Reviewed,
UniProtKB/Swiss-Prot Q9BXH1 (BBC3_HUMAN)
Last modified
November 24, 2009.
Version 60.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Bcl-2-binding component 3 Alternative name(s): p53 up-regulated modulator of apoptosis JFY-1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 193 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is not processed. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Essential mediator of p53-dependent and p53-independent apoptosis. Ref.1 |
| Subunit structure | Interacts with MCL1 and BCL2A1 By similarity. Interacts with BCL2 and BCL2L1/BCL-XL. |
| Subcellular location | Mitochondrion. Note: Localized to the mitochondria in order to induce cytochrome c release. Ref.1 Ref.2 Ref.3 |
| Tissue specificity | Ubiquitously expressed. Ref.1 |
| Induction | By DNA damage, glucocorticoid treatment, growth factor deprivation and p53. Ref.2 Ref.3 |
| Sequence similarities | Belongs to the Bcl-2 family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Cellular component | Mitochondrion |
| Coding sequence diversity | Alternative splicing |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | activation of caspase activity Ref.2 Inferred from direct assay. Source: UniProtKB induction of apoptosisInferred from direct assay. Source: HGNC negative regulation of growth Ref.2Inferred from mutant phenotype. Source: UniProtKB release of cytochrome c from mitochondria Ref.2Inferred from direct assay. Source: UniProtKB |
| Cellular component | mitochondrial outer membrane Ref.2 Inferred from Experiment. Source: Reactome |
| Molecular function | protein binding Ref.1 Ref.2 Inferred from physical interaction. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BCL2 | P10415 | 3 | EBI-519884,EBI-77694 | |
| BCL2 | P10415 | 1 | EBI-519891,EBI-77694 | |
| BCL2 | P10415 | 1 | EBI-519896,EBI-77694 | |
| BCL2A1 | Q16548 | 1 | EBI-519884,EBI-1003550 | |
| Bcl2a1 | Q07440 | 1 | EBI-519884,EBI-707754 | From a different organism. |
| BCL2L1 | Q07817 | 1 | EBI-519884,EBI-78035 | |
| BCL2L1 | Q07817-1 | 5 | EBI-519884,EBI-287195 | |
| BCL2L2 | Q92843 | 2 | EBI-519884,EBI-707714 | |
| MCL1 | Q07820 | 1 | EBI-519884,EBI-1003422 | |
| Mcl1 | P97287 | 2 | EBI-519884,EBI-707292 | From a different organism. |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BXH1-1) Also known as: PUMA alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BXH1-2) Also known as: PUMA beta; The sequence of this isoform differs from the canonical sequence as follows: 1-92: MARARQEGSS...SRPRGPRPDG → MKFGMGSAQACPCQVPRAASTTWVPCQICG | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "PUMA induces the rapid apoptosis of colorectal cancer cells." Yu J., Zhang L., Hwang P.M., Kinzler K.W., Vogelstein B. Mol. Cell 7:673-682(2001) [PubMed: 11463391] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH BCL2 AND BCL2L1, TISSUE SPECIFICITY. |
| [2] | "PUMA, a novel proapoptotic gene, is induced by p53." Nakano K., Wousden K.H. Mol. Cell 7:683-694(2001) [PubMed: 11463392] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), INDUCTION, SUBCELLULAR LOCATION. |
| [3] | "Expression of bbc3, a pro-apoptotic BH3-only gene, is regulated by diverse cell death and survival signals." Han J.-W., Flemington C., Houghton A.B., Gu Z., Zambetti G.P., Lutz R.J., Zhu L., Chittenden T. Proc. Natl. Acad. Sci. U.S.A. 98:11318-11323(2001) [PubMed: 11572983] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INDUCTION, SUBCELLULAR LOCATION. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| AF332558 mRNA. Translation: AAK31316.1. AF354654 mRNA. Translation: AAK39542.1. AF354655 mRNA. Translation: AAK39543.1. U82987 mRNA. Translation: AAB51243.2. CH471126 Genomic DNA. Translation: EAW57465.1. BC136481 mRNA. Translation: AAI36482.1. | |
| IPI | IPI00186516. IPI00941633. |
| RefSeq | NP_001120712.1. NP_001120713.1. NP_001120714.1. NP_055232.1. |
| UniGene | Hs.467020 |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| DIP | DIP:29215N. |
| IntAct | Q9BXH1. 11 interactions. |
| STRING | Q9BXH1. |
Genome annotation databases | |
| Ensembl | ENST00000359924; ENSP00000352999; ENSG00000105327; Homo sapiens. [Genome view] ENST00000439096; ENSP00000395862; ENSG00000105327; Homo sapiens. [Genome view] |
| GeneID | 27113. |
| KEGG | hsa:27113. |
| UCSC | uc002pgf.2. human. uc010eky.1. human. |
Organism-specific databases | |
| CTD | 27113. |
| GeneCards | GC19M052415. |
| H-InvDB | HIX0027462. |
| HGNC | HGNC:17868. BBC3. |
| HPA | CAB007752. |
| MIM | 605854. gene. |
| PharmGKB | PA38471. |
| GenAtlas | Search... |
Phylogenomic databases | |
| HOGENOM | Q9BXH1. |
| HOVERGEN | Q9BXH1. |
| OrthoDB | EOG9RNDW2 |
Enzyme and pathway databases | |
| BioCyc | CATTLE:ENSBTAG00000014656-MON. |
| Reactome | REACT_578. Apoptosis. |
Gene expression databases | |
| ArrayExpress | Q9BXH1. |
| Bgee | Q9BXH1. |
| CleanEx | HS_BBC3. |
| Genevestigator | Q9BXH1. |
| GermOnline | ENSG00000105327. Homo sapiens. |
Family and domain databases | |
| PROSITE | PS01259. BH3. False negative. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 49796. |
| SOURCE | Search... |
Entry information
| Entry name | BBC3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BXH1 Secondary accession number(s): B9EGI3, O00171, Q96PG9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


