Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Complement C1q tumor necrosis factor-related protein 3

Gene

C1QTNF3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

  • cellular triglyceride homeostasis Source: UniProtKB
  • fat cell differentiation Source: UniProtKB
  • negative regulation of gene expression Source: UniProtKB
  • negative regulation of gluconeogenesis Source: UniProtKB
  • negative regulation of inflammatory response Source: UniProtKB
  • negative regulation of interleukin-6 secretion Source: UniProtKB
  • negative regulation of monocyte chemotactic protein-1 production Source: UniProtKB
  • negative regulation of NF-kappaB import into nucleus Source: UniProtKB
  • positive regulation of adiponectin secretion Source: UniProtKB
  • positive regulation of cytokine secretion Source: UniProtKB
  • protein trimerization Source: UniProtKB
Complete GO annotation...

Names & Taxonomyi

Protein namesi
Recommended name:
Complement C1q tumor necrosis factor-related protein 3
Alternative name(s):
Collagenous repeat-containing sequence 26 kDa protein
Short name:
CORS26
Secretory protein CORS26
Gene namesi
Name:C1QTNF3
Synonyms:CTRP3
ORF Names:UNQ753/PRO1484
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:14326. C1QTNF3.

Subcellular locationi

GO - Cellular componenti

  • cell Source: GOC
  • collagen trimer Source: UniProtKB-KW
  • extracellular exosome Source: UniProtKB
  • extracellular space Source: UniProtKB
  • membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA25630.

Polymorphism and mutation databases

BioMutaiC1QTNF3.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2222Sequence analysisAdd
BLAST
Chaini23 – 246224Complement C1q tumor necrosis factor-related protein 3PRO_0000003531Add
BLAST

Post-translational modificationi

Isoform 3: Glycosylated on Asn-70.

Keywords - PTMi

Glycoprotein

Proteomic databases

PaxDbiQ9BXJ4.
PeptideAtlasiQ9BXJ4.
PRIDEiQ9BXJ4.

PTM databases

iPTMnetiQ9BXJ4.

Expressioni

Tissue specificityi

Expressed in colon and small intestine.1 Publication

Gene expression databases

BgeeiQ9BXJ4.
CleanExiHS_C1QTNF3.
GenevisibleiQ9BXJ4. HS.

Interactioni

Protein-protein interaction databases

BioGridi125390. 2 interactions.
IntActiQ9BXJ4. 1 interaction.
STRINGi9606.ENSP00000371497.

Structurei

3D structure databases

ProteinModelPortaliQ9BXJ4.
SMRiQ9BXJ4. Positions 116-244.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini51 – 11363Collagen-likeAdd
BLAST
Domaini113 – 246134C1qPROSITE-ProRule annotationAdd
BLAST

Sequence similaritiesi

Contains 1 C1q domain.PROSITE-ProRule annotation
Contains 1 collagen-like domain.Curated

Keywords - Domaini

Collagen, Signal

Phylogenomic databases

eggNOGiENOG410IJ69. Eukaryota.
ENOG410Y296. LUCA.
GeneTreeiENSGT00760000119052.
HOGENOMiHOG000085658.
HOVERGENiHBG108220.
InParanoidiQ9BXJ4.
OMAiLVYWQLL.
PhylomeDBiQ9BXJ4.
TreeFamiTF329591.

Family and domain databases

Gene3Di2.60.120.40. 1 hit.
InterProiIPR001073. C1q_dom.
IPR008160. Collagen.
IPR008983. Tumour_necrosis_fac-like_dom.
[Graphical view]
PfamiPF00386. C1q. 1 hit.
PF01391. Collagen. 1 hit.
[Graphical view]
PRINTSiPR00007. COMPLEMNTC1Q.
SMARTiSM00110. C1Q. 1 hit.
[Graphical view]
SUPFAMiSSF49842. SSF49842. 1 hit.
PROSITEiPS50871. C1Q. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BXJ4-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLWRQLIYWQ LLALFFLPFC LCQDEYMESP QTGGLPPDCS KCCHGDYSFR
60 70 80 90 100
GYQGPPGPPG PPGIPGNHGN NGNNGATGHE GAKGEKGDKG DLGPRGERGQ
110 120 130 140 150
HGPKGEKGYP GIPPELQIAF MASLATHFSN QNSGIIFSSV ETNIGNFFDV
160 170 180 190 200
MTGRFGAPVS GVYFFTFSMM KHEDVEEVYV YLMHNGNTVF SMYSYEMKGK
210 220 230 240
SDTSSNHAVL KLAKGDEVWL RMGNGALHGD HQRFSTFAGF LLFETK
Length:246
Mass (Da):26,994
Last modified:June 1, 2001 - v1
Checksum:iC589B6C3A73E5D29
GO
Isoform 2 (identifier: Q9BXJ4-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     46-69: Missing.
     82-105: Missing.

