Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tapasin-related protein

Gene

TAPBPL

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Component of the antigen processing and presentation pathway, which binds to MHC class I coupled with beta2-microglobulin/B2M. Association between TAPBPR and MHC class I occurs in the absence of a functional peptide-loading complex (PLC). Expression seems to slow down and down-regulate MHC class I surface expression.1 Publication

GO - Molecular functioni

  • protein complex binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Immunity

Enzyme and pathway databases

BioCyciZFISH:ENSG00000139192-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Tapasin-related protein
Short name:
TAPASIN-R
Alternative name(s):
TAP-binding protein-like
TAP-binding protein-related protein
Short name:
TAPBP-R
Tapasin-like
Gene namesi
Name:TAPBPL
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:30683. TAPBPL.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini19 – 405LumenalSequence analysisAdd BLAST387
Transmembranei406 – 426HelicalSequence analysisAdd BLAST21
Topological domaini427 – 468CytoplasmicSequence analysisAdd BLAST42

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Endoplasmic reticulum, Golgi apparatus, Membrane, Microsome

Pathology & Biotechi

Organism-specific databases

DisGeNETi55080.
OpenTargetsiENSG00000139192.
PharmGKBiPA134955671.

Polymorphism and mutation databases

BioMutaiTAPBPL.
DMDMi296452847.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Signal peptidei1 – 181 PublicationAdd BLAST18
ChainiPRO_000001499319 – 468Tapasin-related proteinAdd BLAST450

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi212 ↔ 283PROSITE-ProRule annotation
Disulfide bondi321 ↔ 382PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

MaxQBiQ9BX59.
PaxDbiQ9BX59.
PeptideAtlasiQ9BX59.
PRIDEiQ9BX59.

PTM databases

iPTMnetiQ9BX59.
PhosphoSitePlusiQ9BX59.

Expressioni

Inductioni

By interferon gamma.1 Publication

Gene expression databases

BgeeiENSG00000139192.
CleanExiHS_TAPBPL.
ExpressionAtlasiQ9BX59. baseline and differential.
GenevisibleiQ9BX59. HS.

Organism-specific databases

HPAiHPA039545.

Interactioni

GO - Molecular functioni

  • protein complex binding Source: UniProtKB

Protein-protein interaction databases

BioGridi120395. 5 interactors.
IntActiQ9BX59. 7 interactors.
STRINGi9606.ENSP00000266556.

Structurei

3D structure databases

ProteinModelPortaliQ9BX59.
SMRiQ9BX59.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini181 – 297Ig-like V-typeAdd BLAST117
Domaini304 – 394Ig-like C1-typeAdd BLAST91

Sequence similaritiesi

Keywords - Domaini

Immunoglobulin domain, Repeat, Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IF63. Eukaryota.
ENOG4111SQB. LUCA.
GeneTreeiENSGT00530000063758.
HOGENOMiHOG000168499.
HOVERGENiHBG057669.
InParanoidiQ9BX59.
OMAiQGQAKRE.
OrthoDBiEOG091G07KM.
PhylomeDBiQ9BX59.
TreeFamiTF334274.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003006. Ig/MHC_CS.
IPR003597. Ig_C1-set.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07654. C1-set. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
SM00407. IGc1. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
PS00290. IG_MHC. 1 hit.
[Graphical view]

Sequences (7)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 7 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform alpha (identifier: Q9BX59-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MGTQEGWCLL LCLALSGAAE TKPHPAEGQW RAVDVVLDCF LAKDGAHRGA
60 70 80 90 100
LASSEDRARA SLVLKQVPVL DDGSLEDFTD FQGGTLAQDD PPIIFEASVD
110 120 130 140 150
LVQIPQAEAL LHADCSGKEV TCEISRYFLQ MTETTVKTAA WFMANMQVSG
160 170 180 190 200
GGPSISLVMK TPRVTKNEAL WHPTLNLPLS PQGTVRTAVE FQVMTQTQSL
210 220 230 240 250
SFLLGSSASL DCGFSMAPGL DLISVEWRLQ HKGRGQLVYS WTAGQGQAVR
260 270 280 290 300
KGATLEPAQL GMARDASLTL PGLTIQDEGT YICQITTSLY RAQQIIQLNI
310 320 330 340 350
QASPKVRLSL ANEALLPTLI CDIAGYYPLD VVVTWTREEL GGSPAQVSGA
360 370 380 390 400
SFSSLRQSVA GTYSISSSLT AEPGSAGATY TCQVTHISLE EPLGASTQVV
410 420 430 440 450
PPERRTALGV IFASSLFLLA LMFLGLQRRQ APTGLGLLQA ERWETTSCAD
460
TQSSHLHEDR TARVSQPS
Length:468
Mass (Da):50,183
Last modified:May 18, 2010 - v2
Checksum:iFA39C335FC22960E
GO
Isoform beta (identifier: Q9BX59-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     430-430: Q → QEASAFLHCAPWAHAPRQRTGRSEGTRRRQNVQMEDKTKEP

