sequence of this isoform differs from the canonical sequence as follows:
         68-113: Missing.

    Note: Predominant isoform.

    Show »
    Length:201
    Mass (Da):22,563
    Checksum:iC6ADEE762B2CE968
    GO
    Isoform 3 (identifier: Q9BXN2-3) [UniParc]FASTAAdd to Basket

    Also known as: C

    The sequence of this isoform differs from the canonical sequence as follows:
         165-189: GFIVKQVSSQPDNSFWIGLSRPQTE → ISDQNHSYPRKPISKLCMDSRVSHL
         190-247: Missing.

    Show »
    Length:189
    Mass (Da):21,065
    Checksum:iF7DF9F76EA4B6B59
    GO
    Isoform 4 (identifier: Q9BXN2-4) [UniParc]FASTAAdd to Basket

    Also known as: G

    The sequence of this isoform differs from the canonical sequence as follows:
         165-196: GFIVKQVSSQPDNSFWIGLSRPQTEVPWLWED → SLTLLPKLECSEAATSQAQVILPPQLPE
         197-247: Missing.

    Show »
    Length:192
    Mass (Da):21,130
    Checksum:i6F3350B1DFBEC921
    GO
    Isoform 5 (identifier: Q9BXN2-5) [UniParc]FASTAAdd to Basket

    Also known as: E

    The sequence of this isoform differs from the canonical sequence as follows:
         36-114: Missing.

    Show »
    Length:168
    Mass (Da):19,218
    Checksum:iAFD3A88F89BBFFC6
    GO
    Isoform 6 (identifier: Q9BXN2-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         68-113: Missing.
         165-178: GFIVKQVSSQPDNS → VSVDFCYDYLWCVS
         179-247: Missing.

    Show »
    Length:132
    Mass (Da):14,787
    Checksum:i997EEE918BC63102
    GO
    Isoform 7 (identifier: Q9BXN2-7) [UniParc]FASTAAdd to Basket

    Also known as: D

    The sequence of this isoform differs from the canonical sequence as follows:
         68-113: Missing.
         165-189: GFIVKQVSSQPDNSFWIGLSRPQTE → ISDQNHSYPRKPISKLCMDSRVSHL
         190-247: Missing.

    Show »
    Length:143
    Mass (Da):16,000
    Checksum:i3BD7AE116DDB4305
    GO
    Isoform 8 (identifier: Q9BXN2-8) [UniParc]FASTAAdd to Basket

    Also known as: F

    The sequence of this isoform differs from the canonical sequence as follows:
         36-45: SCAASPPWRL → IYSKTSVFPT
         46-247: Missing.

    Show »
    Length:45
    Mass (Da):5,164
    Checksum:iED83111E8DE75169
    GO
    Isoform 9 (identifier: Q9BXN2-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         69-77: IWRSNSGSN → GFKAVEFKG
         78-247: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:77
    Mass (Da):8,363
    Checksum:i488D685E42698CCB
    GO
    Isoform 10 (identifier: Q9BXN2-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         68-116: AIWRSNSGSN...TKAVKTTGVL → GTGQFLKDLS...RTTVNPHNHL
         117-247: Missing.

    Show »
    Length:116
    Mass (Da):13,138
    Checksum:i8DE1C6BF8C69B3A9
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti31 – 311V → I in AAL11714. (PubMed:11567029)Curated

    Polymorphismi

    A stop polymorphism at position 238 may be associated with invasive aspergillosis following hematopoietic stem cell transplantation. The risk is highest when the polymorphism is present in both donors and recipients [MIMi:614079].

