Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BX66

- SRBS1_HUMAN

UniProt

Q9BX66 - SRBS1_HUMAN

Protein

Sorbin and SH3 domain-containing protein 1

Gene

SORBS1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 139 (01 Oct 2014)
      Sequence version 3 (11 Jan 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role in tyrosine phosphorylation of CBL by linking CBL to the insulin receptor. Required for insulin-stimulated glucose transport. Involved in formation of actin stress fibers and focal adhesions By similarity.By similarity

    GO - Molecular functioni

    1. actin binding Source: ProtInc
    2. cytoskeletal protein binding Source: ProtInc
    3. insulin receptor binding Source: UniProtKB
    4. protein binding Source: UniProtKB
    5. SH3/SH2 adaptor activity Source: BHF-UCL

    GO - Biological processi

    1. cell-matrix adhesion Source: ProtInc
    2. cellular response to insulin stimulus Source: BHF-UCL
    3. focal adhesion assembly Source: UniProtKB
    4. glucose transport Source: UniProtKB
    5. insulin receptor signaling pathway Source: UniProtKB
    6. muscle contraction Source: Reactome
    7. positive regulation of establishment of protein localization to plasma membrane Source: BHF-UCL
    8. positive regulation of glucose import Source: BHF-UCL
    9. positive regulation of glycogen biosynthetic process Source: BHF-UCL
    10. positive regulation of lipid biosynthetic process Source: BHF-UCL
    11. positive regulation of signal transduction Source: GOC
    12. stress fiber assembly Source: UniProtKB

    Keywords - Biological processi

    Transport

    Enzyme and pathway databases

    ReactomeiREACT_20558. Smooth Muscle Contraction.
    SignaLinkiQ9BX66.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Sorbin and SH3 domain-containing protein 1
    Alternative name(s):
    Ponsin
    SH3 domain protein 5
    SH3P12
    c-Cbl-associated protein
    Short name:
    CAP
    Gene namesi
    Name:SORBS1Imported
    Synonyms:KIAA0894, KIAA1296, SH3D5
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 10

    Organism-specific databases

    HGNCiHGNC:14565. SORBS1.

    Subcellular locationi

    Cell junctionadherens junction. Cell membrane. Cytoplasmcytoskeleton. Cell junctionfocal adhesion. Nucleus By similarity. Nucleus matrix By similarity
    Note: Colocalizes with the Ten-1 ICD form of TENM1 in the nucleus By similarity. Colocalizes with actin stress fibers. Also detected at the plasma membrane and in neuronal intranuclear inclusions. Colocalized with PXN at focal adhesions during myogenic differentiation.By similarity

    GO - Cellular componenti

    1. cell-cell adherens junction Source: UniProtKB
    2. cell-substrate adherens junction Source: UniProtKB
    3. cytosol Source: BHF-UCL
    4. focal adhesion Source: UniProtKB-SubCell
    5. membrane raft Source: UniProtKB
    6. nuclear matrix Source: UniProtKB-SubCell
    7. nucleus Source: UniProtKB
    8. plasma membrane Source: UniProtKB-SubCell
    9. stress fiber Source: UniProtKB
    10. zonula adherens Source: ProtInc

    Keywords - Cellular componenti

    Cell junction, Cell membrane, Cytoplasm, Cytoskeleton, Membrane, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA37899.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 12921292Sorbin and SH3 domain-containing protein 1PRO_0000072185Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei86 – 861Phosphoserine1 Publication
    Modified residuei89 – 891Phosphoserine1 Publication
    Modified residuei369 – 3691PhosphoserineBy similarity
    Modified residuei472 – 4721Phosphoserine1 Publication
    Modified residuei481 – 4811Phosphoserine1 Publication
    Modified residuei536 – 5361Phosphotyrosine; by ABL1By similarity
    Modified residuei654 – 6541Phosphotyrosine; by ABL1By similarity
    Modified residuei665 – 6651Phosphoserine1 Publication
    Modified residuei862 – 8621Phosphothreonine1 Publication
    Modified residuei945 – 9451Phosphoserine1 Publication
    Modified residuei1240 – 12401Phosphotyrosine; by ABL1By similarity

    Post-translational modificationi

    O-glycosylated.By similarity

    Keywords - PTMi

    Glycoprotein, Phosphoprotein

    Proteomic databases

    MaxQBiQ9BX66.
    PaxDbiQ9BX66.
    PRIDEiQ9BX66.

    PTM databases

    PhosphoSiteiQ9BX66.

    Expressioni

    Tissue specificityi

    Detected in skeletal muscle (at protein level). Widely expressed with highest levels in heart and skeletal muscle.2 Publications

    Gene expression databases

    ArrayExpressiQ9BX66.
    BgeeiQ9BX66.
    GenevestigatoriQ9BX66.

    Organism-specific databases

    HPAiHPA027559.
    HPA036994.
    HPA043084.

    Interactioni

    Subunit structurei

    Interacts (via third SH3 domain) with the Ten-1 ICD form of TENM1; the interaction induces the translocation of SORBS1 to the nucleus. Interacts with INSM1 By similarity. Interacts with the long isoform of MLLT4/afadin and with VCL. MLLT4 and VCL bind to SORBS1 in a competitive manner and do not form a ternary complex. Interacts with ABL1, CBL, CBLB and INPPL1/SHIP2 through the third SH3 domain. Interaction with ABL1 occurs only after insulin stimulation while this has no effect on the interaction with INPPL1. Interacts with the insulin receptor but dissociates from it following insulin stimulation. Also interacts with SCA7, PTK2/FAK1 and flotillin. Interacts (via SH3 domain 2) with PXN.By similarity4 Publications

    Binary interactionsi

    WithEntry#Exp.IntActNotes
    ABL1P005192EBI-433642,EBI-375543
    ATXN7O1526515EBI-433642,EBI-708350
    Dnm2P390525EBI-433642,EBI-349613From a different organism.
    HTTP428584EBI-433642,EBI-466029
    INPPL1O153575EBI-433642,EBI-1384248
    PAK2Q131772EBI-433642,EBI-1045887

    Protein-protein interaction databases

    BioGridi115831. 27 interactions.
    IntActiQ9BX66. 25 interactions.
    MINTiMINT-2792261.

