Q9BXH1 (BBC3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 93.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Bcl-2-binding component 3 Alternative name(s): JFY-1 p53 up-regulated modulator of apoptosis | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 193 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Essential mediator of p53/TP53-dependent and p53/TP53-independent apoptosis. Functions by promoting partial unfolding of BCL2L1 and dissociation of BCL2L1 from p53/TP53. Regulates ER stress-induced neuronal apoptosis. Ref.1 Ref.8 |
| Subunit structure | Interacts with MCL1 and BCL2A1 By similarity. Interacts with BCL2 and BCL2L1/BCL-XL. Ref.1 Ref.8 |
| Subcellular location | Mitochondrion. Note: Localized to the mitochondria in order to induce cytochrome c release. Ref.1 Ref.2 Ref.3 |
| Tissue specificity | Ubiquitously expressed. Ref.1 |
| Induction | By DNA damage, glucocorticoid treatment, growth factor deprivation and p53. By ER stress in a DDIT3/CHOP-dependent manner. Ref.2 Ref.3 Ref.7 |
| Domain | The BH3 motif is intrinsically disordered. Ref.8 |
| Sequence similarities | Belongs to the Bcl-2 family. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| BCL2 | P10415 | 5 | EBI-519884,EBI-77694 | |
| BCL2L1 | Q07817-1 | 7 | EBI-519884,EBI-287195 | |
| BCL2L2 | Q92843 | 2 | EBI-519884,EBI-707714 | |
| MCL1 | Q07820 | 3 | EBI-519884,EBI-1003422 | |
| Mcl1 | P97287 | 3 | EBI-519884,EBI-707292 | From a different organism. |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BXH1-1) Also known as: PUMA alpha; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BXH1-2) Also known as: PUMA beta; The sequence of this isoform differs from the canonical sequence as follows: 1-92: MARARQEGSS...SRPRGPRPDG → MKFGMGSAQACPCQVPRAASTTWVPCQICG | ||||||
| Isoform 3 (identifier: Q96PG8-1) Also known as: PUMA delta; The sequence of this isoform can be found in the external entry Q96PG8. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. | ||||||
| Isoform 4 (identifier: Q96PG8-2) Also known as: PUMA gamma; The sequence of this isoform can be found in the external entry Q96PG8. Isoforms of the same protein are often annotated in two different entries if their sequences differ significantly. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||
Molecule processing | |||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 193 | 193 | Bcl-2-binding component 3 | PRO_0000143083 | |||||||
Regions | |||||||||||
| Motif | 137 – 151 | 15 | BH3 | ||||||||
Natural variations | |||||||||||
| Alternative sequence | 1 – 92 | 92 | MARAR…PRPDG → MKFGMGSAQACPCQVPRAAS TTWVPCQICG in isoform 2. | VSP_012238 | |||||||
Experimental info | |||||||||||
| Mutagenesis | 133 | 1 | W → A: Impairs p53/TP53-dependent apoptosis. Ref.8 | ||||||||
Secondary structure | |||||||||||
Helix Strand Turn | |||||||||||
| Helix | 133 – 151 | 19 | |||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "PUMA induces the rapid apoptosis of colorectal cancer cells." Yu J., Zhang L., Hwang P.M., Kinzler K.W., Vogelstein B. Mol. Cell 7:673-682(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH BCL2 AND BCL2L1, TISSUE SPECIFICITY. |
| [2] | "PUMA, a novel proapoptotic gene, is induced by p53." Nakano K., Wousden K.H. Mol. Cell 7:683-694(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 2; 3 AND 4), INDUCTION, SUBCELLULAR LOCATION. |
| [3] | "Expression of bbc3, a pro-apoptotic BH3-only gene, is regulated by diverse cell death and survival signals." Han J.-W., Flemington C., Houghton A.B., Gu Z., Zambetti G.P., Lutz R.J., Zhu L., Chittenden T. Proc. Natl. Acad. Sci. U.S.A. 98:11318-11323(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INDUCTION, SUBCELLULAR LOCATION. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Testis. |
| [6] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [7] | "CHOP potentially co-operates with FOXO3a in neuronal cells to regulate PUMA and BIM expression in response to ER stress." Ghosh A.P., Klocke B.J., Ballestas M.E., Roth K.A. PLoS ONE 7:E39586-E39586(2012) [PubMed] [Europe PMC] [Abstract] Cited for: INDUCTION. |