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti223 – 2231I → S.
    Corresponds to variant rs16910527 [ dbSNP | Ensembl ].
    VAR_050111

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei36 – 11479Missing in isoform 5. 2 PublicationsVSP_022048Add
    BLAST
    Alternative sequencei36 – 4510SCAASPPWRL → IYSKTSVFPT in isoform 8. 1 PublicationVSP_022049
    Alternative sequencei46 – 247202Missing in isoform 8. 1 PublicationVSP_022050Add
    BLAST
    Alternative sequencei68 – 11649AIWRS…TTGVL → GTGQFLKDLSFLNNRRKLFG DPIQEATHWRMATFYQEIKR TTVNPHNHL in isoform 10. 1 PublicationVSP_047589Add
    BLAST
    Alternative sequencei68 – 11346Missing in isoform 2, isoform 6 and isoform 7. 8 PublicationsVSP_022051Add
    BLAST
    Alternative sequencei69 – 779IWRSNSGSN → GFKAVEFKG in isoform 9. 1 PublicationVSP_043298
    Alternative sequencei78 – 247170Missing in isoform 9. 1 PublicationVSP_043299Add
    BLAST
    Alternative sequencei117 – 247131Missing in isoform 10. 1 PublicationVSP_047590Add
    BLAST
    Alternative sequencei165 – 19632GFIVK…WLWED → SLTLLPKLECSEAATSQAQV ILPPQLPE in isoform 4. 1 PublicationVSP_022052Add
    BLAST
    Alternative sequencei165 – 18925GFIVK…RPQTE → ISDQNHSYPRKPISKLCMDS RVSHL in isoform 3 and isoform 7. 3 PublicationsVSP_022053Add
    BLAST
    Alternative sequencei165 – 17814GFIVK…QPDNS → VSVDFCYDYLWCVS in isoform 6. 1 PublicationVSP_022054Add
    BLAST
    Alternative sequencei179 – 24769Missing in isoform 6. 1 PublicationVSP_022055Add
    BLAST
    Alternative sequencei190 – 24758Missing in isoform 3 and isoform 7. 3 PublicationsVSP_022056Add
    BLAST
    Alternative sequencei197 – 24751Missing in isoform 4. 1 PublicationVSP_022057Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY026769 mRNA. Translation: AAK20114.2.
    AY026770 mRNA. Translation: AAK20115.1.
    AY026771 mRNA. Translation: AAK20116.1.
    AF313468 mRNA. Translation: AAK37473.1.
    AF313469 mRNA. Translation: AAK37474.1.
    AF400595 mRNA. Translation: AAL11711.1.
    AF400596 mRNA. Translation: AAL11712.1.
    AF400597 mRNA. Translation: AAL11713.1.
    AF400598 mRNA. Translation: AAL11714.1.
    AF400599 mRNA. Translation: AAL11715.1.
    AF400600 mRNA. Translation: AAL11716.1.
    AF400601 mRNA. Translation: AAL11717.1.
    AF400602 mRNA. Translation: AAL11718.1.
    AJ312372 mRNA. Translation: CAC43846.1.
    AJ312373 mRNA. Translation: CAC43847.1.
    AY009090 mRNA. Translation: AAG33923.2.
    AY359002 mRNA. Translation: AAQ89361.1.
    AK297028 mRNA. Translation: BAH12480.1.
    AK298679 mRNA. Translation: BAH12845.1.
    AK298724 mRNA. Translation: BAH12855.1.
    AK313247 mRNA. Translation: BAG36058.1.
    AC024224 Genomic DNA. No translation available.
    CH471094 Genomic DNA. Translation: EAW96144.1.
    CH471094 Genomic DNA. Translation: EAW96145.1.
    CH471094 Genomic DNA. Translation: EAW96146.1.
    CH471094 Genomic DNA. Translation: EAW96150.1.
    CH471094 Genomic DNA. Translation: EAW96154.1.
    BC013385 mRNA. Translation: AAH13385.1.
    BC071746 mRNA. Translation: AAH71746.1.
    BC093829 mRNA. Translation: AAH93829.1.
    BC093831 mRNA. Translation: AAH93831.1.
    CCDSiCCDS41753.1. [Q9BXN2-1]
    CCDS41754.1. [Q9BXN2-3]
    CCDS53744.1. [Q9BXN2-7]
    CCDS8613.1. [Q9BXN2-2]
    CCDS8614.1. [Q9BXN2-5]
    CCDS8617.1. [Q9BXN2-9]
    RefSeqiNP_072092.2. NM_022570.4. [Q9BXN2-2]
    NP_922938.1. NM_197947.2. [Q9BXN2-1]
    NP_922939.1. NM_197948.2. [Q9BXN2-3]
    NP_922940.1. NM_197949.2. [Q9BXN2-7]
    NP_922941.1. NM_197950.2. [Q9BXN2-5]
    NP_922945.1. NM_197954.2. [Q9BXN2-9]
    XP_005253524.1. XM_005253467.2. [Q9BXN2-1]
    XP_005253525.1. XM_005253468.1. [Q9BXN2-10]
    XP_006719198.1. XM_006719135.1. [Q9BXN2-4]
    XP_006719199.1. XM_006719136.1. [Q9BXN2-10]
    UniGeneiHs.143929.

