Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BXM9 (FSD1L_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified March 19, 2014. Version 93. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
FSD1-like protein
Alternative name(s):
Coiled-coil domain-containing protein 10
FSD1 N-terminal-like protein
Gene names
Name:FSD1L
Synonyms:CCDC10, CSDUFD1, FSD1CL, FSD1NL
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length530 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Sequence similarities

Contains 1 B30.2/SPRY domain.

Contains 1 COS domain.

Contains 1 fibronectin type-III domain.

Ontologies

Keywords
   Coding sequence diversityAlternative splicing
   DomainCoiled coil
   PTMAcetylation
Phosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
None. [Check GOA]

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BXM9-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Note: No experimental confirmation available.
Isoform 2 (identifier: Q9BXM9-2)

The sequence of this isoform differs from the canonical sequence as follows:
     6-37: Missing.
Note: No experimental confirmation available. Contains a N-acetylmethionine at position 1.
Isoform 3 (identifier: Q9BXM9-3)

The sequence of this isoform differs from the canonical sequence as follows:
     6-37: Missing.
     148-177: AARQIKDRVTMASAFRLSLKPKVSDNMTHL → VHKNCINTLNKGSCIFKKAFLFFFSFGFLY
     178-530: Missing.
Note: Due to intron retention. Contains a N-acetylmethionine at position 1.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 530530FSD1-like protein
PRO_0000089405

Regions

Domain137 – 19458COS
Domain196 – 300105Fibronectin type-III
Domain300 – 506207B30.2/SPRY
Coiled coil102 – 14140 Potential

Amino acid modifications

Modified residue5201Phosphoserine Ref.5
Modified residue5231Phosphoserine Ref.4

Natural variations

Alternative sequence6 – 3732Missing in isoform 2 and isoform 3.
VSP_039645
Alternative sequence148 – 17730AARQI…NMTHL → VHKNCINTLNKGSCIFKKAF LFFFSFGFLY in isoform 3.
VSP_039646
Alternative sequence178 – 530353Missing in isoform 3.
VSP_039647

Experimental info

Sequence conflict391A → S in BAH13012. Ref.2
Sequence conflict3421Missing in BAH13049. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified August 10, 2010. Version 2.
Checksum: B2AC94D87F6B6DA1

FASTA53059,578
        10         20         30         40         50         60 
MDSQKYCFKE NENVTVDKAC FLISNITIGP ESINLQQEAL QRIISTLANK NDEIQNFIDT 

        70         80         90        100        110        120 
LHHTLKGVQE NSSNILSELD EEFDSLYSIL DEVKESMINC IKQEQARKSQ ELQSQISQCN 

       130        140        150        160        170        180 
NALENSEELL EFATRSLDIK EPEEFSKAAR QIKDRVTMAS AFRLSLKPKV SDNMTHLMVD 

       190        200        210        220        230        240 
FSQERQMLQT LKFLPVPKAP EIDPVECLVA DNSVTVAWRM PEEDNKIDHF ILEHRKTNFD 

       250        260        270        280        290        300 
GLPRVKDERC WEIIDNIKGT EYTLSGLKFD SKYMNFRVRA CNKAVAGEYS DPVTLETKAL 

       310        320        330        340        350        360 
NFNLDNSSSH LNLKVEDTCV EWDPTGGKGQ ESKIKGKENK GRSGTPSPKR TSVGSRPPAV 

       370        380        390        400        410        420 
RGSRDRFTGE SYTVLGDTAI ESGQHYWEVK AQKDCKSYSV GVAYKTLGKF DQLGKTNTSW 

       430        440        450        460        470        480 
CIHVNNWLQN TFAAKHNNKV KALDVTVPEK IGVFCDFDGG QLSFYDANSK QLLYSFKTKF 

       490        500        510        520        530 
TQPVLPGFMV WCGGLSLSTG MQVPSAVRTL QKSENGMTGS ASSLNNVVTQ 

« Hide

Isoform 2 [UniParc].

Checksum: E534AF3B2960462A
Show »

FASTA49855,964
Isoform 3 [UniParc].

Checksum: B010A13F7B61FFFA
Show »

