Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

RNA-binding protein 24

Gene

RBM24

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Plays a role in myogenic differentiation by regulating MYOG levels. Binds to the 3'-UTR of MYOG mRNA and regulates its stability.1 Publication

GO - Molecular functioni

  1. mRNA 3'-UTR binding Source: UniProtKB
  2. nucleotide binding Source: InterPro

GO - Biological processi

  1. cell differentiation Source: UniProtKB-KW
  2. regulation of mRNA stability Source: UniProtKB
  3. regulation of myotube differentiation Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Differentiation

Keywords - Ligandi

RNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
RNA-binding protein 24
Alternative name(s):
RNA-binding motif protein 24
RNA-binding region-containing protein 6
Gene namesi
Name:RBM24
Synonyms:RNPC6
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 6

Organism-specific databases

HGNCiHGNC:21539. RBM24.

Subcellular locationi

Nucleus By similarity. Cytoplasm By similarity

GO - Cellular componenti

  1. cytoplasm Source: UniProtKB-SubCell
  2. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134964569.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 236236RNA-binding protein 24PRO_0000273370Add
BLAST

Proteomic databases

MaxQBiQ9BX46.
PaxDbiQ9BX46.
PRIDEiQ9BX46.

PTM databases

PhosphoSiteiQ9BX46.

Expressioni

Gene expression databases

BgeeiQ9BX46.
CleanExiHS_RBM24.
ExpressionAtlasiQ9BX46. baseline and differential.
GenevestigatoriQ9BX46.

Interactioni

Protein-protein interaction databases

BioGridi128744. 26 interactions.
IntActiQ9BX46. 1 interaction.
MINTiMINT-2879164.
STRINGi9606.ENSP00000368341.

Structurei

3D structure databases

ProteinModelPortaliQ9BX46.
SMRiQ9BX46. Positions 5-103.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini11 – 8878RRMPROSITE-ProRule annotationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi141 – 22181Ala-richAdd
BLAST

Sequence similaritiesi

Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiCOG0724.
GeneTreeiENSGT00390000002308.
HOGENOMiHOG000276232.
HOVERGENiHBG108399.
InParanoidiQ9BX46.
OMAiKMHTTQK.
OrthoDBiEOG77M8Q4.
PhylomeDBiQ9BX46.
TreeFamiTF314235.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BX46-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MHTTQKDTTY TKIFVGGLPY HTTDASLRKY FEVFGEIEEA VVITDRQTGK
60 70 80 90 100
SRGYGFVTMA DRAAAERACK DPNPIIDGRK ANVNLAYLGA KPRIMQPGFA
110 120 130 140 150
FGVQQLHPAL IQRPFGIPAH YVYPQAFVQP GVVIPHVQPT AAAASTTPYI
160 170 180 190 200
DYTGAAYAQY SAAAAAAAAA AAYDQYPYAA SPAAAGYVTA GGYGYAVQQP
210 220 230
ITAAAPGTAA AAAAAAAAAA AFGQYQPQQL QTDRMQ
Length:236
Mass (Da):24,776
Last modified:June 1, 2001 - v1
Checksum:i1CFB5AEBD4E3AA24
GO
Isoform 2 (identifier: Q9BX46-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGF → MYVCLCVSVAK

Show »
Length:191
Mass (Da):19,599
Checksum:i89E4D14E3DA941F7
GO
Isoform 3 (identifier: Q9BX46-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-58: Missing.

Note: Gene prediction based on EST data.

Show »
Length:178
Mass (Da):18,202
Checksum:iC2FD4D1937F1EBBC
GO

Sequence cautioni

The sequence BAC04474.1 differs from that shown.Unlikely isoform. Aberrant splice sites.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti144 – 1441A → D in BAC04474 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5858Missing in isoform 3. CuratedVSP_046775Add
BLAST
Alternative sequencei1 – 5656MHTTQ…RGYGF → MYVCLCVSVAK in isoform 2. 2 PublicationsVSP_022526Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055391 mRNA. Translation: BAB70914.1.
AK095016 mRNA. Translation: BAC04474.1. Sequence problems.
AY547318 mRNA. Translation: AAS55633.1.
AL136305 Genomic DNA. Translation: CAC36889.1.
AL136305 Genomic DNA. Translation: CAI19958.1.
BC104810 mRNA. Translation: AAI04811.1.
BC104808 mRNA. Translation: AAI04809.1.
CCDSiCCDS4538.1. [Q9BX46-2]
CCDS47378.1. [Q9BX46-1]
CCDS47379.1. [Q9BX46-5]
RefSeqiNP_001137413.1. NM_001143941.1. [Q9BX46-5]
NP_001137414.1. NM_001143942.1. [Q9BX46-1]
NP_694565.1. NM_153020.2. [Q9BX46-2]
UniGeneiHs.519904.

Genome annotation databases

EnsembliENST00000318204; ENSP00000319551; ENSG00000112183. [Q9BX46-2]
ENST00000379052; ENSP00000368341; ENSG00000112183. [Q9BX46-1]
ENST00000425446; ENSP00000396898; ENSG00000112183. [Q9BX46-5]
GeneIDi221662.
KEGGihsa:221662.
UCSCiuc003nbz.4. human. [Q9BX46-1]
uc003nca.3. human. [Q9BX46-2]

Polymorphism databases

DMDMi74761312.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK055391 mRNA. Translation: BAB70914.1.
AK095016 mRNA. Translation: BAC04474.1. Sequence problems.
AY547318 mRNA. Translation: AAS55633.1.
AL136305 Genomic DNA. Translation: CAC36889.1.
AL136305 Genomic DNA. Translation: CAI19958.1.
BC104810 mRNA. Translation: AAI04811.1.
BC104808 mRNA. Translation: AAI04809.1.
CCDSiCCDS4538.1. [Q9BX46-2]
CCDS47378.1. [Q9BX46-1]
CCDS47379.1. [Q9BX46-5]
RefSeqiNP_001137413.1. NM_001143941.1. [Q9BX46-5]
NP_001137414.1. NM_001143942.1. [Q9BX46-1]
NP_694565.1. NM_153020.2. [Q9BX46-2]
UniGeneiHs.519904.

3D structure databases

ProteinModelPortaliQ9BX46.
SMRiQ9BX46. Positions 5-103.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi128744. 26 interactions.
IntActiQ9BX46. 1 interaction.
MINTiMINT-2879164.
STRINGi9606.ENSP00000368341.

PTM databases

PhosphoSiteiQ9BX46.

Polymorphism databases

DMDMi74761312.

Proteomic databases

MaxQBiQ9BX46.
PaxDbiQ9BX46.
PRIDEiQ9BX46.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000318204; ENSP00000319551; ENSG00000112183. [Q9BX46-2]
ENST00000379052; ENSP00000368341; ENSG00000112183. [Q9BX46-1]
ENST00000425446; ENSP00000396898; ENSG00000112183. [Q9BX46-5]
GeneIDi221662.
KEGGihsa:221662.
UCSCiuc003nbz.4. human. [Q9BX46-1]
uc003nca.3. human. [Q9BX46-2]

Organism-specific databases

CTDi221662.
GeneCardsiGC06P017281.
HGNCiHGNC:21539. RBM24.
neXtProtiNX_Q9BX46.
PharmGKBiPA134964569.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG0724.
GeneTreeiENSGT00390000002308.
HOGENOMiHOG000276232.
HOVERGENiHBG108399.
InParanoidiQ9BX46.
OMAiKMHTTQK.
OrthoDBiEOG77M8Q4.
PhylomeDBiQ9BX46.
TreeFamiTF314235.

Miscellaneous databases

GenomeRNAii221662.
NextBioi91409.
PROiQ9BX46.

Gene expression databases

BgeeiQ9BX46.
CleanExiHS_RBM24.
ExpressionAtlasiQ9BX46. baseline and differential.
GenevestigatoriQ9BX46.

Family and domain databases

Gene3Di3.30.70.330. 1 hit.
InterProiIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamiPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTiSM00360. RRM. 1 hit.
[Graphical view]
PROSITEiPS50102. RRM. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Fetal brain and Hippocampus.
  2. Li H., Zhong G., Zhou G., Wang C., Shen C., Ke R., Li M., Xiao W., Lin L., Yang S.
    Submitted (JAN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "The DNA sequence and analysis of human chromosome 6."
    Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
    , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
    Nature 425:805-811(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain cortex.
  5. "RNA-binding motif protein 24 regulates myogenin expression and promotes myogenic differentiation."
    Jin D., Hidaka K., Shirai M., Morisaki T.
    Genes Cells 15:1158-1167(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, RNA-BINDING.

Entry informationi

Entry nameiRBM24_HUMAN
AccessioniPrimary (citable) accession number: Q9BX46
Secondary accession number(s): E9PAY4
, Q6QDA4, Q8N9D3, Q96NI3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2007
Last sequence update: June 1, 2001
Last modified: January 7, 2015
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 6
    Human chromosome 6: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.