    Genome annotation databases

    EnsembliENST00000298523; ENSP00000298523; ENSG00000172243. [Q9BXN2-7]
    ENST00000304084; ENSP00000302569; ENSG00000172243. [Q9BXN2-1]
    ENST00000310002; ENSP00000312089; ENSG00000172243. [Q9BXN2-9]
    ENST00000349926; ENSP00000344723; ENSG00000172243. [Q9BXN2-8]
    ENST00000353231; ENSP00000266456; ENSG00000172243. [Q9BXN2-2]
    ENST00000396484; ENSP00000379743; ENSG00000172243. [Q9BXN2-5]
    ENST00000465100; ENSP00000436923; ENSG00000172243. [Q9BXN2-10]
    ENST00000529761; ENSP00000432876; ENSG00000172243. [Q9BXN2-1]
    ENST00000531192; ENSP00000434392; ENSG00000172243. [Q9BXN2-4]
    ENST00000533022; ENSP00000431461; ENSG00000172243. [Q9BXN2-3]
    GeneIDi64581.
    KEGGihsa:64581.
    UCSCiuc001qxf.2. human. [Q9BXN2-2]
    uc001qxg.2. human. [Q9BXN2-1]
    uc001qxh.2. human. [Q9BXN2-7]
    uc001qxi.2. human. [Q9BXN2-3]
    uc001qxj.2. human. [Q9BXN2-5]
    uc001qxn.3. human. [Q9BXN2-9]
    uc021quz.1. human. [Q9BXN2-6]

    Polymorphism databases

    DMDMi74752433.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY026769 mRNA. Translation: AAK20114.2 .
    AY026770 mRNA. Translation: AAK20115.1 .
    AY026771 mRNA. Translation: AAK20116.1 .
    AF313468 mRNA. Translation: AAK37473.1 .
    AF313469 mRNA. Translation: AAK37474.1 .
    AF400595 mRNA. Translation: AAL11711.1 .
    AF400596 mRNA. Translation: AAL11712.1 .
    AF400597 mRNA. Translation: AAL11713.1 .
    AF400598 mRNA. Translation: AAL11714.1 .
    AF400599 mRNA. Translation: AAL11715.1 .
    AF400600 mRNA. Translation: AAL11716.1 .
    AF400601 mRNA. Translation: AAL11717.1 .
    AF400602 mRNA. Translation: AAL11718.1 .
    AJ312372 mRNA. Translation: CAC43846.1 .
    AJ312373 mRNA. Translation: CAC43847.1 .
    AY009090 mRNA. Translation: AAG33923.2 .
    AY359002 mRNA. Translation: AAQ89361.1 .
    AK297028 mRNA. Translation: BAH12480.1 .
    AK298679 mRNA. Translation: BAH12845.1 .
    AK298724 mRNA. Translation: BAH12855.1 .
    AK313247 mRNA. Translation: BAG36058.1 .
    AC024224 Genomic DNA. No translation available.
    CH471094 Genomic DNA. Translation: EAW96144.1 .
    CH471094 Genomic DNA. Translation: EAW96145.1 .
    CH471094 Genomic DNA. Translation: EAW96146.1 .
    CH471094 Genomic DNA. Translation: EAW96150.1 .
    CH471094 Genomic DNA. Translation: EAW96154.1 .
    BC013385 mRNA. Translation: AAH13385.1 .
    BC071746 mRNA. Translation: AAH71746.1 .
    BC093829 mRNA. Translation: AAH93829.1 .
    BC093831 mRNA. Translation: AAH93831.1 .
    CCDSi CCDS41753.1. [Q9BXN2-1 ]
    CCDS41754.1. [Q9BXN2-3 ]
    CCDS53744.1. [Q9BXN2-7 ]
    CCDS8613.1. [Q9BXN2-2 ]
    CCDS8614.1. [Q9BXN2-5 ]
    CCDS8617.1. [Q9BXN2-9 ]
    RefSeqi NP_072092.2. NM_022570.4. [Q9BXN2-2 ]
    NP_922938.1. NM_197947.2. [Q9BXN2-1 ]
    NP_922939.1. NM_197948.2. [Q9BXN2-3 ]
    NP_922940.1. NM_197949.2. [Q9BXN2-7 ]
    NP_922941.1. NM_197950.2. [Q9BXN2-5 ]
    NP_922945.1. NM_197954.2. [Q9BXN2-9 ]
    XP_005253524.1. XM_005253467.2. [Q9BXN2-1 ]
    XP_005253525.1. XM_005253468.1. [Q9BXN2-10 ]
    XP_006719198.1. XM_006719135.1. [Q9BXN2-4 ]
    XP_006719199.1. XM_006719136.1. [Q9BXN2-10 ]
    UniGenei Hs.143929.