    Structurei

    Secondary structure

    1
    1292
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi796 – 8027
    Beta strandi819 – 8246
    Beta strandi830 – 8345
    Beta strandi839 – 8435
    Turni844 – 8463
    Beta strandi847 – 8493
    Beta strandi870 – 8745
    Beta strandi893 – 8997
    Beta strandi901 – 9088
    Turni910 – 9123
    Beta strandi915 – 9195
    Helixi920 – 9223
    Beta strandi923 – 9275
    Beta strandi1230 – 12334
    Beta strandi1235 – 12406
    Beta strandi1257 – 12637
    Beta strandi1267 – 12737
    Turni1274 – 12763
    Beta strandi1279 – 12835
    Beta strandi1286 – 12894

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2DL3NMR-A796-850[»]
    2ECZNMR-A870-926[»]
    2LJ0NMR-A1228-1292[»]
    2LJ1NMR-A1228-1291[»]
    2MOXNMR-A791-930[»]
    2O2WX-ray2.27A870-930[»]
    2O31X-ray1.50A870-930[»]
    2O9SX-ray0.83A870-930[»]
    2O9VX-ray1.63A870-930[»]
    4LN2X-ray1.00A866-930[»]
    4LNPX-ray1.41A794-854[»]
    ProteinModelPortaliQ9BX66.
    SMRiQ9BX66. Positions 791-850, 870-930, 1228-1292.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9BX66.

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini366 – 469104SoHoPROSITE-ProRule annotationAdd
    BLAST
    Domaini793 – 85260SH3 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini867 – 92862SH3 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini1231 – 129262SH3 3PROSITE-ProRule annotationAdd
    BLAST

    Sequence similaritiesi

    Contains 3 SH3 domains.PROSITE-ProRule annotation
    Contains 1 SoHo domain.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, SH3 domain

    Phylogenomic databases

    eggNOGiNOG256936.
    HOVERGENiHBG053053.
    InParanoidiQ9BX66.
    KOiK06086.
    OMAiITSEWIS.
    OrthoDBiEOG75XGKP.
    PhylomeDBiQ9BX66.
    TreeFamiTF320680.

    Family and domain databases

    InterProiIPR028506. CAP/ponsin.
    IPR011511. SH3_2.
    IPR001452. SH3_domain.
    IPR003127. Sorb.
    [Graphical view]
    PANTHERiPTHR10661:SF4. PTHR10661:SF4. 1 hit.
    PfamiPF07653. SH3_2. 1 hit.
    PF14604. SH3_9. 2 hits.
    PF02208. Sorb. 1 hit.
    [Graphical view]
    SMARTiSM00326. SH3. 3 hits.
    SM00459. Sorb. 1 hit.
    [Graphical view]
    SUPFAMiSSF50044. SSF50044. 3 hits.
    PROSITEiPS50002. SH3. 3 hits.
    PS50831. SOHO. 1 hit.
    [Graphical view]

    Sequences (12)i

    Sequence statusi: Complete.

    This entry describes 12 isoformsi produced by alternative splicing. Align

    Isoform 11 Publication (identifier: Q9BX66-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSSECDGGSK AVMNGLAPGS NGQDKATADP LRARSISAVK IIPVKTVKNA     50
    SGLVLPTDMD LTKICTGKGA VTLRASSSYR ETPSSSPASP QETRQHESKP 100
    GLEPEPSSAD EWRLSSSADA NGNAQPSSLA AKGYRSVHPN LPSDKSQDAT 150
    SSSAAQPEVI VVPLYLVNTD RGQEGTARPP TPLGPLGCVP TIPATASAAS 200
    PLTFPTLDDF IPPHLQRWPH HSQPARASGS FAPISQTPPS FSPPPPLVPP 250
    APEDLRRVSE PDLTGAVSST DSSPLLNEVS SSLIGTDSQA FPSVSKPSSA 300
    YPSTTIVNPT IVLLQHNREQ QKRLSSLSDP VSERRVGEQD SAPTQEKPTS 350
    PGKAIEKRAK DDSRRVVKST QDLSDVSMDE VGIPLRNTER SKDWYKTMFK 400
    QIHKLNRDTP EENPYFPTYK FPELPEIQQT SEEDNPYTPT YQFPASTPSP 450
    KSEDDDSDLY SPRYSFSEDT KSPLSVPRSK SEMSYIDGEK VVKRSATLPL 500
    PARSSSLKSS SERNDWEPPD KKVDTRKYRA EPKSIYEYQP GKSSVLTNEK 550
    MSRDISPEEI DLKNEPWYKF FSELEFGKPP PKKIWDYTPG DCSILPREDR 600
    KTNLDKDLSL CQTELEADLE KMETLNKAPS ANVPQSSAIS PTPEISSETP 650
    GYIYSSNFHA VKRESDGAPG DLTSLENERQ IYKSVLEGGD IPLQGLSGLK 700
    RPSSSASTKD SESPRHFIPA DYLESTEEFI RRRHDDKEKL LADQRRLKRE 750
    QEEADIAARR HTGVIPTHHQ FITNERFGDL LNIDDTAKRK SGSEMRPARA 800
    KFDFKAQTLK ELPLQKGDIV YIYKQIDQNW YEGEHHGRVG IFPRTYIELL 850
    PPAEKAQPKK LTPVQVLEYG EAIAKFNFNG DTQVEMSFRK GERITLLRQV 900
    DENWYEGRIP GTSRQGIFPI TYVDVIKRPL VKNPVDYMDL PFSSSPSRSA 950
    TASPQFSSHS KLITPAPSSL PHSRRALSPE MHAVTSEWIS LTVGVPGRRS 1000
    LALTPPLPPL PEASIYNTDH LALSPRASPS LSLSLPHLSW SDRPTPRSVA 1050
    SPLALPSPHK TYSLAPTSQA SLHMNGDGGV HTPSSGIHQD SFLQLPLGSS 1100
    DSVISQLSDA FSSQSKRQPW REESGQYERK AERGAGERGP GGPKISKKSC 1150
    LKPSDVVRCL STEQRLSDLN TPEESRPGKP LGSAFPGSEA EQTERHRGGE 1200
    QAGRKAARRG GSQQPQAQQR RVTPDRSQTS QDLFSYQALY SYIPQNDDEL 1250
    ELRDGDIVDV MEKCDDGWFV GTSRRTKQFG TFPGNYVKPL YL 1292
    Length:1,292
    Mass (Da):142,513
    Last modified:January 11, 2011 - v3
    Checksum:i70DA4169B6D82F06
    GO
    Isoform 21 Publication (identifier: Q9BX66-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         434-453: DNPYTPTYQFPASTPSPKSE → TKSCSVMSPRLECSGTVIAHCSLKLLDSSNPPTSASQVAGTA
         955-1117: Missing.

