Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cell division cycle-associated protein 7

Gene

CDCA7

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Participates in MYC-mediated cell transformation and apoptosis; induces anchorage-independent growth and clonogenicity in lymphoblastoid cells. Insufficient to induce tumorigenicity when overexpressed but contributes to MYC-mediated tumorigenesis. May play a role as transcriptional regulator.4 Publications

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Apoptosis, Transcription, Transcription regulation

Enzyme and pathway databases

SIGNORiQ9BWT1.

Names & Taxonomyi

Protein namesi
Recommended name:
Cell division cycle-associated protein 7
Alternative name(s):
Protein JPO1
Gene namesi
Name:CDCA7
Synonyms:JPO1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:14628. CDCA7.

Subcellular locationi

  • Nucleus
  • Cytoplasm

  • Note: Predominantly nuclear with some expression also seen in the cytoplasm. Predominantly cytoplasmic when phosphorylated at Thr-163.

GO - Cellular componenti

  • cytoplasm Source: HPA
  • nucleoplasm Source: HPA
  • nucleus Source: MGI
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi158 – 1581R → A: Does not affect phosphorylation or interaction with YHWAE and YHWAZ. 1 Publication
Mutagenesisi159 – 1591P → A: Does not affect phosphorylation or interaction with YHWAE and YHWAZ. 1 Publication
Mutagenesisi160 – 1601R → A: Abolishes phosphorylation and interaction with YHWAE and YHWAZ. 1 Publication
Mutagenesisi160 – 1601R → E: Predominantly cytoplasmic. 1 Publication
Mutagenesisi161 – 1611R → A: Increased phosphorylation, binding to YHWAE and YHWAZ, and cytoplasmic expression. 1 Publication
Mutagenesisi161 – 1611R → E: Predominantly cytoplasmic. 1 Publication
Mutagenesisi162 – 1621R → A: Does not affect phosphorylation or interaction with YHWAE and YHWAZ. 1 Publication
Mutagenesisi162 – 1621R → E: Predominantly cytoplasmic. 1 Publication
Mutagenesisi163 – 1631T → A: Abolishes phosphorylation, interaction with YHWAE and YHWAZ, and cytoplasmic localization. 1 Publication
Mutagenesisi164 – 1641F → A: Abolishes phosphorylation and interaction with YHWAE and YHWAZ. 1 Publication
Mutagenesisi165 – 1651P → A: Abolishes phosphorylation, interaction with YHWAE and YHWAZ, and cytoplasmic localization. 1 Publication
Mutagenesisi171 – 1711R → E: Predominantly cytoplasmic. Completely cytoplasmic with no nuclear expression; when associated with E-176. 1 Publication
Mutagenesisi176 – 1761R → E: Predominantly cytoplasmic. Completely cytoplasmic with no nuclear expression; when associated with E-171. 1 Publication
Mutagenesisi182 – 1821R → E: No effect on subcellular location. 1 Publication
Mutagenesisi184 – 1841R → E: No effect on subcellular location. 1 Publication

Organism-specific databases

PharmGKBiPA26280.

Polymorphism and mutation databases

BioMutaiCDCA7.
DMDMi74733461.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 371371Cell division cycle-associated protein 7PRO_0000249310Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei142 – 1421PhosphoserineCombined sources
Modified residuei163 – 1631PhosphothreonineCombined sources1 Publication
Modified residuei190 – 1901PhosphoserineCombined sources

Post-translational modificationi

Phosphorylation at Thr-163 promotes interaction with YWHAE and YWHAZ, dissociation from MYC and sequestration in the cytoplasm. In vitro, phosphorylated at Thr-163 by AKT.1 Publication

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9BWT1.
MaxQBiQ9BWT1.
PaxDbiQ9BWT1.
PeptideAtlasiQ9BWT1.
PRIDEiQ9BWT1.

PTM databases

iPTMnetiQ9BWT1.
PhosphoSiteiQ9BWT1.

Expressioni

Tissue specificityi

Ubiquitous with higher level in thymus and small intestine. Overexpressed in a large number of tumors, in blood from patients with acute myelogenous leukemia (AML) and in chronic myelogenous leukemia (CML) blast crisis.2 Publications

Inductioni

Activated by MYC and possibly E2F1.

Gene expression databases

BgeeiQ9BWT1.
CleanExiHS_CDCA7.
ExpressionAtlasiQ9BWT1. baseline and differential.
GenevisibleiQ9BWT1. HS.

Organism-specific databases

HPAiHPA005565.

