Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BX79

- STRA6_HUMAN

UniProt

Q9BX79 - STRA6_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Stimulated by retinoic acid gene 6 protein homolog

Gene

STRA6

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

May act as a high-affinity cell-surface receptor for the complex retinol-retinol binding protein (RBP/RBP4). Acts by removing retinol from RBP/RBP4 and transports it across the plasma membrane, where it can be metabolized. This mechanism does not depend on endocytosis. Binds to RBP/RBP4 with high affinity. Increases cellular retinol uptake from the retinol-RBP complex (By similarity).By similarity

GO - Molecular functioni

  1. receptor activity Source: InterPro
  2. vitamin transporter activity Source: InterPro

GO - Biological processi

  1. adrenal gland development Source: DFLAT
  2. alveolar primary septum development Source: DFLAT
  3. artery morphogenesis Source: DFLAT
  4. blood vessel development Source: DFLAT
  5. cognition Source: DFLAT
  6. developmental growth Source: DFLAT
  7. diaphragm development Source: DFLAT
  8. digestive tract morphogenesis Source: DFLAT
  9. ductus arteriosus closure Source: DFLAT
  10. ear development Source: DFLAT
  11. embryonic camera-type eye formation Source: DFLAT
  12. embryonic digestive tract development Source: DFLAT
  13. eyelid development in camera-type eye Source: DFLAT
  14. face morphogenesis Source: DFLAT
  15. feeding behavior Source: DFLAT
  16. female genitalia development Source: DFLAT
  17. head development Source: DFLAT
  18. head morphogenesis Source: DFLAT
  19. heart development Source: DFLAT
  20. kidney development Source: DFLAT
  21. learning Source: DFLAT
  22. lung alveolus development Source: DFLAT
  23. lung development Source: DFLAT
  24. lung vasculature development Source: DFLAT
  25. neuromuscular process Source: DFLAT
  26. nose morphogenesis Source: DFLAT
  27. paramesonephric duct development Source: DFLAT
  28. phototransduction, visible light Source: Reactome
  29. positive regulation of behavior Source: DFLAT
  30. positive regulation of JAK-STAT cascade Source: Ensembl
  31. pulmonary artery morphogenesis Source: DFLAT
  32. pulmonary valve morphogenesis Source: DFLAT
  33. retinoic acid metabolic process Source: Ensembl
  34. retinoid metabolic process Source: Reactome
  35. retinol transport Source: Ensembl
  36. smooth muscle tissue development Source: DFLAT
  37. uterus morphogenesis Source: DFLAT
  38. ventricular septum development Source: DFLAT
  39. vitamin A import Source: Ensembl
  40. vocal learning Source: DFLAT
Complete GO annotation...

Keywords - Molecular functioni

Receptor

Keywords - Biological processi

Transport

Enzyme and pathway databases

ReactomeiREACT_160130. Retinoid cycle disease events.
REACT_160156. The canonical retinoid cycle in rods (twilight vision).

Protein family/group databases

TCDBi2.A.90.1.3. the vitamin a receptor/transporter (stra6) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Stimulated by retinoic acid gene 6 protein homolog
Gene namesi
Name:STRA6
ORF Names:PP14296, UNQ3126/PRO10282/PRO19578
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 15

