Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BX73

- TM2D2_HUMAN

UniProt

Q9BX73 - TM2D2_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

TM2 domain-containing protein 2

Gene

TM2D2

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
TM2 domain-containing protein 2
Alternative name(s):
Beta-amyloid-binding protein-like protein 1
Short name:
BBP-like protein 1
Gene namesi
Name:TM2D2
Synonyms:BLP1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 8

Organism-specific databases

HGNCiHGNC:24127. TM2D2.

Subcellular locationi

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670799.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 3535Sequence AnalysisAdd
BLAST
Chaini36 – 214179TM2 domain-containing protein 2PRO_0000298982Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi92 – 921N-linked (GlcNAc...)Sequence Analysis

Keywords - PTMi

Glycoprotein

Proteomic databases

MaxQBiQ9BX73.
PaxDbiQ9BX73.
PRIDEiQ9BX73.

Expressioni

Tissue specificityi

Widely expressed.1 Publication

Gene expression databases

BgeeiQ9BX73.
CleanExiHS_TM2D2.
ExpressionAtlasiQ9BX73. baseline and differential.
GenevestigatoriQ9BX73.

Organism-specific databases

HPAiHPA047152.
HPA050547.

Interactioni

Protein-protein interaction databases

IntActiQ9BX73. 1 interaction.
MINTiMINT-8201757.
STRINGi9606.ENSP00000416050.

Structurei

3D structure databases

ProteinModelPortaliQ9BX73.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei145 – 16521HelicalSequence AnalysisAdd
BLAST
Transmembranei183 – 20321HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Belongs to the TM2 family.Curated

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG281716.
GeneTreeiENSGT00730000111181.
HOGENOMiHOG000007596.
HOVERGENiHBG071725.
InParanoidiQ9BX73.
OMAiEDGSNWN.
OrthoDBiEOG7K0ZDG.
PhylomeDBiQ9BX73.
TreeFamiTF314896.

Family and domain databases

InterProiIPR007829. TM2.
[Graphical view]
PfamiPF05154. TM2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BX73-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVLGGCPVSY LLLCGQAALL LGNLLLLHCV SRSHSQNATA EPELTSAGAA
60 70 80 90 100
QPEGPGGAAS WEYGDPHSPV ILCSYLPDEF IECEDPVDHV GNATASQELG
110 120 130 140 150
YGCLKFGGQA YSDVEHTSVQ CHALDGIECA SPRTFLRENK PCIKYTGHYF
160 170 180 190 200
ITTLLYSFFL GCFGVDRFCL GHTGTAVGKL LTLGGLGIWW FVDLILLITG
210
GLMPSDGSNW CTVY
Length:214
Mass (Da):22,871
Last modified:June 1, 2001 - v1
Checksum:iBB928712AF2F78A8
GO
Isoform 2 (identifier: Q9BX73-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-76: MVLGGCPVSY...HSPVILCSYL → MKKCLLPVLITCMQTAICKDRMMMIMILLVNYR

Show »
Length:171
Mass (Da):19,012
Checksum:iCD9F9F7CEE5CB388
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7676MVLGG…LCSYL → MKKCLLPVLITCMQTAICKD RMMMIMILLVNYR in isoform 2. 3 PublicationsVSP_027495Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF353991 mRNA. Translation: AAK35065.1.
AK075027 mRNA. Translation: BAC11359.1.
AK075155 mRNA. Translation: BAC11437.1.
AK314703 mRNA. Translation: BAG37251.1.
AL834224 mRNA. Translation: CAH10695.1.
CH471080 Genomic DNA. Translation: EAW63286.1.
CH471080 Genomic DNA. Translation: EAW63288.1.
CH471080 Genomic DNA. Translation: EAW63287.1.
BC004878 mRNA. Translation: AAH04878.2.
BC109049 mRNA. Translation: AAI09050.1.
BC109050 mRNA. Translation: AAI09051.1.
CCDSiCCDS43733.1. [Q9BX73-2]
CCDS6111.1. [Q9BX73-1]
RefSeqiNP_001019551.1. NM_001024380.1. [Q9BX73-2]
NP_001019552.1. NM_001024381.1. [Q9BX73-2]
NP_114146.3. NM_031940.3. [Q9BX73-2]
NP_510882.1. NM_078473.2. [Q9BX73-1]
XP_005273714.1. XM_005273657.1. [Q9BX73-2]
XP_006716471.1. XM_006716408.1. [Q9BX73-2]
UniGeneiHs.7471.

