Q9BX73 (TM2D2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 29, 2013.
Version 73.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: TM2 domain-containing protein 2 Alternative name(s): Beta-amyloid-binding protein-like protein 1 Short name=BBP-like protein 1 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 214 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at transcript level |
General annotation (Comments)
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Tissue specificity | Widely expressed. Ref.1 |
| Sequence similarities | Belongs to the TM2 family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal Transmembrane Transmembrane helix |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BX73-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BX73-2) The sequence of this isoform differs from the canonical sequence as follows: 1-76: MVLGGCPVSY...HSPVILCSYL → MKKCLLPVLITCMQTAICKDRMMMIMILLVNYR |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 35 | 35 | Potential | ||||||
| Chain | 36 – 214 | 179 | TM2 domain-containing protein 2 | PRO_0000298982 | |||||
Regions | |||||||||
| Transmembrane | 145 – 165 | 21 | Helical; Potential | ||||||
| Transmembrane | 183 – 203 | 21 | Helical; Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 92 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 76 | 76 | MVLGG…LCSYL → MKKCLLPVLITCMQTAICKD RMMMIMILLVNYR in isoform 2. | VSP_027495 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF353991 mRNA. Translation: AAK35065.1. AK075027 mRNA. Translation: BAC11359.1. AK075155 mRNA. Translation: BAC11437.1. AK314703 mRNA. Translation: BAG37251.1. AL834224 mRNA. Translation: CAH10695.1. CH471080 Genomic DNA. Translation: EAW63286.1. CH471080 Genomic DNA. Translation: EAW63288.1. CH471080 Genomic DNA. Translation: EAW63287.1. BC004878 mRNA. Translation: AAH04878.2. BC109049 mRNA. Translation: AAI09050.1. BC109050 mRNA. Translation: AAI09051.1. |
| IPI | IPI00032696. IPI00418667. |
| RefSeq | NP_001019551.1. NM_001024380.1. NP_001019552.1. NM_001024381.1. NP_114146.3. NM_031940.3. NP_510882.1. NM_078473.2. |
| UniGene | Hs.7471. |
3D structure databases | |
| ProteinModelPortal | Q9BX73. |
| ModBase | Search... |
Protein-protein interaction databases | |
| MINT | MINT-8201757. |
| STRING | 9606.ENSP00000416050. |
Polymorphism databases | |
| DMDM | 74733464. |
Proteomic databases | |
| PaxDb | Q9BX73. |
| PRIDE | Q9BX73. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000397070; ENSP00000380260; ENSG00000169490. ENST00000412303; ENSP00000402964; ENSG00000169490. ENST00000456397; ENSP00000416050; ENSG00000169490. ENST00000456845; ENSP00000391674; ENSG00000169490. |
| GeneID | 83877. |
| KEGG | hsa:83877. |
| UCSC | uc003xmk.3. human. uc003xml.3. human. |
Organism-specific databases | |
| CTD | 83877. |
| GeneCards | GC08M038846. |
| HGNC | HGNC:24127. TM2D2. |
| HPA | HPA047152. HPA050547. |
| MIM | 610081. gene. |
| neXtProt | NX_Q9BX73. |
| PharmGKB | PA142670799. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG281716. |
| HOGENOM | HOG000007596. |
| HOVERGEN | HBG071725. |
| InParanoid | Q9BX73. |
| OMA | EDGSNWN. |
| OrthoDB | EOG4ZCT5H. |
| PhylomeDB | Q9BX73. |
Gene expression databases | |
| ArrayExpress | Q9BX73. |
| Bgee | Q9BX73. |
| CleanEx | HS_TM2D2. |
| Genevestigator | Q9BX73. |
Family and domain databases | |
| InterPro | IPR007829. TM2. [Graphical view] |
| Pfam | PF05154. TM2. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | TM2D2. human. |
| GenomeRNAi | 83877. |
| NextBio | 72921. |
| SOURCE | Search... |
Entry information
| Entry name | TM2D2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BX73 Secondary accession number(s): B2RBK4, D3DSX8, Q8N0X9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 8 Human chromosome 8: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
