Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BX46

- RBM24_HUMAN

UniProt

Q9BX46 - RBM24_HUMAN

Protein

RNA-binding protein 24

Gene

RBM24

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 106 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Plays a role in myogenic differentiation by regulating MYOG levels. Binds to the 3'-UTR of MYOG mRNA and regulates its stability.1 Publication

    GO - Molecular functioni

    1. mRNA 3'-UTR binding Source: UniProtKB
    2. nucleotide binding Source: InterPro

    GO - Biological processi

    1. cell differentiation Source: UniProtKB-KW
    2. regulation of mRNA stability Source: UniProtKB
    3. regulation of myotube differentiation Source: UniProtKB

    Keywords - Biological processi

    Differentiation

    Keywords - Ligandi

    RNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    RNA-binding protein 24
    Alternative name(s):
    RNA-binding motif protein 24
    RNA-binding region-containing protein 6
    Gene namesi
    Name:RBM24
    Synonyms:RNPC6
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 6

    Organism-specific databases

    HGNCiHGNC:21539. RBM24.

    Subcellular locationi

    Nucleus By similarity. Cytoplasm By similarity

    GO - Cellular componenti

    1. cytoplasm Source: UniProtKB-SubCell
    2. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Cytoplasm, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134964569.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 236236RNA-binding protein 24PRO_0000273370Add
    BLAST

    Proteomic databases

    MaxQBiQ9BX46.
    PaxDbiQ9BX46.
    PRIDEiQ9BX46.

    PTM databases

    PhosphoSiteiQ9BX46.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9BX46.
    BgeeiQ9BX46.
    CleanExiHS_RBM24.
    GenevestigatoriQ9BX46.

    Interactioni

    Protein-protein interaction databases

    BioGridi128744. 2 interactions.
    IntActiQ9BX46. 1 interaction.
    MINTiMINT-2879164.
    STRINGi9606.ENSP00000368341.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BX46.
    SMRiQ9BX46. Positions 5-103.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini11 – 8878RRMPROSITE-ProRule annotationAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi141 – 22181Ala-richAdd
    BLAST

    Sequence similaritiesi

    Contains 1 RRM (RNA recognition motif) domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiCOG0724.
    HOGENOMiHOG000276232.
    HOVERGENiHBG108399.
    InParanoidiQ9BX46.
    OMAiPRIMQPX.
    OrthoDBiEOG77M8Q4.
    PhylomeDBiQ9BX46.
    TreeFamiTF314235.

    Family and domain databases

    Gene3Di3.30.70.330. 1 hit.
    InterProiIPR012677. Nucleotide-bd_a/b_plait.
    IPR000504. RRM_dom.
    [Graphical view]
    PfamiPF00076. RRM_1. 1 hit.
    [Graphical view]
    SMARTiSM00360. RRM. 1 hit.
    [Graphical view]
    PROSITEiPS50102. RRM. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BX46-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MHTTQKDTTY TKIFVGGLPY HTTDASLRKY FEVFGEIEEA VVITDRQTGK    50
    SRGYGFVTMA DRAAAERACK DPNPIIDGRK ANVNLAYLGA KPRIMQPGFA 100
    FGVQQLHPAL IQRPFGIPAH YVYPQAFVQP GVVIPHVQPT AAAASTTPYI 150
    DYTGAAYAQY SAAAAAAAAA AAYDQYPYAA SPAAAGYVTA GGYGYAVQQP 200
    ITAAAPGTAA AAAAAAAAAA AFGQYQPQQL QTDRMQ 236
    Length:236
    Mass (Da):24,776
    Last modified:June 1, 2001 - v1
    Checksum:i1CFB5AEBD4E3AA24
    GO
    Isoform 2 (identifier: Q9BX46-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-56: MHTTQKDTTYTKIFVGGLPYHTTDASLRKYFEVFGEIEEAVVITDRQTGKSRGYGF → MYVCLCVSVAK

    Show »
    Length:191
    Mass (Da):19,599
    Checksum:i89E4D14E3DA941F7
    GO
    Isoform 3 (identifier: Q9BX46-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-58: Missing.

    Note: Gene prediction based on EST data.

