Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Collectin-11

Gene

COLEC11

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Lectin that binds to various sugars including fucose and mannose. Has a higher affinity for fucose compared to mannose. Does not bind to glucose, N-acetylglucosamine and N-acetylgalactosamine. Also binds lipopolysaccharides (LPS). Involved in fundamental development serving as a guidance cue for neural crest cell migration (By similarity).By similarity1 Publication

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Developmental protein

Keywords - Ligandi

Calcium, Lectin, Mannose-binding

Enzyme and pathway databases

ReactomeiR-HSA-3000480. Scavenging by Class A Receptors.

Names & Taxonomyi

Protein namesi
Recommended name:
Collectin-11
Alternative name(s):
Collectin kidney protein 1
Short name:
CL-K1
Gene namesi
Name:COLEC11
ORF Names:UNQ596/PRO1182
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:17213. COLEC11.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Secreted

Pathology & Biotechi

Involvement in diseasei

3MC syndrome 2 (3MC2)1 Publication
The disease is caused by mutations affecting the gene represented in this entry.
Disease descriptionA disorder characterized by facial dysmorphism that includes hypertelorism, blepharophimosis, blepharoptosis and highly arched eyebrows, cleft lip and/or palate, craniosynostosis, learning disability and genital, limb and vesicorenal anomalies. The term 3MC syndrome includes Carnevale, Mingarelli, Malpuech, and Michels syndromes.
See also OMIM:265050
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti169 – 1691S → P in 3MC2. 1 Publication
VAR_065901
Natural varianti204 – 2041G → S in 3MC2. 1 Publication
VAR_065902
Natural varianti217 – 2171Missing in 3MC2. 1 Publication
VAR_065903

Keywords - Diseasei

Disease mutation

Organism-specific databases

MalaCardsiCOLEC11.
MIMi265050. phenotype.
Orphaneti293843. Craniofacial-ulnar-renal syndrome.
PharmGKBiPA26737.

Polymorphism and mutation databases

BioMutaiCOLEC11.
DMDMi74733453.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525Sequence analysisAdd
BLAST
Chaini26 – 271246Collectin-11PRO_0000315044Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi170 ↔ 264PROSITE-ProRule annotation
Disulfide bondi242 ↔ 256PROSITE-ProRule annotation

Keywords - PTMi

Disulfide bond

Proteomic databases

PaxDbiQ9BWP8.
PRIDEiQ9BWP8.

PTM databases

PhosphoSiteiQ9BWP8.

Expressioni

Tissue specificityi

Ubiquitous.1 Publication

Gene expression databases

BgeeiQ9BWP8.
CleanExiHS_COLEC11.
ExpressionAtlasiQ9BWP8. baseline and differential.
GenevisibleiQ9BWP8. HS.

Organism-specific databases

HPAiHPA035241.

Interactioni

Protein-protein interaction databases

BioGridi122460. 12 interactions.
STRINGi9606.ENSP00000339168.

Structurei

Secondary structure

1
271
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Helixi117 – 14125Combined sources
Beta strandi150 – 16112Combined sources
Helixi163 – 17210Combined sources
Helixi183 – 19513Combined sources
Beta strandi199 – 2068Combined sources
Beta strandi208 – 2103Combined sources
Helixi236 – 2383Combined sources
Beta strandi242 – 2465Combined sources
Beta strandi251 – 2544Combined sources
Beta strandi260 – 2678Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4YLIX-ray2.45A/B/C/D/E/F116-270[»]
4YMDX-ray2.87A/B/C/D/E/F116-270[»]
ProteinModelPortaliQ9BWP8.
SMRiQ9BWP8. Positions 85-113, 116-270.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini65 – 11248Collagen-likeAdd
BLAST
Domaini149 – 265117C-type lectinPROSITE-ProRule annotationAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili114 – 14835Sequence analysisAdd
BLAST

Sequence similaritiesi

Belongs to the COLEC10/COLEC11 family.Curated
Contains 1 C-type lectin domain.PROSITE-ProRule annotation
Contains 1 collagen-like domain.Curated

Keywords - Domaini

Coiled coil, Collagen, Signal

Phylogenomic databases

eggNOGiENOG410IS48. Eukaryota.
ENOG4110NRD. LUCA.
GeneTreeiENSGT00700000104102.
HOGENOMiHOG000085660.
HOVERGENiHBG108270.
InParanoidiQ9BWP8.
KOiK10066.
OMAiDMGDKGQ.
OrthoDBiEOG7HXCVB.
PhylomeDBiQ9BWP8.
TreeFamiTF330481.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR018378. C-type_lectin_CS.
IPR016187. C-type_lectin_fold.
IPR008160. Collagen.
[Graphical view]
PfamiPF01391. Collagen. 2 hits.
PF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS00615. C_TYPE_LECTIN_1. 1 hit.
PS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]