Organism-specific databases

HGNCiHGNC:30650. STRA6.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 5050ExtracellularSequence AnalysisAdd
BLAST
Transmembranei51 – 7121HelicalSequence AnalysisAdd
BLAST
Topological domaini72 – 10029CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei101 – 12121HelicalSequence AnalysisAdd
BLAST
Topological domaini122 – 20483ExtracellularSequence AnalysisAdd
BLAST
Transmembranei205 – 22521HelicalSequence AnalysisAdd
BLAST
Topological domaini226 – 30176CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei302 – 32221HelicalSequence AnalysisAdd
BLAST
Topological domaini323 – 3242ExtracellularSequence Analysis
Transmembranei325 – 34521HelicalSequence AnalysisAdd
BLAST
Topological domaini346 – 36116CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei362 – 38221HelicalSequence AnalysisAdd
BLAST
Topological domaini383 – 43957ExtracellularSequence AnalysisAdd
BLAST
Transmembranei440 – 46021HelicalSequence AnalysisAdd
BLAST
Topological domaini461 – 47414CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei475 – 49521HelicalSequence AnalysisAdd
BLAST
Topological domaini496 – 50813ExtracellularSequence AnalysisAdd
BLAST
Transmembranei509 – 52921HelicalSequence AnalysisAdd
BLAST
Topological domaini530 – 667138CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: Reactome
  3. protein complex Source: LIFEdb
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Membrane

Pathology & Biotechi

Involvement in diseasei

Microphthalmia, syndromic, 9 (MCOPS9) [MIM:601186]: A rare clinical entity including as main characteristics anophthalmia or severe microphthalmia, and pulmonary hypoplasia or aplasia. Microphthalmia is a disorder of eye formation, ranging from small size of a single eye to complete bilateral absence of ocular tissues (anophthalmia). In many cases, microphthalmia/anophthalmia occurs in association with syndromes that include non-ocular abnormalities.3 Publications
Note: The disease is caused by mutations affecting the gene represented in this entry.
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti90 – 901P → L in MCOPS9. 1 Publication
VAR_037168
Natural varianti293 – 2931P → L in MCOPS9. 1 Publication
VAR_037169
Natural varianti304 – 3041G → K in MCOPS9; also found in a family with isolated colobomatous microphthalmia; affects STRA6 cell surface expression and retinol upatake; requires 2 nucleotide substitutions. 1 Publication
VAR_066849
Natural varianti321 – 3211T → P in MCOPS9. 1 Publication
Corresponds to variant rs118203962 [ dbSNP | Ensembl ].
VAR_037170
Natural varianti644 – 6441T → M in MCOPS9. 1 Publication
VAR_037174
Natural varianti655 – 6551R → C in MCOPS9. 1 Publication
VAR_037175
Mutations in STRA6 may be a cause of isolated colobomatous microphthalmia, a disorder of the eye characterized by an abnormally small ocular globe.

Keywords - Diseasei

Disease mutation, Microphthalmia

Organism-specific databases

MIMi601186. phenotype.
Orphaneti98938. Colobomatous microphthalmia.
2470. Matthew-Wood syndrome.
PharmGKBiPA134956551.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 667667Stimulated by retinoic acid gene 6 protein homologPRO_0000311228Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi8 – 81N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ9BX79.
PaxDbiQ9BX79.
PRIDEiQ9BX79.

PTM databases

PhosphoSiteiQ9BX79.

Expressioni

Tissue specificityi

Broad expression. In adult eye expressed in sclera, retina, retinal pigment epithelium, and trabecular meshwork but not in choroid and iris.1 Publication

Inductioni

Up-regulated in the colorectal cancer cell line WiDr by the administration of retinoic acid and in tumors with frequent defects in Wnt-1 signaling.2 Publications

Gene expression databases

BgeeiQ9BX79.
CleanExiHS_STRA6.
ExpressionAtlasiQ9BX79. baseline and differential.
GenevestigatoriQ9BX79.

Organism-specific databases

HPAiHPA040839.

Interactioni

Protein-protein interaction databases

BioGridi122110. 2 interactions.
MINTiMINT-4722094.

Structurei

3D structure databases

ProteinModelPortaliQ9BX79.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG47654.
GeneTreeiENSGT00390000015272.
HOVERGENiHBG106311.
InParanoidiQ9BX79.
OMAiAIFCWMS.
OrthoDBiEOG7CRTPB.
PhylomeDBiQ9BX79.
TreeFamiTF331851.

Family and domain databases

InterProiIPR026612. STRA6.
[Graphical view]
PANTHERiPTHR21444:SF5. PTHR21444:SF5. 1 hit.

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BX79-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSSQPAGNQT SPGATEDYSY GSWYIDEPQG GEELQPEGEV PSCHTSIPPG
60 70 80 90 100
LYHACLASLS ILVLLLLAML VRRRQLWPDC VRGRPGLPSP VDFLAGDRPR
110 120 130 140 150
AVPAAVFMVL LSSLCLLLPD EDALPFLTLA SAPSQDGKTE APRGAWKILG
160 170 180 190 200
LFYYAALYYP LAACATAGHT AAHLLGSTLS WAHLGVQVWQ RAECPQVPKI
210 220 230 240 250
YKYYSLLASL PLLLGLGFLS LWYPVQLVRS FSRRTGAGSK GLQSSYSEEY
260 270 280 290 300
LRNLLCRKKL GSSYHTSKHG FLSWARVCLR HCIYTPQPGF HLPLKLVLSA
310 320 330 340 350
TLTGTAIYQV ALLLLVGVVP TIQKVRAGVT TDVSYLLAGF GIVLSEDKQE
360 370 380 390 400
VVELVKHHLW ALEVCYISAL VLSCLLTFLV LMRSLVTHRT NLRALHRGAA
410 420 430 440 450
LDLSPLHRSP HPSRQAIFCW MSFSAYQTAF ICLGLLVQQI IFFLGTTALA
460 470 480 490 500
FLVLMPVLHG RNLLLFRSLE SSWPFWLTLA LAVILQNMAA HWVFLETHDG
510 520 530 540 550
HPQLTNRRVL YAATFLLFPL NVLVGAMVAT WRVLLSALYN AIHLGQMDLS
560 570 580 590 600
LLPPRAATLD PGYYTYRNFL KIEVSQSHPA MTAFCSLLLQ AQSLLPRTMA
610 620 630 640 650
APQDSLRPGE EDEGMQLLQT KDSMAKGARP GASRGRARWG LAYTLLHNPT
660
LQVFRKTALL GANGAQP
Length:667
Mass (Da):73,503
Last modified:June 1, 2001 - v1
Checksum:iD20840A46998BA2E
GO
Isoform 2 (identifier: Q9BX79-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     145-667: AWKILGLFYY...ALLGANGAQP → NLPKITELRLVRAWI

Note: No experimental confirmation available.

Show »
Length:159
Mass (Da):17,190
Checksum:i7FB62BED986EC3B9
GO
Isoform 3 (identifier: Q9BX79-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     89-97: Missing.

Show »
Length:658
Mass (Da):72,601
Checksum:i54052F7AE58F82C9
GO
Isoform 4 (identifier: Q9BX79-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGGKGGGDTRGPVLFPCQLAQALSPRRAFPRELKEKGQRM

Note: No experimental confirmation available.

Show »
Length:706
Mass (Da):77,696
Checksum:iCC091BBE74255CDA
GO
Isoform 5 (identifier: Q9BX79-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MQIRLLRAELVVPLWQFIRQWPPGSDGWGQMEEKGQRM

Show »
Length:704
Mass (Da):77,922
Checksum:i8E952666FFAAE051
GO
Isoform 6 (identifier: Q9BX79-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MDSQGDWAAQEKGQRM

Note: No experimental confirmation available.