Genome annotation databases

EnsembliENST00000397070; ENSP00000380260; ENSG00000169490. [Q9BX73-2]
ENST00000456397; ENSP00000416050; ENSG00000169490. [Q9BX73-1]
ENST00000456845; ENSP00000391674; ENSG00000169490. [Q9BX73-2]
GeneIDi83877.
KEGGihsa:83877.
UCSCiuc003xmk.3. human. [Q9BX73-1]
uc003xml.3. human. [Q9BX73-2]

Polymorphism databases

DMDMi74733464.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF353991 mRNA. Translation: AAK35065.1 .
AK075027 mRNA. Translation: BAC11359.1 .
AK075155 mRNA. Translation: BAC11437.1 .
AK314703 mRNA. Translation: BAG37251.1 .
AL834224 mRNA. Translation: CAH10695.1 .
CH471080 Genomic DNA. Translation: EAW63286.1 .
CH471080 Genomic DNA. Translation: EAW63288.1 .
CH471080 Genomic DNA. Translation: EAW63287.1 .
BC004878 mRNA. Translation: AAH04878.2 .
BC109049 mRNA. Translation: AAI09050.1 .
BC109050 mRNA. Translation: AAI09051.1 .
CCDSi CCDS43733.1. [Q9BX73-2 ]
CCDS6111.1. [Q9BX73-1 ]
RefSeqi NP_001019551.1. NM_001024380.1. [Q9BX73-2 ]
NP_001019552.1. NM_001024381.1. [Q9BX73-2 ]
NP_114146.3. NM_031940.3. [Q9BX73-2 ]
NP_510882.1. NM_078473.2. [Q9BX73-1 ]
XP_005273714.1. XM_005273657.1. [Q9BX73-2 ]
XP_006716471.1. XM_006716408.1. [Q9BX73-2 ]
UniGenei Hs.7471.

3D structure databases

ProteinModelPortali Q9BX73.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

IntActi Q9BX73. 1 interaction.
MINTi MINT-8201757.
STRINGi 9606.ENSP00000416050.

Polymorphism databases

DMDMi 74733464.

Proteomic databases

MaxQBi Q9BX73.
PaxDbi Q9BX73.
PRIDEi Q9BX73.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000397070 ; ENSP00000380260 ; ENSG00000169490 . [Q9BX73-2 ]
ENST00000456397 ; ENSP00000416050 ; ENSG00000169490 . [Q9BX73-1 ]
ENST00000456845 ; ENSP00000391674 ; ENSG00000169490 . [Q9BX73-2 ]
GeneIDi 83877.
KEGGi hsa:83877.
UCSCi uc003xmk.3. human. [Q9BX73-1 ]
uc003xml.3. human. [Q9BX73-2 ]

Organism-specific databases

CTDi 83877.
GeneCardsi GC08M038846.
HGNCi HGNC:24127. TM2D2.
HPAi HPA047152.
HPA050547.
MIMi 610081. gene.
neXtProti NX_Q9BX73.
PharmGKBi PA142670799.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG281716.
GeneTreei ENSGT00730000111181.
HOGENOMi HOG000007596.
HOVERGENi HBG071725.
InParanoidi Q9BX73.
OMAi EDGSNWN.
OrthoDBi EOG7K0ZDG.
PhylomeDBi Q9BX73.
TreeFami TF314896.

Miscellaneous databases

ChiTaRSi TM2D2. human.
GenomeRNAii 83877.
NextBioi 72921.
PROi Q9BX73.
SOURCEi Search...

Gene expression databases

Bgeei Q9BX73.
CleanExi HS_TM2D2.
ExpressionAtlasi Q9BX73. baseline and differential.
Genevestigatori Q9BX73.

Family and domain databases

InterProi IPR007829. TM2.
[Graphical view ]
Pfami PF05154. TM2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Ovary and Placenta.
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Pancreas.

Entry informationi

Entry nameiTM2D2_HUMAN
AccessioniPrimary (citable) accession number: Q9BX73
Secondary accession number(s): B2RBK4, D3DSX8, Q8N0X9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 11, 2007
Last sequence update: June 1, 2001
Last modified: October 29, 2014
This is version 84 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 8
    Human chromosome 8: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3