Note: No experimental confirmation available.
Show »
Length:198
Mass (Da):22,177
Checksum:iAC84CC13912ED445
GO
Isoform 3 (identifier: Q9BXJ4-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     28-28: E → EVSGRTNKVVARIVQSHQQTGRSGSRREKVRERSHPKTGTVDNNTSTDLKSLRPDELPHPEVDDLAQITTFWGQ

Note: N-glycosylated at Asn-70.
Show »
Length:319
Mass (Da):35,183
Checksum:iEC12962E5B726F00
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei28 – 281E → EVSGRTNKVVARIVQSHQQT GRSGSRREKVRERSHPKTGT VDNNTSTDLKSLRPDELPHP EVDDLAQITTFWGQ in isoform 3. 3 PublicationsVSP_043157
Alternative sequencei46 – 6924Missing in isoform 2. 1 PublicationVSP_011624Add
BLAST
Alternative sequencei82 – 10524Missing in isoform 2. 1 PublicationVSP_011625Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF329837 mRNA. Translation: AAK17961.1.
AF326976 mRNA. Translation: AAK70344.1.
EU399231 mRNA. Translation: ABY86416.1.
EU399232 mRNA. Translation: ABY86417.1.
AY358388 mRNA. Translation: AAQ88754.1.
AK295968 mRNA. Translation: BAG58744.1.
AK315921 mRNA. Translation: BAH14292.1.
AK075533 mRNA. Translation: BAC11676.1.
BX640995 mRNA. Translation: CAE45998.1.
AC139783 Genomic DNA. No translation available.
AC139792 Genomic DNA. No translation available.
CH471118 Genomic DNA. Translation: EAX10820.1.
BC112925 mRNA. Translation: AAI12926.1.
BC120990 mRNA. Translation: AAI20991.1.
AF173888 mRNA. Translation: AAQ13635.1.
CCDSiCCDS34141.1. [Q9BXJ4-3]
CCDS3904.1. [Q9BXJ4-1]
RefSeqiNP_112207.1. NM_030945.3. [Q9BXJ4-1]
NP_852100.3. NM_181435.5. [Q9BXJ4-3]
UniGeneiHs.171929.

Genome annotation databases

EnsembliENST00000231338; ENSP00000231338; ENSG00000082196. [Q9BXJ4-1]
ENST00000382065; ENSP00000371497; ENSG00000082196. [Q9BXJ4-3]
GeneIDi114899.
KEGGihsa:114899.
UCSCiuc003jin.4. human. [Q9BXJ4-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF329837 mRNA. Translation: AAK17961.1.
AF326976 mRNA. Translation: AAK70344.1.
EU399231 mRNA. Translation: ABY86416.1.
EU399232 mRNA. Translation: ABY86417.1.
AY358388 mRNA. Translation: AAQ88754.1.
AK295968 mRNA. Translation: BAG58744.1.
AK315921 mRNA. Translation: BAH14292.1.
AK075533 mRNA. Translation: BAC11676.1.
BX640995 mRNA. Translation: CAE45998.1.
AC139783 Genomic DNA. No translation available.
AC139792 Genomic DNA. No translation available.
CH471118 Genomic DNA. Translation: EAX10820.1.
BC112925 mRNA. Translation: AAI12926.1.
BC120990 mRNA. Translation: AAI20991.1.
AF173888 mRNA. Translation: AAQ13635.1.
CCDSiCCDS34141.1. [Q9BXJ4-3]
CCDS3904.1. [Q9BXJ4-1]
RefSeqiNP_112207.1. NM_030945.3. [Q9BXJ4-1]
NP_852100.3. NM_181435.5. [Q9BXJ4-3]
UniGeneiHs.171929.

3D structure databases

ProteinModelPortaliQ9BXJ4.
SMRiQ9BXJ4. Positions 116-244.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi125390. 2 interactions.
IntActiQ9BXJ4. 1 interaction.
STRINGi9606.ENSP00000371497.

PTM databases

iPTMnetiQ9BXJ4.