    3D structure databases

    ProteinModelPortali Q9BXN2.
    SMRi Q9BXN2. Positions 120-245.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122206. 6 interactions.
    IntActi Q9BXN2. 5 interactions.

    Chemistry

    ChEMBLi CHEMBL2034810.

    PTM databases

    PhosphoSitei Q9BXN2.

    Polymorphism databases

    DMDMi 74752433.

    Proteomic databases

    PaxDbi Q9BXN2.
    PRIDEi Q9BXN2.

    Protocols and materials databases

    DNASUi 64581.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000298523 ; ENSP00000298523 ; ENSG00000172243 . [Q9BXN2-7 ]
    ENST00000304084 ; ENSP00000302569 ; ENSG00000172243 . [Q9BXN2-1 ]
    ENST00000310002 ; ENSP00000312089 ; ENSG00000172243 . [Q9BXN2-9 ]
    ENST00000349926 ; ENSP00000344723 ; ENSG00000172243 . [Q9BXN2-8 ]
    ENST00000353231 ; ENSP00000266456 ; ENSG00000172243 . [Q9BXN2-2 ]
    ENST00000396484 ; ENSP00000379743 ; ENSG00000172243 . [Q9BXN2-5 ]
    ENST00000465100 ; ENSP00000436923 ; ENSG00000172243 . [Q9BXN2-10 ]
    ENST00000529761 ; ENSP00000432876 ; ENSG00000172243 . [Q9BXN2-1 ]
    ENST00000531192 ; ENSP00000434392 ; ENSG00000172243 . [Q9BXN2-4 ]
    ENST00000533022 ; ENSP00000431461 ; ENSG00000172243 . [Q9BXN2-3 ]
    GeneIDi 64581.
    KEGGi hsa:64581.
    UCSCi uc001qxf.2. human. [Q9BXN2-2 ]
    uc001qxg.2. human. [Q9BXN2-1 ]
    uc001qxh.2. human. [Q9BXN2-7 ]
    uc001qxi.2. human. [Q9BXN2-3 ]
    uc001qxj.2. human. [Q9BXN2-5 ]
    uc001qxn.3. human. [Q9BXN2-9 ]
    uc021quz.1. human. [Q9BXN2-6 ]

    Organism-specific databases

    CTDi 64581.
    GeneCardsi GC12M010269.
    H-InvDB HIX0010422.
    HGNCi HGNC:14558. CLEC7A.
    HPAi HPA043244.
    MIMi 606264. gene.
    613108. phenotype.
    614079. phenotype.
    neXtProti NX_Q9BXN2.
    Orphaneti 1334. Chronic mucocutaneous candidiasis.
    PharmGKBi PA26581.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG327853.
    HOGENOMi HOG000151249.
    HOVERGENi HBG105854.
    InParanoidi Q9BXN2.
    KOi K10074.
    OMAi TEGPWLW.
    OrthoDBi EOG747PJT.
    PhylomeDBi Q9BXN2.
    TreeFami TF336674.