    Show »
    Length:1,151
    Mass (Da):127,276
    Checksum:iC1BD7AD5D5BE1300
    GO
    Isoform 31 Publication (identifier: Q9BX66-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         147-215: Missing.
         408-453: Missing.
         602-635: Missing.
         956-975: FSSHSKLITPAPSSLPHSRR → LSHHSLRAGPDLTESEKSYV
         976-1213: Missing.

    Show »
    Length:905
    Mass (Da):101,082
    Checksum:iC44DB4C9B0526933
    GO
    Isoform 41 Publication (identifier: Q9BX66-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         26-57: Missing.
         101-109: Missing.
         148-270: Missing.
         408-453: Missing.
         552-635: Missing.
         738-793: Missing.
         955-1212: Missing.

    Note: Contains a phosphoserine at position 346. Contains a phosphoserine at position 603.

    Show »
    Length:684
    Mass (Da):76,596
    Checksum:i9A417161477CB810
    GO
    Isoform 51 Publication (identifier: Q9BX66-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         101-109: Missing.
         431-451: Missing.
         955-1212: Missing.

    Note: Contains a phosphoserine at position 923.

    Show »
    Length:1,004
    Mass (Da):111,791
    Checksum:i45A17463F7373E8B
    GO
    Isoform 61 Publication (identifier: Q9BX66-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         101-109: Missing.
         148-270: Missing.
         580-635: Missing.
         955-1212: Missing.

    Note: Contains a phosphoserine at position 765.

    Show »
    Length:846
    Mass (Da):95,036
    Checksum:i61FC1B8026A7D9A1
    GO
    Isoform 7Curated (identifier: Q9BX66-7) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         26-57: Missing.
         101-109: Missing.
         408-453: Missing.
         552-635: Missing.
         795-799: MRPAR → KYDWA
         800-1292: Missing.

    Note: No experimental confirmation available. Contains a phosphoserine at position 469.

    Show »
    Length:628
    Mass (Da):68,745
    Checksum:i4B5BD67EF6355537
    GO
    Isoform 81 Publication (identifier: Q9BX66-8) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         26-57: Missing.
         148-270: Missing.
         408-453: Missing.
         580-601: Missing.
         955-1212: Missing.

    Note: Contains a phosphoserine at position 730.

    Show »
    Length:811
    Mass (Da):91,055
    Checksum:i019F4E7E811AFDF5
    GO
    Isoform 9Curated (identifier: Q9BX66-9) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         148-270: Missing.
         408-453: Missing.
         552-635: Missing.
         955-1212: Missing.

    Note: Contains a phosphoserine at position 387. Contains a phosphoserine at position 700.

    Show »
    Length:781
    Mass (Da):87,199
    Checksum:iEDB752BF6DB3E4E1
    GO
    Isoform 10Curated (identifier: Q9BX66-10) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         26-57: Missing.
         408-453: Missing.
         552-635: Missing.
         738-793: Missing.
         955-1212: Missing.

    Note: No experimental confirmation available. Contains a phosphoserine at position 478. Contains a phosphoserine at position 735.

    Show »
    Length:816
    Mass (Da):90,218
    Checksum:i490FCF5615BF69DB
    GO
    Isoform 11 (identifier: Q9BX66-11) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         408-453: Missing.
         1213-1213: Q → QLSHHSLRAGPDLTESEKSYV

    Show »
    Length:1,266
    Mass (Da):139,401
    Checksum:i857F07CDCB13B97E
    GO
    Isoform 12 (identifier: Q9BX66-12) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         26-57: Missing.
         148-270: Missing.
         319-328: Missing.
         408-453: Missing.
         580-601: Missing.
         709-709: K → KVDRKGGNAH...PQSELAPSRG
         955-1212: Missing.