Polymorphism and mutation databases

BioMutaiC1QTNF3.

Proteomic databases

PaxDbiQ9BXJ4.
PeptideAtlasiQ9BXJ4.
PRIDEiQ9BXJ4.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000231338; ENSP00000231338; ENSG00000082196. [Q9BXJ4-1]
ENST00000382065; ENSP00000371497; ENSG00000082196. [Q9BXJ4-3]
GeneIDi114899.
KEGGihsa:114899.
UCSCiuc003jin.4. human. [Q9BXJ4-1]

Organism-specific databases

CTDi114899.
GeneCardsiC1QTNF3.
H-InvDBHIX0004793.
HGNCiHGNC:14326. C1QTNF3.
MIMi612045. gene.
neXtProtiNX_Q9BXJ4.
PharmGKBiPA25630.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IJ69. Eukaryota.
ENOG410Y296. LUCA.
GeneTreeiENSGT00760000119052.
HOGENOMiHOG000085658.
HOVERGENiHBG108220.
InParanoidiQ9BXJ4.
OMAiLVYWQLL.
PhylomeDBiQ9BXJ4.
TreeFamiTF329591.

Miscellaneous databases

GeneWikiiC1QTNF3.
GenomeRNAii114899.
PROiQ9BXJ4.
SOURCEiSearch...

Gene expression databases

BgeeiQ9BXJ4.
CleanExiHS_C1QTNF3.
GenevisibleiQ9BXJ4. HS.

Family and domain databases

Gene3Di2.60.120.40. 1 hit.
InterProiIPR001073. C1q_dom.
IPR008160. Collagen.
IPR008983. Tumour_necrosis_fac-like_dom.
[Graphical view]
PfamiPF00386. C1q. 1 hit.
PF01391. Collagen. 1 hit.
[Graphical view]
PRINTSiPR00007. COMPLEMNTC1Q.
SMARTiSM00110. C1Q. 1 hit.
[Graphical view]
SUPFAMiSSF49842. SSF49842. 1 hit.
PROSITEiPS50871. C1Q. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Homo sapiens complement-c1q tumor necrosis factor-related protein."
    Piddington C.S., Bishop P.
    Submitted (DEC-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  2. "Molecular cloning, chromosomal localization, and genomic structure of the human CORS26 gene."
    Maeda T., Hayashi A., Saito T.
    Submitted (DEC-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "C1q/TNF-related protein-3 (CTRP3), a novel adipokine that regulates hepatic glucose output."
    Peterson J.M., Wei Z., Wong G.W.
    J. Biol. Chem. 285:39691-39701(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  5. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Cerebellum and Substantia nigra.
  6. "Signal sequence and keyword trap in silico for selection of full-length human cDNAs encoding secretion or membrane proteins from oligo-capped cDNA libraries."
    Otsuki T., Ota T., Nishikawa T., Hayashi K., Suzuki Y., Yamamoto J., Wakamatsu A., Kimura K., Sakamoto K., Hatano N., Kawai Y., Ishii S., Saito K., Kojima S., Sugiyama T., Ono T., Okano K., Yoshikawa Y.
    , Aotsuka S., Sasaki N., Hattori A., Okumura K., Nagai K., Sugano S., Isogai T.
    DNA Res. 12:117-126(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Embryo.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Salivary gland.
  8. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
  11. "Homo sapiens normal aorta mRNA MST113."
    Hui R.T., Liu Y.Q., Wang X.Y., Qin B.M., Sheng H.
    Submitted (AUG-1999) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 121-246 (ISOFORM 1).
    Tissue: Aorta.
  12. "Genomic organization, promoter, amino acid sequence, chromosomal localization, and expression of the human gene for CORS-26 (collagenous repeat-containing sequence of 26-kDa protein)."
    Schaffler A., Ehling A., Neumann E., Herfarth H., Paul G., Tarner I., Gay S., Scholmerich J., Muller-Ladner U.
    Biochim. Biophys. Acta 1630:123-129(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: TISSUE SPECIFICITY.
  13. Cited for: GLYCOSYLATION AT ASN-70 (ISOFORM 3).

Entry informationi

Entry nameiC1QT3_HUMAN
AccessioniPrimary (citable) accession number: Q9BXJ4
Secondary accession number(s): Q0VAN4
, Q542Y2, Q6MZN1, Q96KY1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 16, 2002
Last sequence update: June 1, 2001
Last modified: July 6, 2016
This is version 130 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.