Q9BX66 (SRBS1_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 124.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Sorbin and SH3 domain-containing protein 1 Alternative name(s): Ponsin SH3 domain protein 5 SH3P12 c-Cbl-associated protein Short name=CAP | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 1292 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Plays a role in tyrosine phosphorylation of CBL by linking CBL to the insulin receptor. Required for insulin-stimulated glucose transport. Involved in formation of actin stress fibers and focal adhesions By similarity. UniProtKB Q62417 |
| Subunit structure | Interacts (via third SH3 domain) with the Ten-1 ICD form of TENM1; the interaction induces the translocation of SORBS1 to the nucleus By similarity. Interacts with the long isoform of MLLT4/afadin and with VCL. MLLT4 and VCL bind to SORBS1 in a competitive manner and do not form a ternary complex. Interacts with ABL1, CBL, CBLB and INPPL1/SHIP2 through the third SH3 domain. Interaction with ABL1 occurs only after insulin stimulation while this has no effect on the interaction with INPPL1. Interacts with the insulin receptor but dissociates from it following insulin stimulation. Also interacts with SCA7, PTK2/FAK1 and flotillin. Interacts (via SH3 domain 2) with PXN. Ref.1 Ref.2 Ref.4 Ref.5 |
| Subcellular location | Cell junction › adherens junction. Cell membrane. Cytoplasm › cytoskeleton. Cell junction › focal adhesion. Nucleus By similarity. Nucleus matrix By similarity. Note: Colocalizes with the Ten-1 ICD form of TENM1 in the nucleus By similarity. Colocalizes with actin stress fibers. Also detected at the plasma membrane and in neuronal intranuclear inclusions. Colocalized with PXN at focal adhesions during myogenic differentiation. Ref.2 Ref.5 |
| Tissue specificity | Detected in skeletal muscle (at protein level). Widely expressed with highest levels in heart and skeletal muscle. Ref.1 Ref.5 |
| Post-translational modification | O-glycosylated By similarity. |
| Sequence similarities | Contains 3 SH3 domains. Contains 1 SoHo domain. |
| Sequence caution | The sequence AAB93496.1 differs from that shown. Reason: Frameshift at positions 861, 867 and 885. The sequence BAA92534.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. |
Ontologies
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| ABL1 | P00519 | 2 | EBI-433642,EBI-375543 | |
| INPPL1 | O15357 | 5 | EBI-433642,EBI-1384248 |
Alternative products
| This entry describes 12 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.1 (identifier: Q9BX66-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.1 (identifier: Q9BX66-2) The sequence of this isoform differs from the canonical sequence as follows: 434-453: DNPYTPTYQFPASTPSPKSE → TKSCSVMSPRLECSGTVIAHCSLKLLDSSNPPTSASQVAGTA 955-1117: Missing. | ||||||
| Note: Ref.1 (AAK37564) sequence is in conflict in positions: 435:K->E, 452-455:AHCS->SRCG, 463:N->D. | ||||||
| Isoform 3 Ref.1 (identifier: Q9BX66-3) The sequence of this isoform differs from the canonical sequence as follows: 147-215: Missing. 408-453: Missing. 602-635: Missing. 956-975: FSSHSKLITPAPSSLPHSRR → LSHHSLRAGPDLTESEKSYV 976-1213: Missing. | ||||||
| Isoform 4 Ref.1 (identifier: Q9BX66-4) The sequence of this isoform differs from the canonical sequence as follows: 26-57: Missing. 101-109: Missing. 148-270: Missing. 408-453: Missing. 552-635: Missing. 738-793: Missing. 955-1212: Missing. | ||||||
| Note: Contains a phosphoserine at position 346. Contains a phosphoserine at position 603. | ||||||
| Isoform 5 Ref.3 (identifier: Q9BX66-5) The sequence of this isoform differs from the canonical sequence as follows: 101-109: Missing. 431-451: Missing. 955-1212: Missing. | ||||||
| Note: Contains a phosphoserine at position 923. | ||||||
| Isoform 6 Ref.4 (identifier: Q9BX66-6) The sequence of this isoform differs from the canonical sequence as follows: 101-109: Missing. 148-270: Missing. 580-635: Missing. 955-1212: Missing. | ||||||
| Note: Contains a phosphoserine at position 765. | ||||||
| Isoform 7 (identifier: Q9BX66-7) The sequence of this isoform differs from the canonical sequence as follows: 26-57: Missing. 101-109: Missing. 408-453: Missing. 552-635: Missing. 795-799: MRPAR → KYDWA 800-1292: Missing. | ||||||
| Note: No experimental confirmation available. Contains a phosphoserine at position 469. | ||||||
| Isoform 8 Ref.2 (identifier: Q9BX66-8) The sequence of this isoform differs from the canonical sequence as follows: 26-57: Missing. 148-270: Missing. 408-453: Missing. 580-601: Missing. 955-1212: Missing. | ||||||
| Note: Contains a phosphoserine at position 730. | ||||||
| Isoform 9 (identifier: Q9BX66-9) The sequence of this isoform differs from the canonical sequence as follows: 148-270: Missing. 408-453: Missing. 552-635: Missing. 955-1212: Missing. | ||||||