    Note: No experimental confirmation available. Derived from mouse ortholog data. Contains a phosphoserine at position 1213.

    Show »
    Length:1,294
    Mass (Da):143,741
    Checksum:i770EBDC6412A6C03
    GO

    Sequence cautioni

    The sequence AAB93496.1 differs from that shown. Reason: Frameshift at positions 861, 867 and 885.
    The sequence BAA92534.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti9 – 91S → P in CAJ97431. (PubMed:17462669)Curated
    Sequence conflicti18 – 181P → S in AAD27647. (PubMed:11374898)Curated
    Sequence conflicti18 – 181P → S in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti110 – 1101D → G in AAD27647. (PubMed:11374898)Curated
    Sequence conflicti110 – 1101D → G in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti113 – 1131R → K in AAD27647. (PubMed:11374898)Curated
    Sequence conflicti113 – 1131R → K in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti131 – 1311A → V in AAD27647. (PubMed:11374898)Curated
    Sequence conflicti131 – 1311A → V in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti134 – 1341Y → S in AAD27647. (PubMed:11374898)Curated
    Sequence conflicti134 – 1341Y → S in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti226 – 2283RAS → SAC in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti264 – 2641T → P in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti292 – 2954PSVS → SSEC in AAD27647. (PubMed:11374898)Curated
    Sequence conflicti292 – 2954PSVS → SSEC in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti481 – 4811S → R in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti489 – 4891E → V in AAD27647. (PubMed:11374898)Curated
    Sequence conflicti489 – 4891E → V in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti607 – 6071D → E in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti610 – 6101L → F in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti644 – 6441E → G in AAD27647. (PubMed:11374898)Curated
    Sequence conflicti644 – 6441E → G in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti679 – 6791R → S in AAD27647. (PubMed:11374898)Curated
    Sequence conflicti679 – 6791R → S in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti690 – 6901D → V in AAD27647. (PubMed:11374898)Curated
    Sequence conflicti690 – 6901D → V in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti694 – 6941Q → R in CAJ97431. (PubMed:17462669)Curated
    Sequence conflicti695 – 6951G → D in AAD27647. (PubMed:11374898)Curated
    Sequence conflicti695 – 6951G → D in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti710 – 7101D → N in AAD27647. (PubMed:11374898)Curated
    Sequence conflicti710 – 7101D → N in AAF22175. (PubMed:11532984)Curated
    Sequence conflicti1156 – 11561V → G in AAK37563. (PubMed:11374898)Curated
    Sequence conflicti1156 – 11561V → G in AAK37564. (PubMed:11374898)Curated
    Isoform 21 Publication (identifier: Q9BX66-2)
    Sequence conflicti435 – 4351K → E in AAK37564. (PubMed:11374898)Curated
    Sequence conflicti452 – 4554AHCS → SRCG in AAK37564. (PubMed:11374898)Curated
    Sequence conflicti463 – 4631N → D in AAK37564. (PubMed:11374898)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti61 – 611L → P.8 Publications
    Corresponds to variant rs943542 [ dbSNP | Ensembl ].
    VAR_047652
    Natural varianti74 – 741R → W.1 Publication
    VAR_019653
    Natural varianti175 – 1751G → V.
    Corresponds to variant rs7081076 [ dbSNP | Ensembl ].
    VAR_047653
    Natural varianti195 – 1951T → A in a breast cancer sample; somatic mutation. 1 Publication
    VAR_035661
    Natural varianti237 – 2371T → A Has a protective role in both obesity and diabetes. 1 Publication
    Corresponds to variant rs2281939 [ dbSNP | Ensembl ].
    VAR_019654
    Natural varianti485 – 4851Y → C.
    Corresponds to variant rs35808802 [ dbSNP | Ensembl ].
    VAR_047654