    Show »
    Length:178
    Mass (Da):18,202
    Checksum:iC2FD4D1937F1EBBC
    GO

    Sequence cautioni

    The sequence BAC04474.1 differs from that shown. Reason: Unlikely isoform. Aberrant splice sites.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti144 – 1441A → D in BAC04474. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 5858Missing in isoform 3. CuratedVSP_046775Add
    BLAST
    Alternative sequencei1 – 5656MHTTQ…RGYGF → MYVCLCVSVAK in isoform 2. 2 PublicationsVSP_022526Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK055391 mRNA. Translation: BAB70914.1.
    AK095016 mRNA. Translation: BAC04474.1. Sequence problems.
    AY547318 mRNA. Translation: AAS55633.1.
    AL136305 Genomic DNA. Translation: CAC36889.1.
    AL136305 Genomic DNA. Translation: CAI19958.1.
    BC104810 mRNA. Translation: AAI04811.1.
    BC104808 mRNA. Translation: AAI04809.1.
    CCDSiCCDS4538.1. [Q9BX46-2]
    CCDS47378.1. [Q9BX46-1]
    CCDS47379.1. [Q9BX46-5]
    RefSeqiNP_001137413.1. NM_001143941.1. [Q9BX46-5]
    NP_001137414.1. NM_001143942.1. [Q9BX46-1]
    NP_694565.1. NM_153020.2. [Q9BX46-2]
    UniGeneiHs.519904.

    Genome annotation databases

    EnsembliENST00000318204; ENSP00000319551; ENSG00000112183. [Q9BX46-2]
    ENST00000379052; ENSP00000368341; ENSG00000112183. [Q9BX46-1]
    ENST00000425446; ENSP00000396898; ENSG00000112183. [Q9BX46-5]
    GeneIDi221662.
    KEGGihsa:221662.
    UCSCiuc003nbz.4. human. [Q9BX46-1]
    uc003nca.3. human. [Q9BX46-2]

    Polymorphism databases

    DMDMi74761312.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK055391 mRNA. Translation: BAB70914.1 .
    AK095016 mRNA. Translation: BAC04474.1 . Sequence problems.
    AY547318 mRNA. Translation: AAS55633.1 .
    AL136305 Genomic DNA. Translation: CAC36889.1 .
    AL136305 Genomic DNA. Translation: CAI19958.1 .
    BC104810 mRNA. Translation: AAI04811.1 .
    BC104808 mRNA. Translation: AAI04809.1 .
    CCDSi CCDS4538.1. [Q9BX46-2 ]
    CCDS47378.1. [Q9BX46-1 ]
    CCDS47379.1. [Q9BX46-5 ]
    RefSeqi NP_001137413.1. NM_001143941.1. [Q9BX46-5 ]
    NP_001137414.1. NM_001143942.1. [Q9BX46-1 ]
    NP_694565.1. NM_153020.2. [Q9BX46-2 ]
    UniGenei Hs.519904.

    3D structure databases

    ProteinModelPortali Q9BX46.
    SMRi Q9BX46. Positions 5-103.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 128744. 2 interactions.
    IntActi Q9BX46. 1 interaction.
    MINTi MINT-2879164.
    STRINGi 9606.ENSP00000368341.

    PTM databases

    PhosphoSitei Q9BX46.

    Polymorphism databases

    DMDMi 74761312.

    Proteomic databases

    MaxQBi Q9BX46.
    PaxDbi Q9BX46.
    PRIDEi Q9BX46.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000318204 ; ENSP00000319551 ; ENSG00000112183 . [Q9BX46-2 ]
    ENST00000379052 ; ENSP00000368341 ; ENSG00000112183 . [Q9BX46-1 ]
    ENST00000425446 ; ENSP00000396898 ; ENSG00000112183 . [Q9BX46-5 ]
    GeneIDi 221662.
    KEGGi hsa:221662.
    UCSCi uc003nbz.4. human. [Q9BX46-1 ]
    uc003nca.3. human. [Q9BX46-2 ]

    Organism-specific databases

    CTDi 221662.
    GeneCardsi GC06P017281.
    HGNCi HGNC:21539. RBM24.
    neXtProti NX_Q9BX46.
    PharmGKBi PA134964569.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG0724.
    HOGENOMi HOG000276232.
    HOVERGENi HBG108399.
    InParanoidi Q9BX46.
    OMAi PRIMQPX.
    OrthoDBi EOG77M8Q4.
    PhylomeDBi Q9BX46.
    TreeFami TF314235.

    Miscellaneous databases

    GenomeRNAii 221662.
    NextBioi 91409.
    PROi Q9BX46.

    Gene expression databases

    ArrayExpressi Q9BX46.
    Bgeei Q9BX46.
    CleanExi HS_RBM24.
    Genevestigatori Q9BX46.