Sequences (10)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 10 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BWP8-1) [UniParc]FASTAAdd to basket

Also known as: CL-K1-I

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRGNLALVGV LISLAFLSLL PSGHPQPAGD DACSVQILVP GLKGDAGEKG
60 70 80 90 100
DKGAPGRPGR VGPTGEKGDM GDKGQKGSVG RHGKIGPIGS KGEKGDSGDI
110 120 130 140 150
GPPGPNGEPG LPCECSQLRK AIGEMDNQVS QLTSELKFIK NAVAGVRETE
160 170 180 190 200
SKIYLLVKEE KRYADAQLSC QGRGGTLSMP KDEAANGLMA AYLAQAGLAR
210 220 230 240 250
VFIGINDLEK EGAFVYSDHS PMRTFNKWRS GEPNNAYDEE DCVEMVASGG
260 270
WNDVACHTTM YFMCEFDKEN M
Length:271
Mass (Da):28,665
Last modified:June 1, 2001 - v1
Checksum:iA14A248CE41DB340
GO
Isoform 2 (identifier: Q9BWP8-2) [UniParc]FASTAAdd to basket

Also known as: CL-K1-Ia

The sequence of this isoform differs from the canonical sequence as follows:
     43-66: Missing.

Show »
Length:247
Mass (Da):26,390
Checksum:i3883FC667BD5F2F3
GO
Isoform 3 (identifier: Q9BWP8-3) [UniParc]FASTAAdd to basket

Also known as: CL-K1-Ib

The sequence of this isoform differs from the canonical sequence as follows:
     67-90: Missing.

Show »
Length:247
Mass (Da):26,317
Checksum:i11BF243DE39E8C1B
GO
Isoform 4 (identifier: Q9BWP8-4) [UniParc]FASTAAdd to basket

Also known as: CL-K1-II

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLK → MWWVPPSPYGCLPCALP

Show »
Length:245
Mass (Da):26,213
Checksum:iEE07AA560B7E5432
GO
Isoform 5 (identifier: Q9BWP8-5) [UniParc]FASTAAdd to basket

Also known as: CL-K1-Ic

The sequence of this isoform differs from the canonical sequence as follows:
     43-90: Missing.

Show »
Length:223
Mass (Da):24,041
Checksum:i0701E755B9FCBE3F
GO
Isoform 6 (identifier: Q9BWP8-6) [UniParc]FASTAAdd to basket

Also known as: CL-K1-IIa

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: Missing.
     51-67: DKGAPGRPGRVGPTGEK → MWWVPPSPYGCLPCALP

Show »
Length:221
Mass (Da):23,938
Checksum:i06EC9291E8A41E01
GO
Isoform 7 (identifier: Q9BWP8-7) [UniParc]FASTAAdd to basket

Also known as: CL-K1-IIb

The sequence of this isoform differs from the canonical sequence as follows:
     1-43: MRGNLALVGVLISLAFLSLLPSGHPQPAGDDACSVQILVPGLK → MWWVPPSPYGCLPCALP
     67-90: Missing.

Show »
Length:221
Mass (Da):23,865
Checksum:i2FD04ACA70EF60E9
GO
Isoform 8 (identifier: Q9BWP8-8) [UniParc]FASTAAdd to basket

Also known as: CL-K1-IIc

The sequence of this isoform differs from the canonical sequence as follows:
     1-74: Missing.
     75-91: QKGSVGRHGKIGPIGSK → MWWVPPSPYGCLPCALP

Show »
Length:197
Mass (Da):21,589
Checksum:i6B47DE5D4E9D1CB6
GO
Isoform 9 (identifier: Q9BWP8-9) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-67: MRGNLALVGV...PGRVGPTGEK → MTPALCRSSS...TSSFVEMGSQ

Show »
Length:268
Mass (Da):29,006
Checksum:i30C30CC8258AA9B7
GO
Isoform 10 (identifier: Q9BWP8-10) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKKQRGVGVLPALRM

Note: No experimental confirmation available.
Show »
Length:285
Mass (Da):30,200
Checksum:i54B2EB71B4AAFE79
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti178 – 1781S → T in CAI56781 (PubMed:17974005).Curated
Sequence conflicti231 – 2311G → D in BAG64772 (PubMed:14702039).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti169 – 1691S → P in 3MC2. 1 Publication
VAR_065901
Natural varianti204 – 2041G → S in 3MC2. 1 Publication
VAR_065902
Natural varianti217 – 2171Missing in 3MC2. 1 Publication
VAR_065903
Natural varianti219 – 2191H → R.1 Publication
Corresponds to variant rs7567833 [ dbSNP | Ensembl ].
VAR_038143

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7474Missing in isoform 8. 1 PublicationVSP_030463Add
BLAST
Alternative sequencei1 – 6767MRGNL…PTGEK → MTPALCRSSSLASKGMRERR ETKAPPDGLEESAPREKKQS QPVVTASDISKRKCTSSFVE MGSQ in isoform 9. 1 PublicationVSP_030464Add
BLAST
Alternative sequencei1 – 5050Missing in isoform 6. 1 PublicationVSP_030465Add
BLAST
Alternative sequencei1 – 4343MRGNL…VPGLK → MWWVPPSPYGCLPCALP in isoform 4 and isoform 7. 1 PublicationVSP_030466Add
BLAST
Alternative sequencei1 – 11M → MKKQRGVGVLPALRM in isoform 10. 1 PublicationVSP_045532
Alternative sequencei43 – 9048Missing in isoform 5. 1 PublicationVSP_030467Add
BLAST
Alternative sequencei43 – 6624Missing in isoform 2. 1 PublicationVSP_030468Add
BLAST
Alternative sequencei51 – 6717DKGAP…PTGEK → MWWVPPSPYGCLPCALP in isoform 6. 1 PublicationVSP_030469Add
BLAST
Alternative sequencei67 – 9024Missing in isoform 3 and isoform 7. 2 PublicationsVSP_030470Add
BLAST
Alternative sequencei75 – 9117QKGSV…PIGSK → MWWVPPSPYGCLPCALP in isoform 8. 1 PublicationVSP_030471Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB119525 mRNA. Translation: BAF43301.1.
AB119650 mRNA. Translation: BAF43302.1.
AB119651 mRNA. Translation: BAF43303.1.
AB119652 mRNA. Translation: BAF43304.1.
AB119684 mRNA. Translation: BAF79604.1.
AB119685 mRNA. Translation: BAF79605.1.
AB119686 mRNA. Translation: BAF79606.1.
AB119687 mRNA. Translation: BAF79607.1.
AY358439 mRNA. Translation: AAQ88805.1.
AK303824 mRNA. Translation: BAG64772.1.
AK313840 mRNA. Translation: BAG36572.1.
AC010907 Genomic DNA. Translation: AAY24235.1.
CH471053 Genomic DNA. Translation: EAX01053.1.
CH471053 Genomic DNA. Translation: EAX01054.1.
CH471053 Genomic DNA. Translation: EAX01055.1.
BC000078 mRNA. Translation: AAH00078.1.
BC009951 mRNA. Translation: AAH09951.1.
CR936641 mRNA. Translation: CAI56781.1.
CCDSiCCDS1649.1. [Q9BWP8-1]
CCDS1650.1. [Q9BWP8-9]
CCDS58689.1. [Q9BWP8-10]
CCDS58690.1. [Q9BWP8-3]
CCDS58691.1. [Q9BWP8-4]
CCDS58692.1. [Q9BWP8-7]
CCDS58693.1. [Q9BWP8-6]
CCDS58694.1. [Q9BWP8-8]
RefSeqiNP_001242911.1. NM_001255982.1. [Q9BWP8-2]
NP_001242912.1. NM_001255983.1. [Q9BWP8-3]
NP_001242913.1. NM_001255984.1. [Q9BWP8-5]
NP_001242914.1. NM_001255985.1. [Q9BWP8-10]
NP_001242915.1. NM_001255986.1. [Q9BWP8-4]
NP_001242916.1. NM_001255987.1. [Q9BWP8-6]
NP_001242917.1. NM_001255988.1. [Q9BWP8-7]
NP_001242918.1. NM_001255989.1. [Q9BWP8-8]
NP_076932.1. NM_024027.4. [Q9BWP8-1]
NP_954705.1. NM_199235.2. [Q9BWP8-9]
UniGeneiHs.32603.
Hs.735715.

