Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BX73

- TM2D2_HUMAN

UniProt

Q9BX73 - TM2D2_HUMAN

Protein

TM2 domain-containing protein 2

Gene

TM2D2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 83 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    TM2 domain-containing protein 2
    Alternative name(s):
    Beta-amyloid-binding protein-like protein 1
    Short name:
    BBP-like protein 1
    Gene namesi
    Name:TM2D2
    Synonyms:BLP1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 8

    Organism-specific databases

    HGNCiHGNC:24127. TM2D2.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142670799.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 3535Sequence AnalysisAdd
    BLAST
    Chaini36 – 214179TM2 domain-containing protein 2PRO_0000298982Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi92 – 921N-linked (GlcNAc...)Sequence Analysis

    Keywords - PTMi

    Glycoprotein

    Proteomic databases

    MaxQBiQ9BX73.
    PaxDbiQ9BX73.
    PRIDEiQ9BX73.

    Expressioni

    Tissue specificityi

    Widely expressed.1 Publication

    Gene expression databases

    ArrayExpressiQ9BX73.
    BgeeiQ9BX73.
    CleanExiHS_TM2D2.
    GenevestigatoriQ9BX73.

    Organism-specific databases

    HPAiHPA047152.
    HPA050547.

    Interactioni

    Protein-protein interaction databases

    IntActiQ9BX73. 1 interaction.
    MINTiMINT-8201757.
    STRINGi9606.ENSP00000416050.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BX73.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei145 – 16521HelicalSequence AnalysisAdd
    BLAST
    Transmembranei183 – 20321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the TM2 family.Curated

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG281716.
    HOGENOMiHOG000007596.
    HOVERGENiHBG071725.
    InParanoidiQ9BX73.
    OMAiEDGSNWN.
    OrthoDBiEOG7K0ZDG.
    PhylomeDBiQ9BX73.
    TreeFamiTF314896.

    Family and domain databases

    InterProiIPR007829. TM2.
    [Graphical view]
    PfamiPF05154. TM2. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BX73-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVLGGCPVSY LLLCGQAALL LGNLLLLHCV SRSHSQNATA EPELTSAGAA    50
    QPEGPGGAAS WEYGDPHSPV ILCSYLPDEF IECEDPVDHV GNATASQELG 100
    YGCLKFGGQA YSDVEHTSVQ CHALDGIECA SPRTFLRENK PCIKYTGHYF 150
    ITTLLYSFFL GCFGVDRFCL GHTGTAVGKL LTLGGLGIWW FVDLILLITG 200
    GLMPSDGSNW CTVY 214
    Length:214
    Mass (Da):22,871
    Last modified:June 1, 2001 - v1
    Checksum:iBB928712AF2F78A8
    GO
    Isoform 2 (identifier: Q9BX73-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-76: MVLGGCPVSY...HSPVILCSYL → MKKCLLPVLITCMQTAICKDRMMMIMILLVNYR

    Show »
    Length:171
    Mass (Da):19,012
    Checksum:iCD9F9F7CEE5CB388
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 7676MVLGG…LCSYL → MKKCLLPVLITCMQTAICKD RMMMIMILLVNYR in isoform 2. 3 PublicationsVSP_027495Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF353991 mRNA. Translation: AAK35065.1.
    AK075027 mRNA. Translation: BAC11359.1.
    AK075155 mRNA. Translation: BAC11437.1.
    AK314703 mRNA. Translation: BAG37251.1.
    AL834224 mRNA. Translation: CAH10695.1.
    CH471080 Genomic DNA. Translation: EAW63286.1.
    CH471080 Genomic DNA. Translation: EAW63288.1.
    CH471080 Genomic DNA. Translation: EAW63287.1.
    BC004878 mRNA. Translation: AAH04878.2.
    BC109049 mRNA. Translation: AAI09050.1.
    BC109050 mRNA. Translation: AAI09051.1.
    CCDSiCCDS43733.1. [Q9BX73-2]
    CCDS6111.1. [Q9BX73-1]
    RefSeqiNP_001019551.1. NM_001024380.1. [Q9BX73-2]
    NP_001019552.1. NM_001024381.1. [Q9BX73-2]
    NP_114146.3. NM_031940.3. [Q9BX73-2]
    NP_510882.1. NM_078473.2. [Q9BX73-1]
    XP_005273714.1. XM_005273657.1. [Q9BX73-2]
    XP_006716471.1. XM_006716408.1. [Q9BX73-2]
    UniGeneiHs.7471.