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei26 – 5732Missing in isoform 4, isoform 7, isoform 8, isoform 10 and isoform 12. 4 PublicationsVSP_050895Add
    BLAST
    Alternative sequencei101 – 1099Missing in isoform 4, isoform 5, isoform 6 and isoform 7. 4 PublicationsVSP_050896
    Alternative sequencei147 – 21569Missing in isoform 3. 1 PublicationVSP_050898Add
    BLAST
    Alternative sequencei148 – 270123Missing in isoform 4, isoform 6, isoform 8, isoform 9 and isoform 12. 5 PublicationsVSP_050899Add
    BLAST
    Alternative sequencei319 – 32810Missing in isoform 12. CuratedVSP_041193
    Alternative sequencei408 – 45346Missing in isoform 3, isoform 4, isoform 7, isoform 8, isoform 9, isoform 10, isoform 11 and isoform 12. 6 PublicationsVSP_050900Add
    BLAST
    Alternative sequencei431 – 45121Missing in isoform 5. 3 PublicationsVSP_050901Add
    BLAST
    Alternative sequencei434 – 45320DNPYT…SPKSE → TKSCSVMSPRLECSGTVIAH CSLKLLDSSNPPTSASQVAG TA in isoform 2. 1 PublicationVSP_050902Add
    BLAST
    Alternative sequencei552 – 63584Missing in isoform 4, isoform 7, isoform 9 and isoform 10. 4 PublicationsVSP_050903Add
    BLAST
    Alternative sequencei580 – 63556Missing in isoform 6. 1 PublicationVSP_050905Add
    BLAST
    Alternative sequencei580 – 60122Missing in isoform 8 and isoform 12. 1 PublicationVSP_050904Add
    BLAST
    Alternative sequencei602 – 63534Missing in isoform 3. 1 PublicationVSP_050906Add
    BLAST
    Alternative sequencei709 – 7091K → KVDRKGGNAHMISSSSVHSR TFNTSNALGPVCKHKKPLSA AKACISEILPSKFKPRLSAP SALLQEQKSILLPSEKAQSC ENLCVSGSLNDSKRGLPLQV GGSIENLLMRSRRDYDSKSS STMSLQEYSTSGRRPCPLSR KAGMQFTMLYRDMHQINRSG LFLGSISSSSSVRDLASHFE KSSLALSRGELGPSQEGSEH IPKHTVSSRITAFEQLIQRS RSMPSLDLSGRLSKSPTPVL SRGSLTSARSAESLLESTKL HPKEMDGMNSSGVYASPTCS NMAHHALSFRGLVPSEPLST CSDDVDRCSNISTDSREGSG GSVHGDFPKHRLNKCKGTCP ASYTRFTTIRKHEQQQTSRQ PEWRLDARGDKSTLLRNIYL MSPLPFRLKKPLHHHPRQPS PGDSSGLLVGQKPDLPSQPH QDQPPSGGKPVVPTRLSSRH TMARLSRSSEPSQERPTALE DYPRAINNGNSVPYSDHSLD RNNNPQSELAPSRG in isoform 12. CuratedVSP_041194
    Alternative sequencei738 – 79356Missing in isoform 4 and isoform 10. 2 PublicationsVSP_050907Add
    BLAST
    Alternative sequencei795 – 7995MRPAR → KYDWA in isoform 7. 1 PublicationVSP_050908
    Alternative sequencei800 – 1292493Missing in isoform 7. 1 PublicationVSP_050909Add
    BLAST
    Alternative sequencei955 – 1212258Missing in isoform 4, isoform 5, isoform 6, isoform 8, isoform 9, isoform 10 and isoform 12. 7 PublicationsVSP_050911Add
    BLAST
    Alternative sequencei955 – 1117163Missing in isoform 2. 1 PublicationVSP_050910Add
    BLAST
    Alternative sequencei956 – 97520FSSHS…PHSRR → LSHHSLRAGPDLTESEKSYV in isoform 3. 1 PublicationVSP_050912Add
    BLAST
    Alternative sequencei976 – 1213238Missing in isoform 3. 1 PublicationVSP_050913Add
    BLAST
    Alternative sequencei1213 – 12131Q → QLSHHSLRAGPDLTESEKSY V in isoform 11. 1 PublicationVSP_039210

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF136380 mRNA. Translation: AAD27647.1.
    AF356525 mRNA. Translation: AAK37563.1.
    AF356526 mRNA. Translation: AAK37564.1.
    AF356527 mRNA. Translation: AAK37565.1.
    AF330623 mRNA. Translation: AAK57479.1.
    AF330624 mRNA. Translation: AAK57480.1.
    AF136381 mRNA. Translation: AAF22175.1.
    AJ489942 mRNA. Translation: CAD34588.1.
    AM260536 mRNA. Translation: CAJ97431.1.
    AB037717 mRNA. Translation: BAA92534.1. Different initiation.
    AL117472 mRNA. Translation: CAB55947.1.
    AL158165 Genomic DNA. Translation: CAI14378.1.
    AL158165 Genomic DNA. Translation: CAI14379.1.
    AL158165 Genomic DNA. Translation: CAI14380.1.
    AL158165 Genomic DNA. Translation: CAI14381.1.
    AL158165 Genomic DNA. Translation: CAI14382.1.
    AL158165 Genomic DNA. Translation: CAI14383.1.
    AL158165 Genomic DNA. Translation: CAI14384.1.
    AL158165 Genomic DNA. Translation: CAI14385.1.
    CH471066 Genomic DNA. Translation: EAW49999.1.
    CH471066 Genomic DNA. Translation: EAW50007.1.
    BC042612 mRNA. Translation: AAH42612.1.
    BC152463 mRNA. Translation: AAI52464.1.
    U70668 mRNA. Translation: AAB93496.1. Frameshift.
    CCDSiCCDS31252.1. [Q9BX66-4]
    CCDS31253.1. [Q9BX66-9]
    CCDS31254.1. [Q9BX66-2]
    CCDS31255.1. [Q9BX66-1]
    CCDS31256.1. [Q9BX66-3]
    CCDS7442.1. [Q9BX66-10]
    PIRiT17257.
    RefSeqiNP_001030126.1. NM_001034954.1.
    NP_001030127.1. NM_001034955.1.
    NP_001030128.1. NM_001034956.1.
    NP_001030129.1. NM_001034957.1.
    NP_001277223.1. NM_001290294.1.
    NP_001277224.1. NM_001290295.1.
    NP_001277225.1. NM_001290296.1.
    NP_001277226.1. NM_001290297.1.
    NP_001277227.1. NM_001290298.1.
    NP_006425.2. NM_006434.2.
    NP_056200.1. NM_015385.3.
    NP_079267.1. NM_024991.2.
    XP_006717644.1. XM_006717581.1. [Q9BX66-1]
    XP_006717652.1. XM_006717589.1. [Q9BX66-5]
    XP_006717654.1. XM_006717591.1. [Q9BX66-6]
    XP_006717655.1. XM_006717592.1. [Q9BX66-8]
    XP_006717658.1. XM_006717595.1. [Q9BX66-4]
    UniGeneiHs.38621.