| [8] | "PUMA binding induces partial unfolding within BCL-xL to disrupt p53 binding and promote apoptosis." Follis A.V., Chipuk J.E., Fisher J.C., Yun M.K., Grace C.R., Nourse A., Baran K., Ou L., Min L., White S.W., Green D.R., Kriwacki R.W. Nat. Chem. Biol. 9:163-168(2013) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (2.9 ANGSTROMS) OF 130-154 IN COMPLEX WITH BCL2L1, STRUCTURE BY NMR OF 130-154 IN COMPLEX WITH BCL2L1, FUNCTION, DOMAIN, MUTAGENESIS OF TRP-133, INTERACTION WITH BCL2L1. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF332558 mRNA. Translation: AAK31316.1. AF354654 mRNA. Translation: AAK39542.1. AF354655 mRNA. Translation: AAK39543.1. U82987 mRNA. Translation: AAB51243.2. CH471126 Genomic DNA. Translation: EAW57465.1. BC136481 mRNA. Translation: AAI36482.1. | ||||||||||||||||||
| IPI | IPI00004338. IPI00186516. | ||||||||||||||||||
| RefSeq | NP_001120712.1. NM_001127240.2. NP_001120713.1. NM_001127241.2. NP_001120714.1. NM_001127242.2. NP_055232.1. NM_014417.4. | ||||||||||||||||||
| UniGene | Hs.467020. | ||||||||||||||||||
3D structure databases | |||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||
| ProteinModelPortal | Q9BXH1. | ||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||
| DIP | DIP-29215N. | ||||||||||||||||||
| IntAct | Q9BXH1. 8 interactions. | ||||||||||||||||||
| MINT | MINT-6629069. | ||||||||||||||||||
| STRING | 9606.ENSP00000404503. | ||||||||||||||||||
PTM databases | |||||||||||||||||||
| PhosphoSite | Q9BXH1. | ||||||||||||||||||
Polymorphism databases | |||||||||||||||||||
| DMDM | 56748610. | ||||||||||||||||||
Proteomic databases | |||||||||||||||||||
| PaxDb | Q9BXH1. | ||||||||||||||||||
| PRIDE | Q9BXH1. | ||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||
Genome annotation databases | |||||||||||||||||||
| Ensembl | ENST00000341983; ENSP00000341155; ENSG00000105327. ENST00000439096; ENSP00000395862; ENSG00000105327. | ||||||||||||||||||
| GeneID | 27113. | ||||||||||||||||||
| KEGG | hsa:27113. | ||||||||||||||||||
| UCSC | uc002pgf.4. human. uc010eky.3. human. | ||||||||||||||||||
Organism-specific databases | |||||||||||||||||||
| CTD | 27113. | ||||||||||||||||||
| GeneCards | GC19M047724. | ||||||||||||||||||
| HGNC | HGNC:17868. BBC3. | ||||||||||||||||||
| HPA | CAB007752. | ||||||||||||||||||
| MIM | 605854. gene. | ||||||||||||||||||
| neXtProt | NX_Q9BXH1. | ||||||||||||||||||
| PharmGKB | PA38471. | ||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||
| eggNOG | prNOG22537. | ||||||||||||||||||
| HOGENOM | HOG000060256. | ||||||||||||||||||
| HOVERGEN | HBG050671. | ||||||||||||||||||
| InParanoid | Q9BXH1. | ||||||||||||||||||
| KO | K10132. | ||||||||||||||||||
| PhylomeDB | Q9BXH1. | ||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||
| Reactome | REACT_578. Apoptosis. | ||||||||||||||||||
Gene expression databases | |||||||||||||||||||
| ArrayExpress | Q9BXH1. | ||||||||||||||||||
| Bgee | Q9BXH1. | ||||||||||||||||||
| CleanEx | HS_BBC3. | ||||||||||||||||||
| Genevestigator | Q9BXH1. | ||||||||||||||||||
| GermOnline | ENSG00000105327. Homo sapiens. | ||||||||||||||||||
Family and domain databases | |||||||||||||||||||
| PROSITE | PS01259. BH3. False negative. [Graphical view] | ||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||
Other | |||||||||||||||||||
| BindingDB | Q9BXH1. | ||||||||||||||||||
| ChEMBL | CHEMBL1250409. | ||||||||||||||||||
| ChiTaRS | BBC3. human. | ||||||||||||||||||
| GenomeRNAi | 27113. | ||||||||||||||||||
| NextBio | 49796. | ||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||
Entry information
| Entry name | BBC3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BXH1 Secondary accession number(s): B9EGI3, O00171, Q96PG9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