| Note: Contains a phosphoserine at position 387. Contains a phosphoserine at position 700. | ||||||
| Isoform 10 (identifier: Q9BX66-10) The sequence of this isoform differs from the canonical sequence as follows: 26-57: Missing. 408-453: Missing. 552-635: Missing. 738-793: Missing. 955-1212: Missing. | ||||||
| Note: No experimental confirmation available. Contains a phosphoserine at position 478. Contains a phosphoserine at position 735. | ||||||
| Isoform 11 (identifier: Q9BX66-11) The sequence of this isoform differs from the canonical sequence as follows: 408-453: Missing. 1213-1213: Q → QLSHHSLRAGPDLTESEKSYV | ||||||
| Isoform 12 (identifier: Q9BX66-12) The sequence of this isoform differs from the canonical sequence as follows: 26-57: Missing. 148-270: Missing. 319-328: Missing. 408-453: Missing. 580-601: Missing. 709-709: K → KVDRKGGNAH...PQSELAPSRG 955-1212: Missing. | ||||||
| Note: No experimental confirmation available. Derived from mouse ortholog data. Contains a phosphoserine at position 1213. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||||||||||||||||||||||||
Molecule processing | ||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 1292 | 1292 | Sorbin and SH3 domain-containing protein 1 | PRO_0000072185 | ||||||||||||||||||||||||||||||||||||||||
Regions | ||||||||||||||||||||||||||||||||||||||||||||
| Domain | 366 – 469 | 104 | SoHo | |||||||||||||||||||||||||||||||||||||||||
| Domain | 793 – 852 | 60 | SH3 1 | |||||||||||||||||||||||||||||||||||||||||
| Domain | 867 – 928 | 62 | SH3 2 | |||||||||||||||||||||||||||||||||||||||||
| Domain | 1231 – 1292 | 62 | SH3 3 | |||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 86 | 1 | Phosphoserine Ref.12 | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 89 | 1 | Phosphoserine Ref.12 | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 134 | 1 | Phosphotyrosine By similarity | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 349 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 472 | 1 | Phosphoserine Ref.12 | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 481 | 1 | Phosphoserine Ref.14 | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 497 | 1 | Phosphothreonine By similarity | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 536 | 1 | Phosphotyrosine; by ABL1 By similarity | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 556 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 640 | 1 | Phosphoserine By similarity | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 654 | 1 | Phosphotyrosine; by ABL1 By similarity | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 665 | 1 | Phosphoserine Ref.12 | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 862 | 1 | Phosphothreonine Ref.12 | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 945 | 1 | Phosphoserine Ref.12 | |||||||||||||||||||||||||||||||||||||||||
| Modified residue | 1240 | 1 | Phosphotyrosine; by ABL1 By similarity | |||||||||||||||||||||||||||||||||||||||||
Natural variations | ||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 26 – 57 | 32 | Missing in isoform 4, isoform 7, isoform 8, isoform 10 and isoform 12. Ref.1 Ref.2 | VSP_050895 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 101 – 109 | 9 | Missing in isoform 4, isoform 5, isoform 6 and isoform 7. Ref.4 | VSP_050896 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 147 – 215 | 69 | Missing in isoform 3. Ref.1 | VSP_050898 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 148 – 270 | 123 | Missing in isoform 4, isoform 6, isoform 8, isoform 9 and isoform 12. Ref.1 Ref.2 Ref.4 | VSP_050899 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 319 – 328 | 10 | Missing in isoform 12. | VSP_041193 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 408 – 453 | 46 | Missing in isoform 3, isoform 4, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11 and isoform 12. Ref.1 Ref.2 | VSP_050900 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 431 – 451 | 21 | Missing in isoform 5. Ref.1 Ref.2 | VSP_050901 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 434 – 453 | 20 | DNPYT…SPKSE → TKSCSVMSPRLECSGTVIAH CSLKLLDSSNPPTSASQVAG TA in isoform 2. Ref.1 | VSP_050902 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 552 – 635 | 84 | Missing in isoform 4, isoform 7, isoform 9 and isoform 10. Ref.1 | VSP_050903 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 580 – 635 | 56 | Missing in isoform 6. Ref.4 | VSP_050905 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 580 – 601 | 22 | Missing in isoform 8 and isoform 12. Ref.2 | VSP_050904 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 602 – 635 | 34 | Missing in isoform 3. Ref.1 | VSP_050906 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 709 | 1 | K → KVDRKGGNAHMISSSSVHSR TFNTSNALGPVCKHKKPLSA AKACISEILPSKFKPRLSAP SALLQEQKSILLPSEKAQSC