    Genome annotation databases

    EnsembliENST00000277982; ENSP00000277982; ENSG00000095637. [Q9BX66-2]
    ENST00000306402; ENSP00000302556; ENSG00000095637. [Q9BX66-9]
    ENST00000354106; ENSP00000277984; ENSG00000095637. [Q9BX66-5]
    ENST00000361941; ENSP00000355136; ENSG00000095637. [Q9BX66-1]
    ENST00000371227; ENSP00000360271; ENSG00000095637. [Q9BX66-11]
    ENST00000371239; ENSP00000360283; ENSG00000095637. [Q9BX66-8]
    ENST00000371241; ENSP00000360285; ENSG00000095637. [Q9BX66-4]
    ENST00000371245; ENSP00000360291; ENSG00000095637. [Q9BX66-3]
    ENST00000371246; ENSP00000360292; ENSG00000095637. [Q9BX66-2]
    ENST00000371247; ENSP00000360293; ENSG00000095637. [Q9BX66-1]
    ENST00000371249; ENSP00000360295; ENSG00000095637. [Q9BX66-10]
    ENST00000607232; ENSP00000475901; ENSG00000095637. [Q9BX66-12]
    GeneIDi10580.
    KEGGihsa:10580.
    UCSCiuc001kkl.3. human. [Q9BX66-5]
    uc001kkm.3. human. [Q9BX66-6]
    uc001kkn.3. human. [Q9BX66-8]
    uc001kko.3. human. [Q9BX66-2]
    uc001kkp.3. human. [Q9BX66-1]
    uc001kkq.3. human. [Q9BX66-3]
    uc001kkr.3. human. [Q9BX66-9]
    uc001kks.3. human. [Q9BX66-4]
    uc001kkv.3. human. [Q9BX66-10]
    uc001kkw.3. human. [Q9BX66-11]

    Polymorphism databases

    DMDMi317373504.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF136380 mRNA. Translation: AAD27647.1 .
    AF356525 mRNA. Translation: AAK37563.1 .
    AF356526 mRNA. Translation: AAK37564.1 .
    AF356527 mRNA. Translation: AAK37565.1 .
    AF330623 mRNA. Translation: AAK57479.1 .
    AF330624 mRNA. Translation: AAK57480.1 .
    AF136381 mRNA. Translation: AAF22175.1 .
    AJ489942 mRNA. Translation: CAD34588.1 .
    AM260536 mRNA. Translation: CAJ97431.1 .
    AB037717 mRNA. Translation: BAA92534.1 . Different initiation.
    AL117472 mRNA. Translation: CAB55947.1 .
    AL158165 Genomic DNA. Translation: CAI14378.1 .
    AL158165 Genomic DNA. Translation: CAI14379.1 .
    AL158165 Genomic DNA. Translation: CAI14380.1 .
    AL158165 Genomic DNA. Translation: CAI14381.1 .
    AL158165 Genomic DNA. Translation: CAI14382.1 .
    AL158165 Genomic DNA. Translation: CAI14383.1 .
    AL158165 Genomic DNA. Translation: CAI14384.1 .
    AL158165 Genomic DNA. Translation: CAI14385.1 .
    CH471066 Genomic DNA. Translation: EAW49999.1 .
    CH471066 Genomic DNA. Translation: EAW50007.1 .
    BC042612 mRNA. Translation: AAH42612.1 .
    BC152463 mRNA. Translation: AAI52464.1 .
    U70668 mRNA. Translation: AAB93496.1 . Frameshift.
    CCDSi CCDS31252.1. [Q9BX66-4 ]
    CCDS31253.1. [Q9BX66-9 ]
    CCDS31254.1. [Q9BX66-2 ]
    CCDS31255.1. [Q9BX66-1 ]
    CCDS31256.1. [Q9BX66-3 ]
    CCDS7442.1. [Q9BX66-10 ]
    PIRi T17257.
    RefSeqi NP_001030126.1. NM_001034954.1.
    NP_001030127.1. NM_001034955.1.
    NP_001030128.1. NM_001034956.1.
    NP_001030129.1. NM_001034957.1.
    NP_001277223.1. NM_001290294.1.
    NP_001277224.1. NM_001290295.1.
    NP_001277225.1. NM_001290296.1.
    NP_001277226.1. NM_001290297.1.
    NP_001277227.1. NM_001290298.1.
    NP_006425.2. NM_006434.2.
    NP_056200.1. NM_015385.3.
    NP_079267.1. NM_024991.2.
    XP_006717644.1. XM_006717581.1. [Q9BX66-1 ]
    XP_006717652.1. XM_006717589.1. [Q9BX66-5 ]
    XP_006717654.1. XM_006717591.1. [Q9BX66-6 ]
    XP_006717655.1. XM_006717592.1. [Q9BX66-8 ]
    XP_006717658.1. XM_006717595.1. [Q9BX66-4 ]
    UniGenei Hs.38621.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2DL3 NMR - A 796-850 [» ]
    2ECZ NMR - A 870-926 [» ]
    2LJ0 NMR - A 1228-1292 [» ]
    2LJ1 NMR - A 1228-1291 [» ]
    2MOX NMR - A 791-930 [» ]
    2O2W X-ray 2.27 A 870-930 [» ]
    2O31 X-ray 1.50 A 870-930 [» ]
    2O9S X-ray 0.83 A 870-930 [» ]
    2O9V X-ray 1.63 A 870-930 [» ]
    4LN2 X-ray 1.00 A 866-930 [» ]
    4LNP X-ray 1.41 A 794-854 [» ]
    ProteinModelPortali Q9BX66.
    SMRi Q9BX66. Positions 791-850, 870-930, 1228-1292.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115831. 27 interactions.
    IntActi Q9BX66. 25 interactions.
    MINTi MINT-2792261.

    PTM databases

    PhosphoSitei Q9BX66.

    Polymorphism databases

    DMDMi 317373504.