Show »
Length:682
Mass (Da):75,192
Checksum:i24CE3B0CC96D9FA5
GO

Sequence cautioni

The sequence BAB14122.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAH13848.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence CAD97655.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti95 – 951A → V in BAH12965. (PubMed:14702039)Curated
Sequence conflicti408 – 4081R → Q in CAD97655. (PubMed:17974005)Curated
Sequence conflicti417 – 4171I → M in BAH12965. (PubMed:14702039)Curated
Sequence conflicti635 – 6351G → S in BAH13848. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti90 – 901P → L in MCOPS9. 1 Publication
VAR_037168
Natural varianti217 – 2171G → E in anophthalmia/microphthalmia. 1 Publication
VAR_060203
Natural varianti293 – 2931P → L in MCOPS9. 1 Publication
VAR_037169
Natural varianti304 – 3041G → K in MCOPS9; also found in a family with isolated colobomatous microphthalmia; affects STRA6 cell surface expression and retinol upatake; requires 2 nucleotide substitutions. 1 Publication
VAR_066849
Natural varianti321 – 3211T → P in MCOPS9. 1 Publication
Corresponds to variant rs118203962 [ dbSNP | Ensembl ].
VAR_037170
Natural varianti339 – 3391G → S.2 Publications
Corresponds to variant rs17852249 [ dbSNP | Ensembl ].
VAR_037171
Natural varianti438 – 4381Q → R in anophthalmia/microphthalmia. 1 Publication
VAR_060204
Natural varianti517 – 5171L → F.
Corresponds to variant rs11545567 [ dbSNP | Ensembl ].
VAR_037172
Natural varianti527 – 5271M → I.3 Publications
Corresponds to variant rs736118 [ dbSNP | Ensembl ].
VAR_037173
Natural varianti638 – 6381R → P in anophthalmia/microphthalmia. 1 Publication
VAR_060205
Natural varianti644 – 6441T → M in MCOPS9. 1 Publication
VAR_037174
Natural varianti655 – 6551R → C in MCOPS9. 1 Publication
VAR_037175

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 11M → MGGKGGGDTRGPVLFPCQLA QALSPRRAFPRELKEKGQRM in isoform 4. 1 PublicationVSP_029437
Alternative sequencei1 – 11M → MQIRLLRAELVVPLWQFIRQ WPPGSDGWGQMEEKGQRM in isoform 5. 1 PublicationVSP_046776
Alternative sequencei1 – 11M → MDSQGDWAAQEKGQRM in isoform 6. 1 PublicationVSP_047497
Alternative sequencei89 – 979Missing in isoform 3. 2 PublicationsVSP_029438
Alternative sequencei145 – 667523AWKIL…NGAQP → NLPKITELRLVRAWI in isoform 2. 1 PublicationVSP_029439Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF352728 mRNA. Translation: AAK30289.1.
AF352729 mRNA. Translation: AAK30290.1.
AY358748 mRNA. Translation: AAQ89108.1.
AY359089 mRNA. Translation: AAQ89447.1.
BX537413 mRNA. Translation: CAD97655.1. Different initiation.
AK022603 mRNA. Translation: BAB14122.1. Different initiation.
AK291966 mRNA. Translation: BAF84655.1.
AK299191 mRNA. Translation: BAH12965.1.
AK302932 mRNA. Translation: BAH13848.1. Different initiation.
AF370419 mRNA. Translation: AAQ15255.2.
AC023545 Genomic DNA. No translation available.
CH471136 Genomic DNA. Translation: EAW99353.1.
CH471136 Genomic DNA. Translation: EAW99356.1.
BC015881 mRNA. Translation: AAH15881.1.
BC025256 mRNA. Translation: AAH25256.1.
CCDSiCCDS10261.1. [Q9BX79-1]
CCDS45301.1. [Q9BX79-3]
CCDS45302.1. [Q9BX79-2]
CCDS55973.1. [Q9BX79-4]
CCDS55974.1. [Q9BX79-5]
CCDS58387.1. [Q9BX79-6]
RefSeqiNP_001136089.1. NM_001142617.1. [Q9BX79-1]
NP_001136090.1. NM_001142618.1. [Q9BX79-1]
NP_001136091.1. NM_001142619.1. [Q9BX79-3]
NP_001136092.1. NM_001142620.1. [Q9BX79-2]
NP_001185969.1. NM_001199040.1. [Q9BX79-5]
NP_001185970.1. NM_001199041.1. [Q9BX79-6]
NP_001185971.1. NM_001199042.1. [Q9BX79-4]
NP_071764.3. NM_022369.3. [Q9BX79-1]
UniGeneiHs.24553.