FASTA14516,767

References

« Hide 'large scale' references
[1]"Characterization of human FSD1, a novel brain specific gene on chromosome 19 with paralogy to 9q31."
Carim-Todd L., Escarceller M., Estivill X., Sumoy L.
Biochim. Biophys. Acta 1518:200-203(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3).
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
[3]"DNA sequence and analysis of human chromosome 9."
Humphray S.J., Oliver K., Hunt A.R., Plumb R.W., Loveland J.E., Howe K.L., Andrews T.D., Searle S., Hunt S.E., Scott C.E., Jones M.C., Ainscough R., Almeida J.P., Ambrose K.D., Ashwell R.I.S., Babbage A.K., Babbage S., Bagguley C.L. expand/collapse author list , Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beasley H., Beasley O., Bird C.P., Bray-Allen S., Brown A.J., Brown J.Y., Burford D., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Chen Y., Clarke G., Clark S.Y., Clee C.M., Clegg S., Collier R.E., Corby N., Crosier M., Cummings A.T., Davies J., Dhami P., Dunn M., Dutta I., Dyer L.W., Earthrowl M.E., Faulkner L., Fleming C.J., Frankish A., Frankland J.A., French L., Fricker D.G., Garner P., Garnett J., Ghori J., Gilbert J.G.R., Glison C., Grafham D.V., Gribble S., Griffiths C., Griffiths-Jones S., Grocock R., Guy J., Hall R.E., Hammond S., Harley J.L., Harrison E.S.I., Hart E.A., Heath P.D., Henderson C.D., Hopkins B.L., Howard P.J., Howden P.J., Huckle E., Johnson C., Johnson D., Joy A.A., Kay M., Keenan S., Kershaw J.K., Kimberley A.M., King A., Knights A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C., Lloyd D.M., Lovell J., Martin S., Mashreghi-Mohammadi M., Matthews L., McLaren S., McLay K.E., McMurray A., Milne S., Nickerson T., Nisbett J., Nordsiek G., Pearce A.V., Peck A.I., Porter K.M., Pandian R., Pelan S., Phillimore B., Povey S., Ramsey Y., Rand V., Scharfe M., Sehra H.K., Shownkeen R., Sims S.K., Skuce C.D., Smith M., Steward C.A., Swarbreck D., Sycamore N., Tester J., Thorpe A., Tracey A., Tromans A., Thomas D.W., Wall M., Wallis J.M., West A.P., Whitehead S.L., Willey D.L., Williams S.A., Wilming L., Wray P.W., Young L., Ashurst J.L., Coulson A., Blocker H., Durbin R.M., Sulston J.E., Hubbard T., Jackson M.J., Bentley D.R., Beck S., Rogers J., Dunham I.
Nature 429:369-374(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-523, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[5]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-520, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[6]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1 (ISOFORMS 2 AND 3), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF316830 mRNA. Translation: AAK26748.1.
AK299350 mRNA. Translation: BAH13012.1.
AK299491 mRNA. Translation: BAH13049.1.
AL161627 Genomic DNA. Translation: CAI13072.1.
AL161627, AL158070 Genomic DNA. Translation: CAI13073.2.
AL158070, AL161627 Genomic DNA. Translation: CAM14451.1.
RefSeqNP_001138785.1. NM_001145313.2.
NP_001274120.1. NM_001287191.1.
NP_001274121.1. NM_001287192.1.
NP_114125.1. NM_031919.4.
UniGeneHs.136901.

3D structure databases

ProteinModelPortalQ9BXM9.
SMRQ9BXM9. Positions 194-498.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123772. 4 interactions.
IntActQ9BXM9. 1 interaction.
STRING9606.ENSP00000417492.

PTM databases

PhosphoSiteQ9BXM9.

Polymorphism databases

DMDM302393701.

Proteomic databases

PaxDbQ9BXM9.
PRIDEQ9BXM9.

Protocols and materials databases

DNASU83856.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000374710; ENSP00000363842; ENSG00000106701. [Q9BXM9-2]
ENST00000374716; ENSP00000363848; ENSG00000106701. [Q9BXM9-3]
ENST00000481272; ENSP00000417492; ENSG00000106701. [Q9BXM9-1]
ENST00000484973; ENSP00000419691; ENSG00000106701.
GeneID83856.
KEGGhsa:83856.
UCSCuc004bcp.3. human. [Q9BXM9-3]
uc004bcq.2. human. [Q9BXM9-2]
uc011lvv.1. human. [Q9BXM9-1]

Organism-specific databases

CTD83856.
GeneCardsGC09P108210.
HGNCHGNC:13753. FSD1L.
HPAHPA035138.
MIM609829. gene.
neXtProtNX_Q9BXM9.
PharmGKBPA26931.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG302398.
HOGENOMHOG000231656.
HOVERGENHBG107931.
OMAQSQLSQC.
TreeFamTF333654.

Gene expression databases

ArrayExpressQ9BXM9.
BgeeQ9BXM9.
CleanExHS_FSD1L.
GenevestigatorQ9BXM9.

Family and domain databases

Gene3D2.60.40.10. 1 hit.
InterProIPR001870. B30.2/SPRY.
IPR003879. Butyrophylin.
IPR008985. ConA-like_lec_gl_sf.
IPR017903. COS_domain.
IPR003961. Fibronectin_type3.
IPR013783. Ig-like_fold.
IPR003877. SPRY_rcpt.
[Graphical view]
PfamPF00041. fn3. 1 hit.
PF00622. SPRY. 1 hit.
[Graphical view]
PRINTSPR01407. BUTYPHLNCDUF.
SMARTSM00060. FN3. 1 hit.
[Graphical view]
SUPFAMSSF49265. SSF49265. 1 hit.
SSF49899. SSF49899. 1 hit.
PROSITEPS50188. B302_SPRY. 1 hit.
PS51262. COS. 1 hit.
PS50853. FN3. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi83856.
NextBio35460755.
PROQ9BXM9.
SOURCESearch...

Entry information

Entry nameFSD1L_HUMAN
AccessionPrimary (citable) accession number: Q9BXM9
Secondary accession number(s): A2A338 expand/collapse secondary AC list , A6NKH7, B7Z5S6, B7Z5W3, Q5T879, Q5T880
Entry history
Integrated into UniProtKB/Swiss-Prot: November 23, 2004
Last sequence update: August 10, 2010
Last modified: March 19, 2014
This is version 93 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 9

Human chromosome 9: entries, gene names and cross-references to MIM