ENLCVSGSLNDSKRGLPLQV GGSIENLLMRSRRDYDSKSS STMSLQEYSTSGRRPCPLSR KAGMQFTMLYRDMHQINRSG LFLGSISSSSSVRDLASHFE KSSLALSRGELGPSQEGSEH IPKHTVSSRITAFEQLIQRS RSMPSLDLSGRLSKSPTPVL SRGSLTSARSAESLLESTKL HPKEMDGMNSSGVYASPTCS NMAHHALSFRGLVPSEPLST CSDDVDRCSNISTDSREGSG GSVHGDFPKHRLNKCKGTCP ASYTRFTTIRKHEQQQTSRQ PEWRLDARGDKSTLLRNIYL MSPLPFRLKKPLHHHPRQPS PGDSSGLLVGQKPDLPSQPH QDQPPSGGKPVVPTRLSSRH TMARLSRSSEPSQERPTALE DYPRAINNGNSVPYSDHSLD RNNNPQSELAPSRG in isoform 12. | VSP_041194 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 738 – 793 | 56 | Missing in isoform 4 and isoform 10. Ref.1 | VSP_050907 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 795 – 799 | 5 | MRPAR → KYDWA in isoform 7. | VSP_050908 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 800 – 1292 | 493 | Missing in isoform 7. | VSP_050909 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 955 – 1212 | 258 | Missing in isoform 4, isoform 5, isoform 6, isoform 8, isoform 9, isoform 10 and isoform 12. Ref.1 Ref.2 Ref.3 Ref.4 | VSP_050911 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 955 – 1117 | 163 | Missing in isoform 2. Ref.1 | VSP_050910 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 956 – 975 | 20 | FSSHS…PHSRR → LSHHSLRAGPDLTESEKSYV in isoform 3. Ref.1 | VSP_050912 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 976 – 1213 | 238 | Missing in isoform 3. Ref.1 | VSP_050913 | ||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1213 | 1 | Q → QLSHHSLRAGPDLTESEKSY V in isoform 11. | VSP_039210 | ||||||||||||||||||||||||||||||||||||||||
| Natural variant | 61 | 1 | L → P. Ref.1 Ref.2 Ref.3 Ref.4 Ref.5 Ref.6 Ref.7 Ref.10 Corresponds to variant rs943542 [ dbSNP | Ensembl ]. | VAR_047652 | ||||||||||||||||||||||||||||||||||||||||
| Natural variant | 74 | 1 | R → W. Ref.3 | VAR_019653 | ||||||||||||||||||||||||||||||||||||||||
| Natural variant | 175 | 1 | G → V. Corresponds to variant rs7081076 [ dbSNP | Ensembl ]. | VAR_047653 | ||||||||||||||||||||||||||||||||||||||||
| Natural variant | 195 | 1 | T → A in a breast cancer sample; somatic mutation. Ref.17 | VAR_035661 | ||||||||||||||||||||||||||||||||||||||||
| Natural variant | 237 | 1 | T → A Has a protective role in both obesity and diabetes. Ref.3 Corresponds to variant rs2281939 [ dbSNP | Ensembl ]. | VAR_019654 | ||||||||||||||||||||||||||||||||||||||||
| Natural variant | 485 | 1 | Y → C. Corresponds to variant rs35808802 [ dbSNP | Ensembl ]. | VAR_047654 | ||||||||||||||||||||||||||||||||||||||||
Experimental info | ||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 9 | 1 | S → P in CAJ97431. Ref.5 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 18 | 1 | P → S in AAD27647. Ref.1 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 18 | 1 | P → S in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 110 | 1 | D → G in AAD27647. Ref.1 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 110 | 1 | D → G in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 113 | 1 | R → K in AAD27647. Ref.1 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 113 | 1 | R → K in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 131 | 1 | A → V in AAD27647. Ref.1 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 131 | 1 | A → V in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 134 | 1 | Y → S in AAD27647. Ref.1 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 134 | 1 | Y → S in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 226 – 228 | 3 | RAS → SAC in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 264 | 1 | T → P in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 292 – 295 | 4 | PSVS → SSEC in AAD27647. Ref.1 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 292 – 295 | 4 | PSVS → SSEC in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 481 | 1 | S → R in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 489 | 1 | E → V in AAD27647. Ref.1 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 489 | 1 | E → V in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 607 | 1 | D → E in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 610 | 1 | L → F in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 644 | 1 | E → G in AAD27647. Ref.1 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 644 | 1 | E → G in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 679 | 1 | R → S in AAD27647. Ref.1 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 679 | 1 | R → S in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 690 | 1 | D → V in AAD27647. Ref.1 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 690 | 1 | D → V in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 694 | 1 | Q → R in CAJ97431. Ref.5 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 695 | 1 | G → D in AAD27647. Ref.1 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 695 | 1 | G → D in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 710 | 1 | D → N in AAD27647. Ref.1 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 710 | 1 | D → N in AAF22175. Ref.3 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1156 | 1 | V → G in AAK37563. Ref.1 | |||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 1156 | 1 | V → G in AAK37564. Ref.1 | |||||||||||||||||||||||||||||||||||||||||