Genome annotation databases

EnsembliENST00000323940; ENSP00000326085; ENSG00000137868. [Q9BX79-1]
ENST00000395105; ENSP00000378537; ENSG00000137868. [Q9BX79-1]
ENST00000423167; ENSP00000413012; ENSG00000137868. [Q9BX79-3]
ENST00000432245; ENSP00000407176; ENSG00000137868. [Q9BX79-2]
ENST00000449139; ENSP00000410221; ENSG00000137868. [Q9BX79-1]
ENST00000535552; ENSP00000440238; ENSG00000137868. [Q9BX79-5]
ENST00000563965; ENSP00000456609; ENSG00000137868. [Q9BX79-4]
ENST00000574278; ENSP00000458827; ENSG00000137868. [Q9BX79-6]
ENST00000616000; ENSP00000479112; ENSG00000137868. [Q9BX79-1]
GeneIDi64220.
KEGGihsa:64220.
UCSCiuc002axj.3. human. [Q9BX79-4]
uc002axk.3. human. [Q9BX79-1]
uc002axn.3. human. [Q9BX79-3]
uc010bjk.3. human. [Q9BX79-2]

Polymorphism databases

DMDMi74733466.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF352728 mRNA. Translation: AAK30289.1 .
AF352729 mRNA. Translation: AAK30290.1 .
AY358748 mRNA. Translation: AAQ89108.1 .
AY359089 mRNA. Translation: AAQ89447.1 .
BX537413 mRNA. Translation: CAD97655.1 . Different initiation.
AK022603 mRNA. Translation: BAB14122.1 . Different initiation.
AK291966 mRNA. Translation: BAF84655.1 .
AK299191 mRNA. Translation: BAH12965.1 .
AK302932 mRNA. Translation: BAH13848.1 . Different initiation.
AF370419 mRNA. Translation: AAQ15255.2 .
AC023545 Genomic DNA. No translation available.
CH471136 Genomic DNA. Translation: EAW99353.1 .
CH471136 Genomic DNA. Translation: EAW99356.1 .
BC015881 mRNA. Translation: AAH15881.1 .
BC025256 mRNA. Translation: AAH25256.1 .
CCDSi CCDS10261.1. [Q9BX79-1 ]
CCDS45301.1. [Q9BX79-3 ]
CCDS45302.1. [Q9BX79-2 ]
CCDS55973.1. [Q9BX79-4 ]
CCDS55974.1. [Q9BX79-5 ]
CCDS58387.1. [Q9BX79-6 ]
RefSeqi NP_001136089.1. NM_001142617.1. [Q9BX79-1 ]
NP_001136090.1. NM_001142618.1. [Q9BX79-1 ]
NP_001136091.1. NM_001142619.1. [Q9BX79-3 ]
NP_001136092.1. NM_001142620.1. [Q9BX79-2 ]
NP_001185969.1. NM_001199040.1. [Q9BX79-5 ]
NP_001185970.1. NM_001199041.1. [Q9BX79-6 ]
NP_001185971.1. NM_001199042.1. [Q9BX79-4 ]
NP_071764.3. NM_022369.3. [Q9BX79-1 ]
UniGenei Hs.24553.

3D structure databases

ProteinModelPortali Q9BX79.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122110. 2 interactions.
MINTi MINT-4722094.

Protein family/group databases

TCDBi 2.A.90.1.3. the vitamin a receptor/transporter (stra6) family.

PTM databases

PhosphoSitei Q9BX79.

Polymorphism databases

DMDMi 74733466.