    Miscellaneous databases

    GeneWikii CLEC7A.
    GenomeRNAii 64581.
    NextBioi 66517.
    PROi Q9BXN2.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BXN2.
    Bgeei Q9BXN2.
    Genevestigatori Q9BXN2.

    Family and domain databases

    Gene3Di 3.10.100.10. 1 hit.
    InterProi IPR001304. C-type_lectin.
    IPR016186. C-type_lectin-like.
    IPR016187. C-type_lectin_fold.
    [Graphical view ]
    Pfami PF00059. Lectin_C. 1 hit.
    [Graphical view ]
    SMARTi SM00034. CLECT. 1 hit.
    [Graphical view ]
    SUPFAMi SSF56436. SSF56436. 1 hit.
    PROSITEi PS50041. C_TYPE_LECTIN_2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "A novel cluster of lectin-like receptor genes expressed in monocytic, dendritic and endothelial cells maps close to the NK receptor genes in the human NK gene complex."
      Sobanov Y., Bernreiter A., Derdak S., Mechtcheriakova D., Schweighofer B., Duechler M., Kalthoff F., Hofer E.
      Eur. J. Immunol. 31:3493-3503(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    2. "Identification of a human homologue of the dendritic cell-associated C-type lectin-1, dectin-1."
      Yokota K., Takashima A., Bergstresser P.R., Ariizumi K.
      Gene 272:51-60(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), TISSUE SPECIFICITY.
      Tissue: Peripheral blood leukocyte.
    3. "Cloning of human DECTIN-1, a novel C-type lectin-like receptor gene expressed on dendritic cells."
      Hermanz-Falcon P., Arce I., Roda-Navarro P., Fernandez-Ruiz E.
      Immunogenetics 53:288-295(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2 AND 7), TISSUE SPECIFICITY.
      Tissue: Peripheral blood leukocyte.
    4. "Characterization of the human beta-glucan receptor and its alternatively spliced isoforms."
      Willment J.A., Gordon S., Brown G.D.
      J. Biol. Chem. 276:43818-43823(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 7; 8 AND 10), FUNCTION, TISSUE SPECIFICITY.
      Tissue: Peripheral blood leukocyte.
    5. "Molecular and functional characterization of human Dectin-1."
      Gruenebach F., Weck M.M., Reichert J., Brossart P.
      Exp. Hematol. 30:1309-1315(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INDUCTION, TISSUE SPECIFICITY.
      Tissue: Dendritic cell.
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    7. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 5 AND 7).
      Tissue: Umbilical cord blood.
    8. "The finished DNA sequence of human chromosome 12."
      Scherer S.E., Muzny D.M., Buhay C.J., Chen R., Cree A., Ding Y., Dugan-Rocha S., Gill R., Gunaratne P., Harris R.A., Hawes A.C., Hernandez J., Hodgson A.V., Hume J., Jackson A., Khan Z.M., Kovar-Smith C., Lewis L.R.
      , Lozado R.J., Metzker M.L., Milosavljevic A., Miner G.R., Montgomery K.T., Morgan M.B., Nazareth L.V., Scott G., Sodergren E., Song X.-Z., Steffen D., Lovering R.C., Wheeler D.A., Worley K.C., Yuan Y., Zhang Z., Adams C.Q., Ansari-Lari M.A., Ayele M., Brown M.J., Chen G., Chen Z., Clerc-Blankenburg K.P., Davis C., Delgado O., Dinh H.H., Draper H., Gonzalez-Garay M.L., Havlak P., Jackson L.R., Jacob L.S., Kelly S.H., Li L., Li Z., Liu J., Liu W., Lu J., Maheshwari M., Nguyen B.