Secondary structure | ||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 795 – 802 | 8 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 819 – 824 | 6 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 830 – 834 | 5 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 839 – 843 | 5 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 844 – 846 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 847 – 849 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 870 – 874 | 5 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 893 – 899 | 7 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 901 – 908 | 8 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 910 – 912 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 915 – 919 | 5 | ||||||||||||||||||||||||||||||||||||||||||
| Helix | 920 – 922 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 923 – 927 | 5 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1230 – 1233 | 4 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1235 – 1240 | 6 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1257 – 1263 | 7 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1267 – 1273 | 7 | ||||||||||||||||||||||||||||||||||||||||||
| Turn | 1274 – 1276 | 3 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1279 – 1283 | 5 | ||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 1286 – 1289 | 4 | ||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Cloning, mapping, and characterization of the human sorbin and SH3 domain containing 1 (SORBS1) gene: a protein associated with c-Abl during insulin signaling in the hepatoma cell line Hep3B." Lin W.-H., Huang C.-J., Liu M.-W., Chang H.-M., Chen Y.-J., Tai T.-Y., Chuang L.-M. Genomics 74:12-20(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), TISSUE SPECIFICITY, INTERACTION WITH ABL1 AND INSULIN RECEPTOR, VARIANT PRO-61. Tissue: Liver and Skeletal muscle. |
| [2] | "Ataxin-7 interacts with a Cbl-associated protein that it recruits into neuronal intranuclear inclusions." Lebre A.-S., Jamot L., Takahashi J., Spassky N., Leprince C., Ravise N., Zander C., Fujigasaki H., Kussel-Andermann P., Duyckaerts C., Camonis J.H., Brice A. Hum. Mol. Genet. 10:1201-1213(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8), SUBCELLULAR LOCATION, INTERACTION WITH SCA7, VARIANT PRO-61. Tissue: Retina. |
| [3] | "Molecular scanning of the human sorbin and SH3-domain-containing-1 (SORBS1) gene: positive association of the T228A polymorphism with obesity and type 2 diabetes." Lin W.-H., Chiu K.C., Chang H.-M., Lee K.C., Tai T.-Y., Chuang L.-M. Hum. Mol. Genet. 10:1753-1760(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), VARIANTS PRO-61; TRP-74 AND ALA-237. Tissue: Skeletal muscle. |
| [4] | "The c-Cbl-associated protein and c-Cbl are two new partners of the SH2-containing inositol polyphosphate 5-phosphatase SHIP2." Vandenbroere I., Paternotte N., Dumont J.E., Erneux C., Pirson I. Biochem. Biophys. Res. Commun. 300:494-500(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), INTERACTION WITH INPPL1, VARIANT PRO-61. Tissue: Brain. |
| [5] | "Paxillin and ponsin interact in nascent costameres of muscle cells." Gehmlich K., Pinotsis N., Hayess K., van der Ven P.F., Milting H., El Banayosy A., Korfer R., Wilmanns M., Ehler E., Furst D.O. J. Mol. Biol. 369:665-682(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 11), INTERACTION WITH PXN, X-RAY CRYSTALLOGRAPHY (0.83 ANGSTROMS) OF 870-930 IN COMPLEX WITH PXN PEPTIDE, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANT PRO-61. Tissue: Skeletal muscle. |
| [6] | "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro." Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O. DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9), VARIANT PRO-61. Tissue: Brain. |
| [7] | "Towards a catalog of human genes and proteins: sequencing and analysis of 500 novel complete protein coding human cDNAs." Wiemann S., Weil B., Wellenreuther R., Gassenhuber J., Glassl S., Ansorge W., Boecher M., Bloecker H., Bauersachs S., Blum H., Lauber J., Duesterhoeft A., Beyer A., Koehrer K., Strack N., Mewes H.-W., Ottenwaelder B., Obermaier B. Poustka A.Genome Res. 11:422-435(2001) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 10), VARIANT PRO-61. Tissue: Uterus. |
| [8] | "The DNA sequence and comparative analysis of human chromosome 10." Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J. Rogers J.Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [10] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 7 AND 9), VARIANT PRO-61. Tissue: Testis. |