Proteomic databases

MaxQBi Q9BX79.
PaxDbi Q9BX79.
PRIDEi Q9BX79.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000323940 ; ENSP00000326085 ; ENSG00000137868 . [Q9BX79-1 ]
ENST00000395105 ; ENSP00000378537 ; ENSG00000137868 . [Q9BX79-1 ]
ENST00000423167 ; ENSP00000413012 ; ENSG00000137868 . [Q9BX79-3 ]
ENST00000432245 ; ENSP00000407176 ; ENSG00000137868 . [Q9BX79-2 ]
ENST00000449139 ; ENSP00000410221 ; ENSG00000137868 . [Q9BX79-1 ]
ENST00000535552 ; ENSP00000440238 ; ENSG00000137868 . [Q9BX79-5 ]
ENST00000563965 ; ENSP00000456609 ; ENSG00000137868 . [Q9BX79-4 ]
ENST00000574278 ; ENSP00000458827 ; ENSG00000137868 . [Q9BX79-6 ]
ENST00000616000 ; ENSP00000479112 ; ENSG00000137868 . [Q9BX79-1 ]
GeneIDi 64220.
KEGGi hsa:64220.
UCSCi uc002axj.3. human. [Q9BX79-4 ]
uc002axk.3. human. [Q9BX79-1 ]
uc002axn.3. human. [Q9BX79-3 ]
uc010bjk.3. human. [Q9BX79-2 ]

Organism-specific databases

CTDi 64220.
GeneCardsi GC15M074471.
HGNCi HGNC:30650. STRA6.
HPAi HPA040839.
MIMi 601186. phenotype.
610745. gene.
neXtProti NX_Q9BX79.
Orphaneti 98938. Colobomatous microphthalmia.
2470. Matthew-Wood syndrome.
PharmGKBi PA134956551.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG47654.
GeneTreei ENSGT00390000015272.
HOVERGENi HBG106311.
InParanoidi Q9BX79.
OMAi AIFCWMS.
OrthoDBi EOG7CRTPB.
PhylomeDBi Q9BX79.
TreeFami TF331851.

Enzyme and pathway databases

Reactomei REACT_160130. Retinoid cycle disease events.
REACT_160156. The canonical retinoid cycle in rods (twilight vision).

Miscellaneous databases

ChiTaRSi STRA6. human.
GenomeRNAii 64220.
NextBioi 66143.
PROi Q9BX79.
SOURCEi Search...

Gene expression databases

Bgeei Q9BX79.
CleanExi HS_STRA6.
ExpressionAtlasi Q9BX79. baseline and differential.
Genevestigatori Q9BX79.

Family and domain databases

InterProi IPR026612. STRA6.
[Graphical view ]
PANTHERi PTHR21444:SF5. PTHR21444:SF5. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Overexpression of the retinoic acid-responsive gene Stra6 in human cancers and its synergistic induction by Wnt-1 and retinoic acid."
    Szeto W., Jiang W., Tice D.A., Rubinfeld B., Hollingshead P.G., Fong S.E., Dugger D.L., Pham T., Yansura D.G., Wong T.A., Grimaldi J.C., Corpuz R.T., Singh J.S., Frantz G.D., Devaux B., Crowley C.W., Schwall R.H., Eberhard D.A.
    , Rastelli L., Polakis P., Pennica D.
    Cancer Res. 61:4197-4205(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 3), INDUCTION, VARIANT ILE-527.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT ILE-527.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 4).
    Tissue: Endometrium.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 5 AND 6), VARIANT ILE-527.
    Tissue: Testis.
  5. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT SER-339.
  6. "Analysis of the DNA sequence and duplication history of human chromosome 15."
    Zody M.C., Garber M., Sharpe T., Young S.K., Rowen L., O'Neill K., Whittaker C.A., Kamal M., Chang J.L., Cuomo C.A., Dewar K., FitzGerald M.G., Kodira C.D., Madan A., Qin S., Yang X., Abbasi N., Abouelleil A.
    , Arachchi H.M., Baradarani L., Birditt B., Bloom S., Bloom T., Borowsky M.L., Burke J., Butler J., Cook A., DeArellano K., DeCaprio D., Dorris L. III, Dors M., Eichler E.E., Engels R., Fahey J., Fleetwood P., Friedman C., Gearin G., Hall J.L., Hensley G., Johnson E., Jones C., Kamat A., Kaur A., Locke D.P., Madan A., Munson G., Jaffe D.B., Lui A., Macdonald P., Mauceli E., Naylor J.W., Nesbitt R., Nicol R., O'Leary S.B., Ratcliffe A., Rounsley S., She X., Sneddon K.M.B., Stewart S., Sougnez C., Stone S.M., Topham K., Vincent D., Wang S., Zimmer A.R., Birren B.W., Hood L., Lander E.S., Nusbaum C.
    Nature 440:671-675(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT SER-339.
    Tissue: Brain and Muscle.
  9. "Synergistic induction of tumor antigens by Wnt-1 signaling and retinoic acid revealed by gene expression profiling."
    Tice D.A., Szeto W., Soloviev I., Rubinfeld B., Fong S.E., Dugger D.L., Winer J., Williams P.M., Wieand D., Smith V., Schwall R.H., Pennica D., Polakis P.
    J. Biol. Chem. 277:14329-14335(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: INDUCTION.
  10. Cited for: INVOLVEMENT IN MCOPS9.
  11. "First implication of STRA6 mutations in isolated anophthalmia, microphthalmia, and coloboma: A new dimension to the STRA6 phenotype."
    Casey J., Kawaguchi R., Morrissey M., Sun H., McGettigan P., Nielsen J.E., Conroy J., Regan R., Kenny E., Cormican P., Morris D.W., Tormey P., Ni Chroinin M., Kennedy B.N., Lynch S., Green A., Ennis S.
    Hum. Mutat. 32:1417-1426(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: INVOLVEMENT IN ISOLATED COLOBOMATOUS MICROPHTHALMIA, VARIANT MCOPS9 LYS-304, CHARACTERIZATION OF VARIANT MCOPS9 LYS-304.
  12. "Mutations in STRA6 cause a broad spectrum of malformations including anophthalmia, congenital heart defects, diaphragmatic hernia, alveolar capillary dysplasia, lung hypoplasia, and mental retardation."
    Pasutto F., Sticht H., Hammersen G., Gillessen-Kaesbach G., FitzPatrick D.R., Nuernberg G., Brasch F., Schirmer-Zimmermann H., Tolmie J.L., Chitayat D., Houge G., Fernandez-Martinez L., Keating S., Mortier G., Hennekam R.C.M., von der Wense A., Slavotinek A., Meinecke P.
    , Bitoun P., Becker C., Nuernberg P., Reis A., Rauch A.
    Am. J. Hum. Genet. 80:550-560(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANTS MCOPS9 LEU-90; LEU-293; PRO-321; MET-644 AND CYS-655, TISSUE SPECIFICITY.
  13. "Identification of STRA6 and SKI sequence variants in patients with anophthalmia/microphthalmia."
    White T., Lu T., Metlapally R., Katowitz J., Kherani F., Wang T.-Y., Tran-Viet K.-N., Young T.L.
    Mol. Vis. 14:2458-2465(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: VARIANT ANOPHTHALMIA/MICROPHTHALMIA GLU-217.
  14. Cited for: VARIANTS ANOPHTHALMIA/MICROPHTHALMIA ARG-438 AND PRO-638.

Entry informationi

Entry nameiSTRA6_HUMAN
AccessioniPrimary (citable) accession number: Q9BX79
Secondary accession number(s): A8K7F1
, B7Z5M9, B7Z862, D3DW54, F5GYI8, I3L1G8, Q6PJF8, Q71RB9, Q7L9G1, Q7Z3U9, Q8TB21, Q9BX78, Q9H9U8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: June 1, 2001
Last modified: November 26, 2014
This is version 90 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 15
    Human chromosome 15: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

External Data

Dasty 3