Reviewed,
UniProtKB/Swiss-Prot Q9BXH5 (TTY6_HUMAN)
Last modified
November 24, 2009.
Version 39.
History...
Clusters with 100%,
90%,
50% identity |
Documents (2) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin · Protein attributes · General annotation (Comments) · Ontologies · Alternative products · Sequence annotation (Features) · Sequences · References · Cross-references · Entry information · Relevant documents
Names and origin
| Protein names | Recommended name: Putative transcript Y 6 protein Alternative name(s): Testis-specific Y-linked 6 | |||||||
| Gene names |
| |||||||
| Organism | Homo sapiens (Human) [Complete proteome] | |||||||
| Taxonomic identifier | 9606 [NCBI] | |||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 95 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Uncertain. |
General annotation (Comments)
| Caution | Could be the product of a pseudogene. According to Ref.3, may be a non-coding mRNA. |
Ontologies
| Keywords | |
|---|---|
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| None. [Check GOA] | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BXH5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BXH5-2) The sequence of this isoform differs from the canonical sequence as follows: 65-65: S → SVLQGLLVKWRNHDKGKSKVEQYSHSSKWTPTGA | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 95 | 95 | Putative transcript Y 6 protein | PRO_0000065687 | |||||
Natural variations | |||||||||
| Alternative sequence | 65 | 1 | S → SVLQGLLVKWRNHDKGKSKV EQYSHSSKWTPTGA in isoform 2. | VSP_026590 | |||||
Experimental info | |||||||||
| Sequence conflict | 69 | 1 | V → A in AAT09001. Ref.1 | ||||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| AY597808 mRNA. Translation: AAT09001.1. AF332237 mRNA. Translation: AAK13487.1. AC023342 Genomic DNA. No translation available. | |
| IPI | IPI00000304. IPI00472295. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | Q9BXH5. |
Proteomic databases | |
| PRIDE | Q9BXH5. |
Organism-specific databases | |
| GeneCards | GC0YM022995. GC0YP022630. |
| H-InvDB | HIX0056676. HIX0056696. |
| HGNC | HGNC:16483. TTTY6. HGNC:31887. TTTY6B. |
| MIM | 400039. gene. |
| PharmGKB | PA38151. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOVERGEN | Q9BXH5. |
Gene expression databases | |
| CleanEx | HS_TTTY6. HS_TTTY6B. |
| Genevestigator | Q9BXH5. |
| GermOnline | ENSG00000131538. Homo sapiens. ENSG00000131548. Homo sapiens. |
Family and domain databases | |
| ProtoNet | Search... |
Other Resources | |
| SOURCE | Search... |
Entry information
| Entry name | TTY6_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BXH5 Secondary accession number(s): Q6PL48 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome Y Human chromosome Y: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |

Clusters with