| [11] | "A Fas-ligand associated factor 2, FLAF2, potentiates Fas-ligand stability." Hachiya T., Kobayasi A., Touji S., Tamai K. Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 752-888. Tissue: Placenta. |
| [12] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-86; SER-89; SER-472; SER-665; THR-862 AND SER-945, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-478 AND SER-735 (ISOFORM 10), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1213 (ISOFORM 12), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-346 AND SER-603 (ISOFORM 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-923 (ISOFORM 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-765 (ISOFORM 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-469 (ISOFORM 7), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-730 (ISOFORM 8), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-387 AND SER-700 (ISOFORM 9), MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [13] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [14] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-481, MASS SPECTROMETRY. |
| [15] | "Second SH3 domain of ponsin solved from powder diffraction." Margiolaki I., Wright J.P., Wilmanns M., Fitch A.N., Pinotsis N. J. Am. Chem. Soc. 129:11865-11871(2007) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.5 ANGSTROMS) OF 870-930. |
| [16] | "Solution structure of SH3 domains of human Sorbin and SH3 domain-containing protein 1." RIKEN structural genomics initiative (RSGI) Submitted (FEB-2009) to the PDB data bank Cited for: STRUCTURE BY NMR OF 796-926. |
| [17] | "The consensus coding sequences of human breast and colorectal cancers." Sjoeblom T., Jones S., Wood L.D., Parsons D.W., Lin J., Barber T.D., Mandelker D., Leary R.J., Ptak J., Silliman N., Szabo S., Buckhaults P., Farrell C., Meeh P., Markowitz S.D., Willis J., Dawson D., Willson J.K.V. Velculescu V.E.Science 314:268-274(2006) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] ALA-195. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AF136380 mRNA. Translation: AAD27647.1. AF356525 mRNA. Translation: AAK37563.1. AF356526 mRNA. Translation: AAK37564.1. AF356527 mRNA. Translation: AAK37565.1. AF330623 mRNA. Translation: AAK57479.1. AF330624 mRNA. Translation: AAK57480.1. AF136381 mRNA. Translation: AAF22175.1. AJ489942 mRNA. Translation: CAD34588.1. AM260536 mRNA. Translation: CAJ97431.1. AB037717 mRNA. Translation: BAA92534.1. Different initiation. AL117472 mRNA. Translation: CAB55947.1. AL158165 Genomic DNA. Translation: CAI14378.1. AL158165 Genomic DNA. Translation: CAI14379.1. AL158165 Genomic DNA. Translation: CAI14380.1. AL158165 Genomic DNA. Translation: CAI14381.1. AL158165 Genomic DNA. Translation: CAI14382.1. AL158165 Genomic DNA. Translation: CAI14383.1. AL158165 Genomic DNA. Translation: CAI14384.1. AL158165 Genomic DNA. Translation: CAI14385.1. CH471066 Genomic DNA. Translation: EAW49999.1. CH471066 Genomic DNA. Translation: EAW50007.1. BC042612 mRNA. Translation: AAH42612.1. BC152463 mRNA. Translation: AAI52464.1. U70668 mRNA. Translation: AAB93496.1. Frameshift. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IPI | IPI00002491. IPI00010554. IPI00010555. IPI00064591. IPI00186452. IPI00306791. IPI00334908. IPI00383430. IPI00454950. IPI00454951. IPI00807389. IPI01018230. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PIR | T17257. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| RefSeq | NP_001030126.1. NM_001034954.1. NP_001030127.1. NM_001034955.1. NP_001030128.1. NM_001034956.1. NP_001030129.1. NM_001034957.1. NP_006425.2. NM_006434.2. NP_056200.1. NM_015385.2. NP_079267.1. NM_024991.1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UniGene | Hs.38621. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
3D structure databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProteinModelPortal | Q9BX66. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMR | Q9BX66. Positions 791-930, 1228-1292. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ModBase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protein-protein interaction databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| IntAct | Q9BX66. 12 interactions. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MINT | MINT-2792261. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