-V., Okwuonu G.O., Pasternak S., Perez L.M., Plopper F.J.H., Santibanez J., Shen H., Tabor P.E., Verduzco D., Waldron L., Wang Q., Williams G.A., Zhang J., Zhou J., Allen C.C., Amin A.G., Anyalebechi V., Bailey M., Barbaria J.A., Bimage K.E., Bryant N.P., Burch P.E., Burkett C.E., Burrell K.L., Calderon E., Cardenas V., Carter K., Casias K., Cavazos I., Cavazos S.R., Ceasar H., Chacko J., Chan S.N., Chavez D., Christopoulos C., Chu J., Cockrell R., Cox C.D., Dang M., Dathorne S.R., David R., Davis C.M., Davy-Carroll L., Deshazo D.R., Donlin J.E., D'Souza L., Eaves K.A., Egan A., Emery-Cohen A.J., Escotto M., Flagg N., Forbes L.D., Gabisi A.M., Garza M., Hamilton C., Henderson N., Hernandez O., Hines S., Hogues M.E., Huang M., Idlebird D.G., Johnson R., Jolivet A., Jones S., Kagan R., King L.M., Leal B., Lebow H., Lee S., LeVan J.M., Lewis L.C., London P., Lorensuhewa L.M., Loulseged H., Lovett D.A., Lucier A., Lucier R.L., Ma J., Madu R.C., Mapua P., Martindale A.D., Martinez E., Massey E., Mawhiney S., Meador M.G., Mendez S., Mercado C., Mercado I.C., Merritt C.E., Miner Z.L., Minja E., Mitchell T., Mohabbat F., Mohabbat K., Montgomery B., Moore N., Morris S., Munidasa M., Ngo R.N., Nguyen N.B., Nickerson E., Nwaokelemeh O.O., Nwokenkwo S., Obregon M., Oguh M., Oragunye N., Oviedo R.J., Parish B.J., Parker D.N., Parrish J., Parks K.L., Paul H.A., Payton B.A., Perez A., Perrin W., Pickens A., Primus E.L., Pu L.-L., Puazo M., Quiles M.M., Quiroz J.B., Rabata D., Reeves K., Ruiz S.J., Shao H., Sisson I., Sonaike T., Sorelle R.P., Sutton A.E., Svatek A.F., Svetz L.A., Tamerisa K.S., Taylor T.R., Teague B., Thomas N., Thorn R.D., Trejos Z.Y., Trevino B.K., Ukegbu O.N., Urban J.B., Vasquez L.I., Vera V.A., Villasana D.M., Wang L., Ward-Moore S., Warren J.T., Wei X., White F., Williamson A.L., Wleczyk R., Wooden H.S., Wooden S.H., Yen J., Yoon L., Yoon V., Zorrilla S.E., Nelson D., Kucherlapati R., Weinstock G., Gibbs R.A.
      Nature 440:346-351(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 6 AND 9).
      Tissue: Colon, Lung and Urinary bladder.
    11. "Human Dectin-1 isoform E is a cytoplasmic protein and interacts with RanBPM."
      Xie J., Sun M., Guo L., Liu W., Jiang J., Chen X., Zhou L., Gu J.
      Biochem. Biophys. Res. Commun. 347:1067-1073(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: INTERACTION WITH RANBP9, SUBCELLULAR LOCATION.
    12. Cited for: FUNCTION, SUBCELLULAR LOCATION.
    13. Cited for: INVOLVEMENT IN CANDF4.
    14. "Dectin-1 Y238X polymorphism associates with susceptibility to invasive aspergillosis in hematopoietic transplantation through impairment of both recipient- and donor-dependent mechanisms of antifungal immunity."
      Cunha C., Di Ianni M., Bozza S., Giovannini G., Zagarella S., Zelante T., D'Angelo C., Pierini A., Pitzurra L., Falzetti F., Carotti A., Perruccio K., Latge J.P., Rodrigues F., Velardi A., Aversa F., Romani L., Carvalho A.
      Blood 116:5394-5402(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: POLYMORPHISM.

    Entry informationi

    Entry nameiCLC7A_HUMAN
    AccessioniPrimary (citable) accession number: Q9BXN2
    Secondary accession number(s): B2R861
    , B7Z494, B7Z5A9, B7Z5B9, Q6IPS7, Q96D32, Q96DR9, Q96LD3, Q96PA4, Q96PA5, Q96PA6, Q96PA7, Q96PA8, Q9H1K3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 12, 2006
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 112 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 12
      Human chromosome 12: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3