    Proteomic databases

    MaxQBi Q9BX66.
    PaxDbi Q9BX66.
    PRIDEi Q9BX66.

    Protocols and materials databases

    DNASUi 10580.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000277982 ; ENSP00000277982 ; ENSG00000095637 . [Q9BX66-2 ]
    ENST00000306402 ; ENSP00000302556 ; ENSG00000095637 . [Q9BX66-9 ]
    ENST00000354106 ; ENSP00000277984 ; ENSG00000095637 . [Q9BX66-5 ]
    ENST00000361941 ; ENSP00000355136 ; ENSG00000095637 . [Q9BX66-1 ]
    ENST00000371227 ; ENSP00000360271 ; ENSG00000095637 . [Q9BX66-11 ]
    ENST00000371239 ; ENSP00000360283 ; ENSG00000095637 . [Q9BX66-8 ]
    ENST00000371241 ; ENSP00000360285 ; ENSG00000095637 . [Q9BX66-4 ]
    ENST00000371245 ; ENSP00000360291 ; ENSG00000095637 . [Q9BX66-3 ]
    ENST00000371246 ; ENSP00000360292 ; ENSG00000095637 . [Q9BX66-2 ]
    ENST00000371247 ; ENSP00000360293 ; ENSG00000095637 . [Q9BX66-1 ]
    ENST00000371249 ; ENSP00000360295 ; ENSG00000095637 . [Q9BX66-10 ]
    ENST00000607232 ; ENSP00000475901 ; ENSG00000095637 . [Q9BX66-12 ]
    GeneIDi 10580.
    KEGGi hsa:10580.
    UCSCi uc001kkl.3. human. [Q9BX66-5 ]
    uc001kkm.3. human. [Q9BX66-6 ]
    uc001kkn.3. human. [Q9BX66-8 ]
    uc001kko.3. human. [Q9BX66-2 ]
    uc001kkp.3. human. [Q9BX66-1 ]
    uc001kkq.3. human. [Q9BX66-3 ]
    uc001kkr.3. human. [Q9BX66-9 ]
    uc001kks.3. human. [Q9BX66-4 ]
    uc001kkv.3. human. [Q9BX66-10 ]
    uc001kkw.3. human. [Q9BX66-11 ]

    Organism-specific databases

    CTDi 10580.
    GeneCardsi GC10M097061.
    HGNCi HGNC:14565. SORBS1.
    HPAi HPA027559.
    HPA036994.
    HPA043084.
    MIMi 605264. gene.
    neXtProti NX_Q9BX66.
    PharmGKBi PA37899.
    HUGEi Search...
    Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG256936.
    HOVERGENi HBG053053.
    InParanoidi Q9BX66.
    KOi K06086.
    OMAi ITSEWIS.
    OrthoDBi EOG75XGKP.
    PhylomeDBi Q9BX66.
    TreeFami TF320680.

    Enzyme and pathway databases

    Reactomei REACT_20558. Smooth Muscle Contraction.
    SignaLinki Q9BX66.

    Miscellaneous databases

    ChiTaRSi SORBS1. human.
    EvolutionaryTracei Q9BX66.
    GeneWikii SORBS1.
    GenomeRNAii 10580.
    NextBioi 40165.
    PROi Q9BX66.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BX66.
    Bgeei Q9BX66.
    Genevestigatori Q9BX66.