Note: Has reduced cell surface expression, and does not down-regulate MHC class I surface expression as efficiently as isoform alpha.
Show »
Length:508
Mass (Da):54,799
Checksum:iC01DE24BDEB6A75F
GO
Isoform gamma (identifier: Q9BX59-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     302-402: Missing.

Note: Does not interact with MHC class I.
Show »
Length:367
Mass (Da):39,804
Checksum:i0F349D112FAD78D4
GO
Isoform delta (identifier: Q9BX59-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     236-262: QLVYSWTAGQGQAVRKGATLEPAQLGM → RGDLHLPDHHLSVPSSADHPAQHPSFP
     263-468: Missing.

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:262
Mass (Da):28,253
Checksum:iC832EBDF4A96CEF4
GO
Isoform epsilon (identifier: Q9BX59-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     189-402: Missing.

Show »
Length:254
Mass (Da):27,517
Checksum:iB2870B9E0F0096F8
GO
Isoform eta (identifier: Q9BX59-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     236-298: QLVYSWTAGQ...LYRAQQIIQL → RGDLHLPDHH...STYRTWAASG
     299-468: Missing.

Show »
Length:297
Mass (Da):31,844
Checksum:i364A0948A7307891
GO
Isoform zeta (identifier: Q9BX59-7) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     430-468: QAPTGLGLLQ...DRTARVSQPS → QEASAFLHCA...LPLPNSALSK

Show »
Length:509
Mass (Da):55,092
Checksum:i083917CC16401070
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_07175742A → V.2 PublicationsCorresponds to variant rs2041385dbSNPEnsembl.1
Natural variantiVAR_071758146M → V.2 PublicationsCorresponds to variant rs2532501dbSNPEnsembl.1
Natural variantiVAR_033627151G → R.2 PublicationsCorresponds to variant rs7295376dbSNPEnsembl.1
Natural variantiVAR_071759165T → A.2 PublicationsCorresponds to variant rs2532500dbSNPEnsembl.1
Natural variantiVAR_071760169A → V.2 PublicationsCorresponds to variant rs2041387dbSNPEnsembl.1
Natural variantiVAR_056090334T → M.1 PublicationCorresponds to variant rs1045546dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_057089189 – 402Missing in isoform epsilon. 1 PublicationAdd BLAST214
Alternative sequenceiVSP_057090236 – 298QLVYS…QIIQL → RGDLHLPDHHLSVPSSADHP AQHPRAENSLGSHLCQQSLP SCTDVPGASETASTYRTWAA SG in isoform eta. 1 PublicationAdd BLAST63
Alternative sequenceiVSP_057091236 – 262QLVYS…AQLGM → RGDLHLPDHHLSVPSSADHP AQHPSFP in isoform delta. 1 PublicationAdd BLAST27
Alternative sequenceiVSP_057092263 – 468Missing in isoform delta. 1 PublicationAdd BLAST206
Alternative sequenceiVSP_057093299 – 468Missing in isoform eta. 1 PublicationAdd BLAST170
Alternative sequenceiVSP_057094302 – 402Missing in isoform gamma. 1 PublicationAdd BLAST101
Alternative sequenceiVSP_057095430 – 468QAPTG…VSQPS → QEASAFLHCAPWAHAPRQRT GRSEGTRRRQNVQMEDKTKE PGWWCDGRKTKLEEMEKEQV RDNEAWVGAGLPLPNSALSK in isoform zeta. 1 PublicationAdd BLAST39
Alternative sequenceiVSP_057096430Q → QEASAFLHCAPWAHAPRQRT GRSEGTRRRQNVQMEDKTKE P in isoform beta. 1 Publication1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001005 mRNA. Translation: BAA91465.1.
AK002056 mRNA. Translation: BAB41077.1.
AC005840 Genomic DNA. No translation available.
BC015017 mRNA. Translation: AAH15017.1.
CCDSiCCDS8546.1. [Q9BX59-1]
RefSeqiNP_060479.3. NM_018009.4. [Q9BX59-1]
UniGeneiHs.504597.

