Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RNA-binding protein 24

Gene

RBM24

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in myogenic differentiation by regulating MYOG levels. Binds to the 3'-UTR of MYOG mRNA and regulates its stability.1 Publication

GO - Molecular functioni

GO - Biological processi

Keywordsi

Molecular functionRNA-binding
Biological processDifferentiation

Names & Taxonomyi

Protein namesi
Recommended name:
RNA-binding protein 24
Alternative name(s):
RNA-binding motif protein 24
RNA-binding region-containing protein 6
Gene namesi
Name:RBM24
Synonyms:RNPC6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 6

Organism-specific databases

EuPathDBiHostDB:ENSG00000112183.14.
HGNCiHGNC:21539. RBM24.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000112183.
PharmGKBiPA134964569.

Polymorphism and mutation databases

BioMutaiRBM24.
DMDMi74761312.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002733701 – 236RNA-binding protein 24Add BLAST236

Proteomic databases

EPDiQ9BX46.
MaxQBiQ9BX46.
PaxDbiQ9BX46.
PeptideAtlasiQ9BX46.
PRIDEiQ9BX46.

PTM databases

iPTMnetiQ9BX46.
PhosphoSitePlusiQ9BX46.

Expressioni

Gene expression databases

BgeeiENSG00000112183.
CleanExiHS_RBM24.
ExpressionAtlasiQ9BX46. baseline and differential.
GenevisibleiQ9BX46. HS.

Organism-specific databases

HPAiHPA066927.
HPA067231.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
POU2AF1Q166334EBI-12224445,EBI-943588

Protein-protein interaction databases

BioGridi128744. 29 interactors.
IntActiQ9BX46. 6 interactors.
MINTiMINT-2879164.
STRINGi9606.ENSP00000368341.

Structurei

3D structure databases

ProteinModelPortaliQ9BX46.
SMRiQ9BX46.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini11 – 88RRMPROSITE-ProRule annotationAdd BLAST78

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi141 – 221Ala-richAdd BLAST81

Phylogenomic databases

eggNOGiKOG0149. Eukaryota.
ENOG4111PGT. LUCA.
GeneTreeiENSGT00390000002308.
HOGENOMiHOG000276232.
HOVERGENiHBG108399.
InParanoidiQ9BX46.
OMAiSSPYIDY.
OrthoDBiEOG091G13K0.
PhylomeDBiQ9BX46.
TreeFamiTF314235.

Family and domain databases

InterProiView protein in InterPro
IPR000504. RRM_dom.
PfamiView protein in Pfam
PF00076. RRM_1. 1 hit.
SMARTiView protein in SMART
SM00360. RRM. 1 hit.
SUPFAMiSSF54928. SSF54928. 2 hits.
PROSITEiView protein in PROSITE
PS50102. RRM. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BX46-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHTTQKDTTY TKIFVGGLPY HTTDASLRKY FEVFGEIEEA VVITDRQTGK
60 70 80 90 100
SRGYGFVTMA DRAAAERACK DPNPIIDGRK ANVNLAYLGA KPRIMQPGFA
110 120 130 140 150
FGVQQLHPAL IQRPFGIPAH YVYPQAFVQP GVVIPHVQPT AAAASTTPYI
160 170 180 190 200
DYTGAAYAQY SAAAAAAAAA AAYDQYPYAA SPAAAGYVTA GGYGYAVQQP
210 220 230
ITAAAPGTAA AAAAAAAAAA AFGQYQPQQL QTDRMQ
Length:236
Mass (Da):24,776
Last modified:June 1, 2001 - v1
Checksum:i1CFB5AEBD4E3AA24
GO
Isoform 2 (identifier: Q9BX46-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGF → MYVCLCVSVAK

Show »
Length:191
Mass (Da):19,599
Checksum:i89E4D14E3DA941F7
GO
Isoform 3 (identifier: Q9BX46-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-58: Missing.

Note: Gene prediction based on EST data.
Show »
Length:178
Mass (Da):18,202
Checksum:iC2FD4D1937F1EBBC
GO

Sequence cautioni

The sequence BAC04474 differs from that shown. Unlikely isoform. Aberrant splice sites.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti144A → D in BAC04474 (PubMed:14702039).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0467751 – 58Missing in isoform 3. CuratedAdd BLAST58
Alternative sequenceiVSP_0225261 – 56MHTTQ…RGYGF → MYVCLCVSVAK in isoform 2. 2 PublicationsAdd BLAST56

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055391 mRNA. Translation: BAB70914.1.
AK095016 mRNA. Translation: BAC04474.1. Sequence problems.
AY547318 mRNA. Translation: AAS55633.1.
AL136305 Genomic DNA. Translation: CAC36889.1.
AL136305 Genomic DNA. Translation: CAI19958.1.
BC104810 mRNA. Translation: AAI04811.1.
BC104808 mRNA. Translation: AAI04809.1.
CCDSiCCDS4538.1. [Q9BX46-2]
CCDS47378.1. [Q9BX46-1]
CCDS47379.1. [Q9BX46-5]
RefSeqiNP_001137413.1. NM_001143941.1. [Q9BX46-5]
NP_001137414.1. NM_001143942.1. [Q9BX46-1]
NP_694565.1. NM_153020.2. [Q9BX46-2]
UniGeneiHs.519904.

Genome annotation databases

EnsembliENST00000318204; ENSP00000319551; ENSG00000112183. [Q9BX46-2]
ENST00000379052; ENSP00000368341; ENSG00000112183. [Q9BX46-1]
ENST00000425446; ENSP00000396898; ENSG00000112183. [Q9BX46-5]
GeneIDi221662.
KEGGihsa:221662.
UCSCiuc003nbz.5. human. [Q9BX46-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRBM24_HUMAN
AccessioniPrimary (citable) accession number: Q9BX46
Secondary accession number(s): E9PAY4
, Q6QDA4, Q8N9D3, Q96NI3
Entry historyiIntegrated into UniProtKB/Swiss-Prot: January 23, 2007
Last sequence update: June 1, 2001
Last modified: September 27, 2017
This is version 128 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM