Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BX46 (RBM24_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 105. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (2) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
RNA-binding protein 24
Alternative name(s):
RNA-binding motif protein 24
RNA-binding region-containing protein 6
Gene names
Name:RBM24
Synonyms:RNPC6
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length236 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Plays a role in myogenic differentiation by regulating MYOG levels. Binds to the 3'-UTR of MYOG mRNA and regulates its stability. Ref.5

Subcellular location

Nucleus By similarity. Cytoplasm By similarity.

Sequence similarities

Contains 1 RRM (RNA recognition motif) domain.

Sequence caution

The sequence BAC04474.1 differs from that shown. Reason: Unlikely isoform. Aberrant splice sites.

Ontologies

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BX46-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9BX46-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-56: MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGF → MYVCLCVSVAK
Isoform 3 (identifier: Q9BX46-5)

The sequence of this isoform differs from the canonical sequence as follows:
     1-58: Missing.
Note: Gene prediction based on EST data.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 236236RNA-binding protein 24
PRO_0000273370

Regions

Domain11 – 8878RRM
Compositional bias141 – 22181Ala-rich

Natural variations

Alternative sequence1 – 5858Missing in isoform 3.
VSP_046775
Alternative sequence1 – 5656MHTTQ…RGYGF → MYVCLCVSVAK in isoform 2.
VSP_022526

Experimental info

Sequence conflict1441A → D in BAC04474. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2001. Version 1.
Checksum: 1CFB5AEBD4E3AA24

FASTA23624,776
        10         20         30         40         50         60 
MHTTQKDTTY TKIFVGGLPY HTTDASLRKY FEVFGEIEEA VVITDRQTGK SRGYGFVTMA 

        70         80         90        100        110        120 
DRAAAERACK DPNPIIDGRK ANVNLAYLGA KPRIMQPGFA FGVQQLHPAL IQRPFGIPAH 

       130        140        150        160        170        180 
YVYPQAFVQP GVVIPHVQPT AAAASTTPYI DYTGAAYAQY SAAAAAAAAA AAYDQYPYAA 

       190        200        210        220        230 
SPAAAGYVTA GGYGYAVQQP ITAAAPGTAA AAAAAAAAAA AFGQYQPQQL QTDRMQ 

« Hide

Isoform 2 [UniParc].

Checksum: 89E4D14E3DA941F7
Show »

FASTA19119,599
Isoform 3 [UniParc].

Checksum: C2FD4D1937F1EBBC
Show »

FASTA17818,202

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Fetal brain and Hippocampus.
[2]Li H., Zhong G., Zhou G., Wang C., Shen C., Ke R., Li M., Xiao W., Lin L., Yang S.
Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[3]"The DNA sequence and analysis of human chromosome 6."
Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D. expand/collapse author list , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Brain cortex.
[5]"RNA-binding motif protein 24 regulates myogenin expression and promotes myogenic differentiation."
Jin D., Hidaka K., Shirai M., Morisaki T.
Genes Cells 15:1158-1167(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, RNA-BINDING.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK055391 mRNA. Translation: BAB70914.1.
AK095016 mRNA. Translation: BAC04474.1. Sequence problems.
AY547318 mRNA. Translation: AAS55633.1.
AL136305 Genomic DNA. Translation: CAC36889.1.
AL136305 Genomic DNA. Translation: CAI19958.1.
BC104810 mRNA. Translation: AAI04811.1.
BC104808 mRNA. Translation: AAI04809.1.
CCDSCCDS4538.1. [Q9BX46-2]
CCDS47378.1. [Q9BX46-1]
CCDS47379.1. [Q9BX46-5]
RefSeqNP_001137413.1. NM_001143941.1. [Q9BX46-5]
NP_001137414.1. NM_001143942.1. [Q9BX46-1]
NP_694565.1. NM_153020.2. [Q9BX46-2]
UniGeneHs.519904.

3D structure databases

ProteinModelPortalQ9BX46.
SMRQ9BX46. Positions 5-103.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid128744. 2 interactions.
IntActQ9BX46. 1 interaction.
MINTMINT-2879164.
STRING9606.ENSP00000368341.

PTM databases

PhosphoSiteQ9BX46.

Polymorphism databases

DMDM74761312.

Proteomic databases

MaxQBQ9BX46.
PaxDbQ9BX46.
PRIDEQ9BX46.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000318204; ENSP00000319551; ENSG00000112183. [Q9BX46-2]
ENST00000379052; ENSP00000368341; ENSG00000112183. [Q9BX46-1]
ENST00000425446; ENSP00000396898; ENSG00000112183. [Q9BX46-5]
GeneID221662.
KEGGhsa:221662.
UCSCuc003nbz.4. human. [Q9BX46-1]
uc003nca.3. human. [Q9BX46-2]

Organism-specific databases

CTD221662.
GeneCardsGC06P017281.
HGNCHGNC:21539. RBM24.
neXtProtNX_Q9BX46.
PharmGKBPA134964569.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG0724.
HOGENOMHOG000276232.
HOVERGENHBG108399.
InParanoidQ9BX46.
OMAPRIMQPX.
OrthoDBEOG77M8Q4.
PhylomeDBQ9BX46.
TreeFamTF314235.

Gene expression databases

ArrayExpressQ9BX46.
BgeeQ9BX46.
CleanExHS_RBM24.
GenevestigatorQ9BX46.

Family and domain databases

Gene3D3.30.70.330. 1 hit.
InterProIPR012677. Nucleotide-bd_a/b_plait.
IPR000504. RRM_dom.
[Graphical view]
PfamPF00076. RRM_1. 1 hit.
[Graphical view]
SMARTSM00360. RRM. 1 hit.
[Graphical view]
PROSITEPS50102. RRM. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi221662.
NextBio91409.
PROQ9BX46.

Entry information

Entry nameRBM24_HUMAN
AccessionPrimary (citable) accession number: Q9BX46
Secondary accession number(s): E9PAY4 expand/collapse secondary AC list , Q6QDA4, Q8N9D3, Q96NI3
Entry history
Integrated into UniProtKB/Swiss-Prot: January 23, 2007
Last sequence update: June 1, 2001
Last modified: July 9, 2014
This is version 105 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

Human chromosome 6

Human chromosome 6: entries, gene names and cross-references to MIM