Genome annotation databases

EnsembliENST00000266556; ENSP00000266556; ENSG00000139192. [Q9BX59-1]
GeneIDi55080.
KEGGihsa:55080.
UCSCiuc001qog.5. human. [Q9BX59-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001005 mRNA. Translation: BAA91465.1.
AK002056 mRNA. Translation: BAB41077.1.
AC005840 Genomic DNA. No translation available.
BC015017 mRNA. Translation: AAH15017.1.
CCDSiCCDS8546.1. [Q9BX59-1]
RefSeqiNP_060479.3. NM_018009.4. [Q9BX59-1]
UniGeneiHs.504597.

3D structure databases

ProteinModelPortaliQ9BX59.
SMRiQ9BX59.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120395. 5 interactors.
IntActiQ9BX59. 7 interactors.
STRINGi9606.ENSP00000266556.

PTM databases

iPTMnetiQ9BX59.
PhosphoSitePlusiQ9BX59.

Polymorphism and mutation databases

BioMutaiTAPBPL.
DMDMi296452847.

Proteomic databases

MaxQBiQ9BX59.
PaxDbiQ9BX59.
PeptideAtlasiQ9BX59.
PRIDEiQ9BX59.

Protocols and materials databases

DNASUi55080.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000266556; ENSP00000266556; ENSG00000139192. [Q9BX59-1]
GeneIDi55080.
KEGGihsa:55080.
UCSCiuc001qog.5. human. [Q9BX59-1]

Organism-specific databases

CTDi55080.
DisGeNETi55080.
GeneCardsiTAPBPL.
HGNCiHGNC:30683. TAPBPL.
HPAiHPA039545.
MIMi607081. gene.
neXtProtiNX_Q9BX59.
OpenTargetsiENSG00000139192.
PharmGKBiPA134955671.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IF63. Eukaryota.
ENOG4111SQB. LUCA.
GeneTreeiENSGT00530000063758.
HOGENOMiHOG000168499.
HOVERGENiHBG057669.
InParanoidiQ9BX59.
OMAiQGQAKRE.
OrthoDBiEOG091G07KM.
PhylomeDBiQ9BX59.
TreeFamiTF334274.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000139192-MONOMER.

Miscellaneous databases

ChiTaRSiTAPBPL. human.
GenomeRNAii55080.
PROiQ9BX59.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000139192.
CleanExiHS_TAPBPL.
ExpressionAtlasiQ9BX59. baseline and differential.
GenevisibleiQ9BX59. HS.

Family and domain databases

Gene3Di2.60.40.10. 2 hits.
InterProiIPR007110. Ig-like_dom.
IPR013783. Ig-like_fold.
IPR003006. Ig/MHC_CS.
IPR003597. Ig_C1-set.
IPR003599. Ig_sub.
IPR013106. Ig_V-set.
[Graphical view]
PfamiPF07654. C1-set. 1 hit.
PF07686. V-set. 1 hit.
[Graphical view]
SMARTiSM00409. IG. 1 hit.
SM00407. IGc1. 1 hit.
[Graphical view]
SUPFAMiSSF48726. SSF48726. 2 hits.
PROSITEiPS50835. IG_LIKE. 2 hits.
PS00290. IG_MHC. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTPSNR_HUMAN
AccessioniPrimary (citable) accession number: Q9BX59
Secondary accession number(s): Q9NWB8
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2005
Last sequence update: May 18, 2010
Last modified: November 30, 2016
This is version 128 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.