    Genome annotation databases

    EnsembliENST00000397070; ENSP00000380260; ENSG00000169490. [Q9BX73-2]
    ENST00000456397; ENSP00000416050; ENSG00000169490. [Q9BX73-1]
    ENST00000456845; ENSP00000391674; ENSG00000169490. [Q9BX73-2]
    GeneIDi83877.
    KEGGihsa:83877.
    UCSCiuc003xmk.3. human. [Q9BX73-1]
    uc003xml.3. human. [Q9BX73-2]

    Polymorphism databases

    DMDMi74733464.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF353991 mRNA. Translation: AAK35065.1 .
    AK075027 mRNA. Translation: BAC11359.1 .
    AK075155 mRNA. Translation: BAC11437.1 .
    AK314703 mRNA. Translation: BAG37251.1 .
    AL834224 mRNA. Translation: CAH10695.1 .
    CH471080 Genomic DNA. Translation: EAW63286.1 .
    CH471080 Genomic DNA. Translation: EAW63288.1 .
    CH471080 Genomic DNA. Translation: EAW63287.1 .
    BC004878 mRNA. Translation: AAH04878.2 .
    BC109049 mRNA. Translation: AAI09050.1 .
    BC109050 mRNA. Translation: AAI09051.1 .
    CCDSi CCDS43733.1. [Q9BX73-2 ]
    CCDS6111.1. [Q9BX73-1 ]
    RefSeqi NP_001019551.1. NM_001024380.1. [Q9BX73-2 ]
    NP_001019552.1. NM_001024381.1. [Q9BX73-2 ]
    NP_114146.3. NM_031940.3. [Q9BX73-2 ]
    NP_510882.1. NM_078473.2. [Q9BX73-1 ]
    XP_005273714.1. XM_005273657.1. [Q9BX73-2 ]
    XP_006716471.1. XM_006716408.1. [Q9BX73-2 ]
    UniGenei Hs.7471.

    3D structure databases

    ProteinModelPortali Q9BX73.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    IntActi Q9BX73. 1 interaction.
    MINTi MINT-8201757.
    STRINGi 9606.ENSP00000416050.

    Polymorphism databases

    DMDMi 74733464.

    Proteomic databases

    MaxQBi Q9BX73.
    PaxDbi Q9BX73.
    PRIDEi Q9BX73.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000397070 ; ENSP00000380260 ; ENSG00000169490 . [Q9BX73-2 ]
    ENST00000456397 ; ENSP00000416050 ; ENSG00000169490 . [Q9BX73-1 ]
    ENST00000456845 ; ENSP00000391674 ; ENSG00000169490 . [Q9BX73-2 ]
    GeneIDi 83877.
    KEGGi hsa:83877.
    UCSCi uc003xmk.3. human. [Q9BX73-1 ]
    uc003xml.3. human. [Q9BX73-2 ]

    Organism-specific databases

    CTDi 83877.
    GeneCardsi GC08M038846.
    HGNCi HGNC:24127. TM2D2.
    HPAi HPA047152.
    HPA050547.
    MIMi 610081. gene.
    neXtProti NX_Q9BX73.
    PharmGKBi PA142670799.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG281716.
    HOGENOMi HOG000007596.
    HOVERGENi HBG071725.
    InParanoidi Q9BX73.
    OMAi EDGSNWN.
    OrthoDBi EOG7K0ZDG.
    PhylomeDBi Q9BX73.
    TreeFami TF314896.

    Miscellaneous databases

    ChiTaRSi TM2D2. human.
    GenomeRNAii 83877.
    NextBioi 72921.
    PROi Q9BX73.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BX73.
    Bgeei Q9BX73.
    CleanExi HS_TM2D2.
    Genevestigatori Q9BX73.

    Family and domain databases

    InterProi IPR007829. TM2.
    [Graphical view ]
    Pfami PF05154. TM2. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Ovary and Placenta.
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Pancreas.

    Entry informationi

    Entry nameiTM2D2_HUMAN
    AccessioniPrimary (citable) accession number: Q9BX73
    Secondary accession number(s): B2RBK4, D3DSX8, Q8N0X9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: September 11, 2007
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 83 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 8
      Human chromosome 8: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3