Q9BXM9 (FSD1L_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: FSD1-like protein Alternative name(s): Coiled-coil domain-containing protein 10 FSD1 N-terminal-like protein | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 530 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Sequence similarities | Contains 1 B30.2/SPRY domain. Contains 1 COS domain. Contains 1 fibronectin type-III domain. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Domain | Coiled coil |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BXM9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 2 (identifier: Q9BXM9-2) The sequence of this isoform differs from the canonical sequence as follows: 6-37: Missing. | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 (identifier: Q9BXM9-3) The sequence of this isoform differs from the canonical sequence as follows: 6-37: Missing. 148-177: AARQIKDRVTMASAFRLSLKPKVSDNMTHL → VHKNCINTLNKGSCIFKKAFLFFFSFGFLY 178-530: Missing. | ||||||
| Note: Due to intron retention. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 530 | 530 | FSD1-like protein | PRO_0000089405 | |||||
Regions | |||||||||
| Domain | 137 – 194 | 58 | COS | ||||||
| Domain | 195 – 299 | 105 | Fibronectin type-III | ||||||
| Domain | 300 – 506 | 207 | B30.2/SPRY | ||||||
| Coiled coil | 102 – 141 | 40 | Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 520 | 1 | Phosphoserine Ref.5 | ||||||
| Modified residue | 523 | 1 | Phosphoserine Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 6 – 37 | 32 | Missing in isoform 2 and isoform 3. | VSP_039645 | |||||
| Alternative sequence | 148 – 177 | 30 | AARQI…NMTHL → VHKNCINTLNKGSCIFKKAF LFFFSFGFLY in isoform 3. | VSP_039646 | |||||
| Alternative sequence | 178 – 530 | 353 | Missing in isoform 3. | VSP_039647 | |||||
Experimental info | |||||||||
| Sequence conflict | 39 | 1 | A → S in BAH13012. Ref.2 | ||||||
| Sequence conflict | 342 | 1 | Missing in BAH13049. Ref.2 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF316830 mRNA. Translation: AAK26748.1. AK299350 mRNA. Translation: BAH13012.1. AK299491 mRNA. Translation: BAH13049.1. AL161627 Genomic DNA. Translation: CAI13072.1. AL161627, AL158070 Genomic DNA. Translation: CAI13073.2. AL158070, AL161627 Genomic DNA. Translation: CAM14451.1. |
| IPI | IPI00011117. IPI00513845. IPI00921807. |
| RefSeq | NP_001138785.1. NM_001145313.1. NP_114125.1. NM_031919.3. NP_997530.2. NM_207647.2. |
| UniGene | Hs.136901. |
3D structure databases | |
| ProteinModelPortal | Q9BXM9. |
| SMR | Q9BXM9. Positions 191-308, 374-488. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9BXM9. 1 interaction. |
| STRING | 9606.ENSP00000417492. |
PTM databases | |
| PhosphoSite | Q9BXM9. |
Polymorphism databases | |
| DMDM | 302393701. |
Proteomic databases | |
| PaxDb | Q9BXM9. |
| PRIDE | Q9BXM9. |
Protocols and materials databases | |
| DNASU | 83856. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000374710; ENSP00000363842; ENSG00000106701. ENST00000374716; ENSP00000363848; ENSG00000106701. ENST00000481272; ENSP00000417492; ENSG00000106701. ENST00000484973; ENSP00000419691; ENSG00000106701. |
| GeneID | 83856. |
| KEGG | hsa:83856. |
| UCSC | uc004bcp.3. human. uc004bcq.2. human. uc011lvv.1. human. |
Organism-specific databases | |
| CTD | 83856. |
| GeneCards | GC09P108210. |
| HGNC | HGNC:13753. FSD1L. |
| HPA | HPA035138. |
| MIM | 609829. gene. |
| neXtProt | NX_Q9BXM9. |
| PharmGKB | PA26931. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG302398. |
| HOGENOM | HOG000231656. |
| HOVERGEN | HBG107931. |
| OMA | QSQLSQC. |
Gene expression databases | |
| ArrayExpress | Q9BXM9. |
| Bgee | Q9BXM9. |
| CleanEx | HS_FSD1L. |
| Genevestigator | Q9BXM9. |
| GermOnline | ENSG00000106701. Homo sapiens. |
Family and domain databases | |
| Gene3D | 2.60.40.10. 1 hit. |
| InterPro | IPR001870. B30.2/SPRY. IPR003879. Butyrophylin. IPR008985. ConA-like_lec_gl_sf. IPR017903. COS_domain. IPR003961. Fibronectin_type3. IPR013783. Ig-like_fold. IPR003877. SPRY_rcpt. [Graphical view] |
| Pfam | PF00041. fn3. 1 hit. PF00622. SPRY. 1 hit. [Graphical view] |
| PRINTS | PR01407. BUTYPHLNCDUF. |
| SMART | SM00060. FN3. 1 hit. [Graphical view] |
| SUPFAM | SSF49899. ConA_like_lec_gl. 1 hit. SSF49265. FN_III-like. 1 hit. |
| PROSITE | PS50188. B302_SPRY. 1 hit. PS51262. COS. 1 hit. PS50853. FN3. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 83856. |
| NextBio | 35460755. |
| SOURCE | Search... |
Entry information
| Entry name | FSD1L_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BXM9 Secondary accession number(s): A2A338 Q5T880 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 9 Human chromosome 9: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