Interactioni

Subunit structurei

Interacts with MYC (via C-terminus), YWHAE and YWHAZ.1 Publication

Protein-protein interaction databases

BioGridi123792. 7 interactions.
IntActiQ9BWT1. 1 interaction.
MINTiMINT-8201761.
STRINGi9606.ENSP00000306968.

Structurei

3D structure databases

ProteinModelPortaliQ9BWT1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni146 – 17025Interaction with MYCAdd
BLAST
Regioni247 – 371125Mediates transcriptional activityAdd
BLAST

Motif

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Motifi160 – 17617Nuclear localization signal1 PublicationAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi157 – 18630Arg-richAdd
BLAST

Phylogenomic databases

eggNOGiENOG410IFJD. Eukaryota.
ENOG410ZWEA. LUCA.
GeneTreeiENSGT00390000014657.
HOGENOMiHOG000231812.
HOVERGENiHBG060300.
InParanoidiQ9BWT1.
OMAiNPDCWGV.
OrthoDBiEOG7NGQBQ.
PhylomeDBiQ9BWT1.
TreeFamiTF101076.

Family and domain databases

InterProiIPR033576. CDCA7.
IPR018866. Znf-4CXXC_R1.
[Graphical view]
PANTHERiPTHR31169:SF2. PTHR31169:SF2. 1 hit.
PfamiPF10497. zf-4CXXC_R1. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BWT1-1) [UniParc]FASTAAdd to basket

Also known as: isoform 2 variant

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MDARRVPQKD LRVKKNLKKF RYVKLISMET SSSSDDSCDS FASDNFANTR
60 70 80 90 100
LQSVREGCRT RSQCRHSGPL RVAMKFPARS TRGATNKKAE SRQPSENSVT
110 120 130 140 150
DSNSDSEDES GMNFLEKRAL NIKQNKAMLA KLMSELESFP GSFRGRHPLP
160 170 180 190 200
GSDSQSRRPR RRTFPGVASR RNPERRARPL TRSRSRILGS LDALPMEEEE
210 220 230 240 250
EEDKYMLVRK RKTVDGYMNE DDLPRSRRSR SSVTLPHIIR PVEEITEEEL
260 270 280 290 300
ENVCSNSREK IYNRSLGSTC HQCRQKTIDT KTNCRNPDCW GVRGQFCGPC
310 320 330 340 350
LRNRYGEEVR DALLDPNWHC PPCRGICNCS FCRQRDGRCA TGVLVYLAKY
360 370
HGFGNVHAYL KSLKQEFEMQ A
Length:371
Mass (Da):42,573
Last modified:June 1, 2001 - v1
Checksum:i30A244E3057D9C43
GO
Isoform 2 (identifier: Q9BWT1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-49: T → TKPKFRSDIS...FSESEIQDGM

Show »
Length:450
Mass (Da):51,445
Checksum:iE0AE72184AEDAE39
GO
Isoform 3 (identifier: Q9BWT1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     267-316: Missing.

Note: No experimental confirmation available.
Show »
Length:321
Mass (Da):36,892
Checksum:i2F5A9FA6F14EA200
GO
Isoform 4 (identifier: Q9BWT1-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     155-207: QSRRPRRRTF...EEEEEDKYML → VSTSSCLYTV...PPDRSLDDPP
     208-371: Missing.

Note: No experimental confirmation available.
Show »
Length:207
Mass (Da):23,340
Checksum:i77AF9BB96EFDDF0F
GO
Isoform 5 (identifier: Q9BWT1-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     8-49: Missing.

Note: No experimental confirmation available.
Show »
Length:329
Mass (Da):37,786
Checksum:i50BB8953A4D83BAB
GO
Isoform 6 (identifier: Q9BWT1-6) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     49-49: T → TKPRPDVTNELAGIFHADSDDESFCGFSESEIQDGM

Note: No experimental confirmation available.
Show »
Length:406
Mass (Da):46,400
Checksum:i236883B33F379260
GO