PTM databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhosphoSite | Q9BX66. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Polymorphism databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DMDM | 215273913. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Proteomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PaxDb | Q9BX66. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PRIDE | Q9BX66. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Protocols and materials databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| DNASU | 10580. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Genome annotation databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Ensembl | ENST00000277982; ENSP00000277982; ENSG00000095637. ENST00000306402; ENSP00000302556; ENSG00000095637. ENST00000347291; ENSP00000277985; ENSG00000095637. ENST00000353505; ENSP00000343998; ENSG00000095637. ENST00000354106; ENSP00000277984; ENSG00000095637. ENST00000361941; ENSP00000355136; ENSG00000095637. ENST00000371227; ENSP00000360271; ENSG00000095637. ENST00000371239; ENSP00000360283; ENSG00000095637. ENST00000371241; ENSP00000360285; ENSG00000095637. ENST00000371245; ENSP00000360291; ENSG00000095637. ENST00000371246; ENSP00000360292; ENSG00000095637. ENST00000371247; ENSP00000360293; ENSG00000095637. ENST00000371249; ENSP00000360295; ENSG00000095637. ENST00000393949; ENSP00000377521; ENSG00000095637. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneID | 10580. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KEGG | hsa:10580. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| UCSC | uc001kkl.3. human. uc001kkm.3. human. uc001kkn.3. human. uc001kko.3. human. uc001kkp.3. human. uc001kkq.3. human. uc001kkr.3. human. uc001kks.3. human. uc001kkv.3. human. uc001kkw.3. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Organism-specific databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| CTD | 10580. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GeneCards | GC10M097061. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HGNC | HGNC:14565. SORBS1. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HPA | HPA027559. HPA036994. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| MIM | 605264. gene. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| neXtProt | NX_Q9BX66. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PharmGKB | PA37899. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HUGE | Search... Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenAtlas | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Phylogenomic databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| eggNOG | NOG256936. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| HOVERGEN | HBG053053. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InParanoid | Q9BX66. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| KO | K06086. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OMA | ECDVGAS. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| OrthoDB | EOG40K7Z2. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PhylomeDB | Q9BX66. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Enzyme and pathway databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pathway_Interaction_DB | insulin_pathway. Insulin Pathway. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Reactome | REACT_17044. Muscle contraction. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Gene expression databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ArrayExpress | Q9BX66. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Bgee | Q9BX66. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Genevestigator | Q9BX66. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GermOnline | ENSG00000095637. Homo sapiens. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Family and domain databases | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| InterPro | IPR011511. SH3_2. IPR001452. SH3_domain. IPR003127. Sorb. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| Pfam | PF00018. SH3_1. 2 hits. PF07653. SH3_2. 1 hit. PF02208. Sorb. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SMART | SM00326. SH3. 3 hits. SM00459. Sorb. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SUPFAM | SSF50044. SH3. 3 hits. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| PROSITE | PS50002. SH3. 3 hits. PS50831. SOHO. 1 hit. [Graphical view] | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ProtoNet | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Other | |||||||||||||||||||||||||||||||||||||||||||||||||||||||
| ChiTaRS | SORBS1. human. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| EvolutionaryTrace | Q9BX66. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| GenomeRNAi | 10580. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| NextBio | 40165. | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
| SOURCE | Search... | ||||||||||||||||||||||||||||||||||||||||||||||||||||||
Entry information
| Entry name | SRBS1_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BX66 Secondary accession number(s): A0AED4 Q9Y338 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 10 Human chromosome 10: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