    Family and domain databases

    InterProi IPR028506. CAP/ponsin.
    IPR011511. SH3_2.
    IPR001452. SH3_domain.
    IPR003127. Sorb.
    [Graphical view ]
    PANTHERi PTHR10661:SF4. PTHR10661:SF4. 1 hit.
    Pfami PF07653. SH3_2. 1 hit.
    PF14604. SH3_9. 2 hits.
    PF02208. Sorb. 1 hit.
    [Graphical view ]
    SMARTi SM00326. SH3. 3 hits.
    SM00459. Sorb. 1 hit.
    [Graphical view ]
    SUPFAMi SSF50044. SSF50044. 3 hits.
    PROSITEi PS50002. SH3. 3 hits.
    PS50831. SOHO. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning, mapping, and characterization of the human sorbin and SH3 domain containing 1 (SORBS1) gene: a protein associated with c-Abl during insulin signaling in the hepatoma cell line Hep3B."
      Lin W.-H., Huang C.-J., Liu M.-W., Chang H.-M., Chen Y.-J., Tai T.-Y., Chuang L.-M.
      Genomics 74:12-20(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3 AND 4), TISSUE SPECIFICITY, INTERACTION WITH ABL1 AND INSULIN RECEPTOR, VARIANT PRO-61.
      Tissue: LiverImported and Skeletal muscleImported.
    2. "Ataxin-7 interacts with a Cbl-associated protein that it recruits into neuronal intranuclear inclusions."
      Lebre A.-S., Jamot L., Takahashi J., Spassky N., Leprince C., Ravise N., Zander C., Fujigasaki H., Kussel-Andermann P., Duyckaerts C., Camonis J.H., Brice A.
      Hum. Mol. Genet. 10:1201-1213(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 8), SUBCELLULAR LOCATION, INTERACTION WITH SCA7, VARIANT PRO-61.
      Tissue: RetinaImported.
    3. "Molecular scanning of the human sorbin and SH3-domain-containing-1 (SORBS1) gene: positive association of the T228A polymorphism with obesity and type 2 diabetes."
      Lin W.-H., Chiu K.C., Chang H.-M., Lee K.C., Tai T.-Y., Chuang L.-M.
      Hum. Mol. Genet. 10:1753-1760(2001) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 5), VARIANTS PRO-61; TRP-74 AND ALA-237.
      Tissue: Skeletal muscleImported.
    4. "The c-Cbl-associated protein and c-Cbl are two new partners of the SH2-containing inositol polyphosphate 5-phosphatase SHIP2."
      Vandenbroere I., Paternotte N., Dumont J.E., Erneux C., Pirson I.
      Biochem. Biophys. Res. Commun. 300:494-500(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 6), INTERACTION WITH INPPL1, VARIANT PRO-61.
      Tissue: BrainImported.
    5. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 11), INTERACTION WITH PXN, X-RAY CRYSTALLOGRAPHY (0.83 ANGSTROMS) OF 870-930 IN COMPLEX WITH PXN PEPTIDE, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, VARIANT PRO-61.
      Tissue: Skeletal muscle.
    6. "Prediction of the coding sequences of unidentified human genes. XVI. The complete sequences of 150 new cDNA clones from brain which code for large proteins in vitro."
      Nagase T., Kikuno R., Ishikawa K., Hirosawa M., Ohara O.
      DNA Res. 7:65-73(2000) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 9), VARIANT PRO-61.
      Tissue: BrainImported.
    7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 10), VARIANT PRO-61.
      Tissue: UterusImported.
    8. "The DNA sequence and comparative analysis of human chromosome 10."
      Deloukas P., Earthrowl M.E., Grafham D.V., Rubenfield M., French L., Steward C.A., Sims S.K., Jones M.C., Searle S., Scott C., Howe K., Hunt S.E., Andrews T.D., Gilbert J.G.R., Swarbreck D., Ashurst J.L., Taylor A., Battles J.
      , Bird C.P., Ainscough R., Almeida J.P., Ashwell R.I.S., Ambrose K.D., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Bates K., Beasley H., Bray-Allen S., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Cahill P., Camire D., Carter N.P., Chapman J.C., Clark S.Y., Clarke G., Clee C.M., Clegg S., Corby N., Coulson A., Dhami P., Dutta I., Dunn M., Faulkner L., Frankish A., Frankland J.A., Garner P., Garnett J., Gribble S., Griffiths C., Grocock R., Gustafson E., Hammond S., Harley J.L., Hart E., Heath P.D., Ho T.P., Hopkins B., Horne J., Howden P.J., Huckle E., Hynds C., Johnson C., Johnson D., Kana A., Kay M., Kimberley A.M., Kershaw J.K., Kokkinaki M., Laird G.K., Lawlor S., Lee H.M., Leongamornlert D.A., Laird G., Lloyd C., Lloyd D.M., Loveland J., Lovell J., McLaren S., McLay K.E., McMurray A., Mashreghi-Mohammadi M., Matthews L., Milne S., Nickerson T., Nguyen M., Overton-Larty E., Palmer S.A., Pearce A.V., Peck A.I., Pelan S., Phillimore B., Porter K., Rice C.M., Rogosin A., Ross M.T., Sarafidou T., Sehra H.K., Shownkeen R., Skuce C.D., Smith M., Standring L., Sycamore N., Tester J., Thorpe A., Torcasso W., Tracey A., Tromans A., Tsolas J., Wall M., Walsh J., Wang H., Weinstock K., West A.P., Willey D.L., Whitehead S.L., Wilming L., Wray P.W., Young L., Chen Y., Lovering R.C., Moschonas N.K., Siebert R., Fechtel K., Bentley D., Durbin R.M., Hubbard T., Doucette-Stamm L., Beck S., Smith D.R., Rogers J.
      Nature 429:375-381(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    9. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    10. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 7 AND 9), VARIANT PRO-61.
      Tissue: TestisImported.
    11. "A Fas-ligand associated factor 2, FLAF2, potentiates Fas-ligand stability."
      Hachiya T., Kobayasi A., Touji S., Tamai K.
      Submitted (SEP-1996) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 752-888.
      Tissue: Placenta.
    12. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-86; SER-89; SER-472; SER-665; THR-862 AND SER-945, PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-478 AND SER-735 (ISOFORM 10), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-1213 (ISOFORM 12), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-346 AND SER-603 (ISOFORM 4), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-923 (ISOFORM 5), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-765 (ISOFORM 6), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-469 (ISOFORM 7), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-730 (ISOFORM 8), PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-387 AND SER-700 (ISOFORM 9), IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    13. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    15. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
      Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
      Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-481, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    16. Cited for: X-RAY CRYSTALLOGRAPHY (1.5 ANGSTROMS) OF 870-930.
    17. "Solution structure of SH3 domains of human Sorbin and SH3 domain-containing protein 1."
      RIKEN structural genomics initiative (RSGI)
      Submitted (FEB-2009) to the PDB data bank
      Cited for: STRUCTURE BY NMR OF 796-926.
    18. Cited for: VARIANT [LARGE SCALE ANALYSIS] ALA-195.

    Entry informationi

    Entry nameiSRBS1_HUMAN
    AccessioniPrimary (citable) accession number: Q9BX66
    Secondary accession number(s): A0AED4
    , A6NEK3, A6NID8, A6NJS4, A7MD40, D3DR42, O43857, Q5T923, Q5T924, Q5T927, Q5T928, Q5T929, Q5T930, Q5T931, Q5T932, Q7LBE5, Q8IVK0, Q8IVQ4, Q96KF3, Q96KF4, Q9BX64, Q9BX65, Q9P2Q0, Q9UFT2, Q9UHN7, Q9Y338
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: August 31, 2004
    Last sequence update: January 11, 2011
    Last modified: October 1, 2014
    This is version 139 of the entry and version 3 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 10
      Human chromosome 10: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    6. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3