Sequence cautioni

The sequence CAH56357.1 differs from that shown. Reason: Frameshift at position 260. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti152 – 1521S → G in AAH15124 (PubMed:15489334).Curated
Sequence conflicti320 – 3201C → W in BAD97244 (Ref. 3) Curated
Isoform 2 (identifier: Q9BWT1-2)
Sequence conflicti63 – 631N → S in BAB55245 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei8 – 4942Missing in isoform 5. 1 PublicationVSP_054407Add
BLAST
Alternative sequencei49 – 491T → TKPKFRSDISEELANVFYED SDNESFCGFSESEVQDVLDH CGFLQKPRPDVTNELAGIFH ADSDDESFCGFSESEIQDGM in isoform 2. 1 PublicationVSP_020394
Alternative sequencei49 – 491T → TKPRPDVTNELAGIFHADSD DESFCGFSESEIQDGM in isoform 6. 1 PublicationVSP_054408
Alternative sequencei155 – 20753QSRRP…DKYML → VSTSSCLYTVVFWAHLRSIC VVFKNLISLFVWPSRQTKGT QRKPPDRSLDDPP in isoform 4. 1 PublicationVSP_020395Add
BLAST
Alternative sequencei208 – 371164Missing in isoform 4. 1 PublicationVSP_020396Add
BLAST
Alternative sequencei267 – 31650Missing in isoform 3. 1 PublicationVSP_020397Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY029179 mRNA. Translation: AAK31591.1.
AK027628 mRNA. Translation: BAB55245.1.
AK027642 mRNA. Translation: BAB55258.1.
AK075134 mRNA. Translation: BAC11425.1.
AK297097 mRNA. Translation: BAG59610.1.
AK300949 mRNA. Translation: BAG62578.1.
AK223524 mRNA. Translation: BAD97244.1.
AL833728 mRNA. Translation: CAH56253.1.
AL834186 mRNA. Translation: CAH56357.1. Frameshift.
AC092573 Genomic DNA. Translation: AAX82003.1.
BC015124 mRNA. Translation: AAH15124.1.
BC027966 mRNA. Translation: AAH27966.1.
BG354580 mRNA. No translation available.
CCDSiCCDS2252.1. [Q9BWT1-2]
CCDS2253.1. [Q9BWT1-1]
RefSeqiNP_114148.3. NM_031942.4. [Q9BWT1-2]
NP_665809.1. NM_145810.2. [Q9BWT1-1]
UniGeneiHs.470654.

Genome annotation databases

EnsembliENST00000306721; ENSP00000306968; ENSG00000144354. [Q9BWT1-2]
ENST00000347703; ENSP00000272789; ENSG00000144354. [Q9BWT1-1]
ENST00000410019; ENSP00000386833; ENSG00000144354. [Q9BWT1-5]
ENST00000410101; ENSP00000386656; ENSG00000144354. [Q9BWT1-6]
GeneIDi83879.
KEGGihsa:83879.
UCSCiuc002uic.2. human. [Q9BWT1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY029179 mRNA. Translation: AAK31591.1.
AK027628 mRNA. Translation: BAB55245.1.
AK027642 mRNA. Translation: BAB55258.1.
AK075134 mRNA. Translation: BAC11425.1.
AK297097 mRNA. Translation: BAG59610.1.
AK300949 mRNA. Translation: BAG62578.1.
AK223524 mRNA. Translation: BAD97244.1.
AL833728 mRNA. Translation: CAH56253.1.
AL834186 mRNA. Translation: CAH56357.1. Frameshift.
AC092573 Genomic DNA. Translation: AAX82003.1.
BC015124 mRNA. Translation: AAH15124.1.
BC027966 mRNA. Translation: AAH27966.1.
BG354580 mRNA. No translation available.
CCDSiCCDS2252.1. [Q9BWT1-2]
CCDS2253.1. [Q9BWT1-1]
RefSeqiNP_114148.3. NM_031942.4. [Q9BWT1-2]
NP_665809.1. NM_145810.2. [Q9BWT1-1]
UniGeneiHs.470654.

3D structure databases

ProteinModelPortaliQ9BWT1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123792. 7 interactions.
IntActiQ9BWT1. 1 interaction.
MINTiMINT-8201761.
STRINGi9606.ENSP00000306968.

PTM databases

iPTMnetiQ9BWT1.
PhosphoSiteiQ9BWT1.

Polymorphism and mutation databases

BioMutaiCDCA7.
DMDMi74733461.

Proteomic databases

EPDiQ9BWT1.
MaxQBiQ9BWT1.
PaxDbiQ9BWT1.
PeptideAtlasiQ9BWT1.
PRIDEiQ9BWT1.