    Family and domain databases

    Gene3Di 3.30.70.330. 1 hit.
    InterProi IPR012677. Nucleotide-bd_a/b_plait.
    IPR000504. RRM_dom.
    [Graphical view ]
    Pfami PF00076. RRM_1. 1 hit.
    [Graphical view ]
    SMARTi SM00360. RRM. 1 hit.
    [Graphical view ]
    PROSITEi PS50102. RRM. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Fetal brain and Hippocampus.
    2. Li H., Zhong G., Zhou G., Wang C., Shen C., Ke R., Li M., Xiao W., Lin L., Yang S.
      Submitted (FEB-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. "The DNA sequence and analysis of human chromosome 6."
      Mungall A.J., Palmer S.A., Sims S.K., Edwards C.A., Ashurst J.L., Wilming L., Jones M.C., Horton R., Hunt S.E., Scott C.E., Gilbert J.G.R., Clamp M.E., Bethel G., Milne S., Ainscough R., Almeida J.P., Ambrose K.D., Andrews T.D.
      , Ashwell R.I.S., Babbage A.K., Bagguley C.L., Bailey J., Banerjee R., Barker D.J., Barlow K.F., Bates K., Beare D.M., Beasley H., Beasley O., Bird C.P., Blakey S.E., Bray-Allen S., Brook J., Brown A.J., Brown J.Y., Burford D.C., Burrill W., Burton J., Carder C., Carter N.P., Chapman J.C., Clark S.Y., Clark G., Clee C.M., Clegg S., Cobley V., Collier R.E., Collins J.E., Colman L.K., Corby N.R., Coville G.J., Culley K.M., Dhami P., Davies J., Dunn M., Earthrowl M.E., Ellington A.E., Evans K.A., Faulkner L., Francis M.D., Frankish A., Frankland J., French L., Garner P., Garnett J., Ghori M.J., Gilby L.M., Gillson C.J., Glithero R.J., Grafham D.V., Grant M., Gribble S., Griffiths C., Griffiths M.N.D., Hall R., Halls K.S., Hammond S., Harley J.L., Hart E.A., Heath P.D., Heathcott R., Holmes S.J., Howden P.J., Howe K.L., Howell G.R., Huckle E., Humphray S.J., Humphries M.D., Hunt A.R., Johnson C.M., Joy A.A., Kay M., Keenan S.J., Kimberley A.M., King A., Laird G.K., Langford C., Lawlor S., Leongamornlert D.A., Leversha M., Lloyd C.R., Lloyd D.M., Loveland J.E., Lovell J., Martin S., Mashreghi-Mohammadi M., Maslen G.L., Matthews L., McCann O.T., McLaren S.J., McLay K., McMurray A., Moore M.J.F., Mullikin J.C., Niblett D., Nickerson T., Novik K.L., Oliver K., Overton-Larty E.K., Parker A., Patel R., Pearce A.V., Peck A.I., Phillimore B.J.C.T., Phillips S., Plumb R.W., Porter K.M., Ramsey Y., Ranby S.A., Rice C.M., Ross M.T., Searle S.M., Sehra H.K., Sheridan E., Skuce C.D., Smith S., Smith M., Spraggon L., Squares S.L., Steward C.A., Sycamore N., Tamlyn-Hall G., Tester J., Theaker A.J., Thomas D.W., Thorpe A., Tracey A., Tromans A., Tubby B., Wall M., Wallis J.M., West A.P., White S.S., Whitehead S.L., Whittaker H., Wild A., Willey D.J., Wilmer T.E., Wood J.M., Wray P.W., Wyatt J.C., Young L., Younger R.M., Bentley D.R., Coulson A., Durbin R.M., Hubbard T., Sulston J.E., Dunham I., Rogers J., Beck S.
      Nature 425:805-811(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Brain cortex.
    5. "RNA-binding motif protein 24 regulates myogenin expression and promotes myogenic differentiation."
      Jin D., Hidaka K., Shirai M., Morisaki T.
      Genes Cells 15:1158-1167(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, RNA-BINDING.

    Entry informationi

    Entry nameiRBM24_HUMAN
    AccessioniPrimary (citable) accession number: Q9BX46
    Secondary accession number(s): E9PAY4
    , Q6QDA4, Q8N9D3, Q96NI3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 23, 2007
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 106 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 6
      Human chromosome 6: entries, gene names and cross-references to MIM
    2. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3