Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BX73 (TM2D2_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 80. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
TM2 domain-containing protein 2
Alternative name(s):
Beta-amyloid-binding protein-like protein 1
Short name=BBP-like protein 1
Gene names
Name:TM2D2
Synonyms:BLP1
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length214 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at transcript level

General annotation (Comments)

Subcellular location

Membrane; Multi-pass membrane protein Potential.

Tissue specificity

Widely expressed. Ref.1

Sequence similarities

Belongs to the TM2 family.

Ontologies

Keywords
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
   DomainSignal
Transmembrane
Transmembrane helix
   PTMGlycoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BX73-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9BX73-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-76: MVLGGCPVSY...HSPVILCSYL → MKKCLLPVLITCMQTAICKDRMMMIMILLVNYR

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 3535 Potential
Chain36 – 214179TM2 domain-containing protein 2
PRO_0000298982

Regions

Transmembrane145 – 16521Helical; Potential
Transmembrane183 – 20321Helical; Potential

Amino acid modifications

Glycosylation921N-linked (GlcNAc...) Potential

Natural variations

Alternative sequence1 – 7676MVLGG…LCSYL → MKKCLLPVLITCMQTAICKD RMMMIMILLVNYR in isoform 2.
VSP_027495

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2001. Version 1.
Checksum: BB928712AF2F78A8

FASTA21422,871
        10         20         30         40         50         60 
MVLGGCPVSY LLLCGQAALL LGNLLLLHCV SRSHSQNATA EPELTSAGAA QPEGPGGAAS 

        70         80         90        100        110        120 
WEYGDPHSPV ILCSYLPDEF IECEDPVDHV GNATASQELG YGCLKFGGQA YSDVEHTSVQ 

       130        140        150        160        170        180 
CHALDGIECA SPRTFLRENK PCIKYTGHYF ITTLLYSFFL GCFGVDRFCL GHTGTAVGKL 

       190        200        210 
LTLGGLGIWW FVDLILLITG GLMPSDGSNW CTVY 

« Hide

Isoform 2 [UniParc].

Checksum: CD9F9F7CEE5CB388
Show »

FASTA17119,012

References

« Hide 'large scale' references
[1]"Beta-amyloid peptide-induced apoptosis regulated by a novel protein containing a G protein activation module."
Kajkowski E.M., Lo C.F., Ning X., Walker S., Sofia H.J., Wang W., Edris W., Chanda P., Wagner E., Vile S., Ryan K., McHendry-Rinde B., Smith S.C., Wood A., Rhodes K.J., Kennedy J.D., Bard J., Jacobsen J.S., Ozenberger B.A.
J. Biol. Chem. 276:18748-18756(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Ovary and Placenta.
[3]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Testis.
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (DEC-2006) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Pancreas.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF353991 mRNA. Translation: AAK35065.1.
AK075027 mRNA. Translation: BAC11359.1.
AK075155 mRNA. Translation: BAC11437.1.
AK314703 mRNA. Translation: BAG37251.1.
AL834224 mRNA. Translation: CAH10695.1.
CH471080 Genomic DNA. Translation: EAW63286.1.
CH471080 Genomic DNA. Translation: EAW63288.1.
CH471080 Genomic DNA. Translation: EAW63287.1.
BC004878 mRNA. Translation: AAH04878.2.
BC109049 mRNA. Translation: AAI09050.1.
BC109050 mRNA. Translation: AAI09051.1.
RefSeqNP_001019551.1. NM_001024380.1.
NP_001019552.1. NM_001024381.1.
NP_114146.3. NM_031940.3.
NP_510882.1. NM_078473.2.
XP_005273714.1. XM_005273657.1.
UniGeneHs.7471.

3D structure databases

ProteinModelPortalQ9BX73.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

IntActQ9BX73. 1 interaction.
MINTMINT-8201757.
STRING9606.ENSP00000416050.

Polymorphism databases

DMDM74733464.

Proteomic databases

PaxDbQ9BX73.
PRIDEQ9BX73.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000397070; ENSP00000380260; ENSG00000169490. [Q9BX73-2]
ENST00000412303; ENSP00000402964; ENSG00000169490. [Q9BX73-2]
ENST00000456397; ENSP00000416050; ENSG00000169490. [Q9BX73-1]
ENST00000456845; ENSP00000391674; ENSG00000169490. [Q9BX73-2]
GeneID83877.
KEGGhsa:83877.
UCSCuc003xmk.3. human. [Q9BX73-1]
uc003xml.3. human. [Q9BX73-2]

Organism-specific databases

CTD83877.
GeneCardsGC08M038846.
HGNCHGNC:24127. TM2D2.
HPAHPA047152.
HPA050547.
MIM610081. gene.
neXtProtNX_Q9BX73.
PharmGKBPA142670799.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG281716.
HOGENOMHOG000007596.
HOVERGENHBG071725.
InParanoidQ9BX73.
OMAEDGSNWN.
OrthoDBEOG7K0ZDG.
PhylomeDBQ9BX73.
TreeFamTF314896.

Gene expression databases

ArrayExpressQ9BX73.
BgeeQ9BX73.
CleanExHS_TM2D2.
GenevestigatorQ9BX73.

Family and domain databases

InterProIPR007829. TM2.
[Graphical view]
PfamPF05154. TM2. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSTM2D2. human.
GenomeRNAi83877.
NextBio72921.
PROQ9BX73.
SOURCESearch...

Entry information

Entry nameTM2D2_HUMAN
AccessionPrimary (citable) accession number: Q9BX73
Secondary accession number(s): B2RBK4, D3DSX8, Q8N0X9
Entry history
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: June 1, 2001
Last modified: April 16, 2014
This is version 80 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 8

Human chromosome 8: entries, gene names and cross-references to MIM