Protocols and materials databases

DNASUi83879.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306721; ENSP00000306968; ENSG00000144354. [Q9BWT1-2]
ENST00000347703; ENSP00000272789; ENSG00000144354. [Q9BWT1-1]
ENST00000410019; ENSP00000386833; ENSG00000144354. [Q9BWT1-5]
ENST00000410101; ENSP00000386656; ENSG00000144354. [Q9BWT1-6]
GeneIDi83879.
KEGGihsa:83879.
UCSCiuc002uic.2. human. [Q9BWT1-1]

Organism-specific databases

CTDi83879.
GeneCardsiCDCA7.
HGNCiHGNC:14628. CDCA7.
HPAiHPA005565.
MIMi609937. gene.
neXtProtiNX_Q9BWT1.
PharmGKBiPA26280.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IFJD. Eukaryota.
ENOG410ZWEA. LUCA.
GeneTreeiENSGT00390000014657.
HOGENOMiHOG000231812.
HOVERGENiHBG060300.
InParanoidiQ9BWT1.
OMAiNPDCWGV.
OrthoDBiEOG7NGQBQ.
PhylomeDBiQ9BWT1.
TreeFamiTF101076.

Enzyme and pathway databases

SIGNORiQ9BWT1.

Miscellaneous databases

ChiTaRSiCDCA7. human.
GeneWikiiCDCA7.
GenomeRNAii83879.
PROiQ9BWT1.
SOURCEiSearch...

Gene expression databases

BgeeiQ9BWT1.
CleanExiHS_CDCA7.
ExpressionAtlasiQ9BWT1. baseline and differential.
GenevisibleiQ9BWT1. HS.

Family and domain databases

InterProiIPR033576. CDCA7.
IPR018866. Znf-4CXXC_R1.
[Graphical view]
PANTHERiPTHR31169:SF2. PTHR31169:SF2. 1 hit.
PfamiPF10497. zf-4CXXC_R1. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "A novel c-Myc-responsive gene, JPO1, participates in neoplastic transformation."
    Prescott J.E., Osthus R.C., Lee L.A., Lewis B.C., Shim H., Barrett J.F., Guo Q., Hawkins A.L., Griffin C.A., Dang C.V.
    J. Biol. Chem. 276:48276-48284(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, MISCELLANEOUS, TISSUE SPECIFICITY, SUBCELLULAR LOCATION.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2; 4; 5 AND 6).
    Tissue: Placenta and Small intestine.
  3. Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 155-371 (ISOFORM 1).
    Tissue: Lymph node and Stomach.
  5. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Kidney and Pancreas.
  7. "Drug target discovery by gene expression analysis: cell cycle genes."
    Walker M.G.
    Curr. Cancer Drug Targets 1:73-83(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 90-371.
  8. "The Myc target gene JPO1/CDCA7 is frequently overexpressed in human tumors and has limited transforming activity in vivo."
    Osthus R.C., Karim B., Prescott J.E., Smith B.D., McDevitt M., Huso D.L., Dang C.V.
    Cancer Res. 65:5620-5627(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, TISSUE SPECIFICITY.
  9. "JPO1/CDCA7, a novel transcription factor E2F1-induced protein, possesses intrinsic transcriptional regulator activity."
    Goto Y., Hayashi R., Muramatsu T., Ogawa H., Eguchi I., Oshida Y., Ohtani K., Yoshida K.
    Biochim. Biophys. Acta 1759:60-68(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, REGION.
  10. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-190, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  11. "Toward a comprehensive characterization of a human cancer cell phosphoproteome."
    Zhou H., Di Palma S., Preisinger C., Peng M., Polat A.N., Heck A.J., Mohammed S.
    J. Proteome Res. 12:260-271(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-142 AND THR-163, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma and Erythroleukemia.
  12. "The MYC-associated protein CDCA7 is phosphorylated by AKT to regulate MYC-dependent apoptosis and transformation."
    Gill R.M., Gabor T.V., Couzens A.L., Scheid M.P.
    Mol. Cell. Biol. 33:498-513(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH MYC; YWHAE AND YWHAZ, SUBCELLULAR LOCATION, NUCLEAR LOCALIZATION SIGNAL, PHOSPHORYLATION AT THR-163, MUTAGENESIS OF ARG-158; PRO-159; ARG-160; ARG-161; ARG-162; THR-163; PHE-164; PRO-165; ARG-171; ARG-176; ARG-182 AND ARG-184.

Entry informationi

Entry nameiCDCA7_HUMAN
AccessioniPrimary (citable) accession number: Q9BWT1
Secondary accession number(s): B4DLP8
, B4DV66, Q53EW5, Q580W9, Q658K4, Q658N4, Q8NBY9, Q96BV8, Q96SP5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: September 5, 2006
Last sequence update: June 1, 2001
Last modified: July 6, 2016
This is version 115 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

CDCA7 expression is correlated with MYC expression in lymphoblastoid, lymphoma and breast cancer cell lines.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.