Genome annotation databases

EnsembliENST00000236693; ENSP00000236693; ENSG00000118004. [Q9BWP8-9]
ENST00000349077; ENSP00000339168; ENSG00000118004. [Q9BWP8-1]
ENST00000382062; ENSP00000371494; ENSG00000118004. [Q9BWP8-3]
ENST00000402794; ENSP00000384882; ENSG00000118004. [Q9BWP8-6]
ENST00000402922; ENSP00000385653; ENSG00000118004. [Q9BWP8-7]
ENST00000403096; ENSP00000385130; ENSG00000118004. [Q9BWP8-4]
ENST00000404205; ENSP00000385827; ENSG00000118004. [Q9BWP8-8]
ENST00000418971; ENSP00000411770; ENSG00000118004. [Q9BWP8-10]
GeneIDi78989.
KEGGihsa:78989.
UCSCiuc002qxz.5. human. [Q9BWP8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Web resourcesi

Functional Glycomics Gateway - Glycan Binding

Collectin K1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB119525 mRNA. Translation: BAF43301.1.
AB119650 mRNA. Translation: BAF43302.1.
AB119651 mRNA. Translation: BAF43303.1.
AB119652 mRNA. Translation: BAF43304.1.
AB119684 mRNA. Translation: BAF79604.1.
AB119685 mRNA. Translation: BAF79605.1.
AB119686 mRNA. Translation: BAF79606.1.
AB119687 mRNA. Translation: BAF79607.1.
AY358439 mRNA. Translation: AAQ88805.1.
AK303824 mRNA. Translation: BAG64772.1.
AK313840 mRNA. Translation: BAG36572.1.
AC010907 Genomic DNA. Translation: AAY24235.1.
CH471053 Genomic DNA. Translation: EAX01053.1.
CH471053 Genomic DNA. Translation: EAX01054.1.
CH471053 Genomic DNA. Translation: EAX01055.1.
BC000078 mRNA. Translation: AAH00078.1.
BC009951 mRNA. Translation: AAH09951.1.
CR936641 mRNA. Translation: CAI56781.1.
CCDSiCCDS1649.1. [Q9BWP8-1]
CCDS1650.1. [Q9BWP8-9]
CCDS58689.1. [Q9BWP8-10]
CCDS58690.1. [Q9BWP8-3]
CCDS58691.1. [Q9BWP8-4]
CCDS58692.1. [Q9BWP8-7]
CCDS58693.1. [Q9BWP8-6]
CCDS58694.1. [Q9BWP8-8]
RefSeqiNP_001242911.1. NM_001255982.1. [Q9BWP8-2]
NP_001242912.1. NM_001255983.1. [Q9BWP8-3]
NP_001242913.1. NM_001255984.1. [Q9BWP8-5]
NP_001242914.1. NM_001255985.1. [Q9BWP8-10]
NP_001242915.1. NM_001255986.1. [Q9BWP8-4]
NP_001242916.1. NM_001255987.1. [Q9BWP8-6]
NP_001242917.1. NM_001255988.1. [Q9BWP8-7]
NP_001242918.1. NM_001255989.1. [Q9BWP8-8]
NP_076932.1. NM_024027.4. [Q9BWP8-1]
NP_954705.1. NM_199235.2. [Q9BWP8-9]
UniGeneiHs.32603.
Hs.735715.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
4YLIX-ray2.45A/B/C/D/E/F116-270[»]
4YMDX-ray2.87A/B/C/D/E/F116-270[»]
ProteinModelPortaliQ9BWP8.
SMRiQ9BWP8. Positions 85-113, 116-270.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122460. 12 interactions.
STRINGi9606.ENSP00000339168.

PTM databases

PhosphoSiteiQ9BWP8.

Polymorphism and mutation databases

BioMutaiCOLEC11.
DMDMi74733453.

Proteomic databases

PaxDbiQ9BWP8.
PRIDEiQ9BWP8.

Protocols and materials databases

DNASUi78989.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000236693; ENSP00000236693; ENSG00000118004. [Q9BWP8-9]
ENST00000349077; ENSP00000339168; ENSG00000118004. [Q9BWP8-1]
ENST00000382062; ENSP00000371494; ENSG00000118004. [Q9BWP8-3]
ENST00000402794; ENSP00000384882; ENSG00000118004. [Q9BWP8-6]
ENST00000402922; ENSP00000385653; ENSG00000118004. [Q9BWP8-7]
ENST00000403096; ENSP00000385130; ENSG00000118004. [Q9BWP8-4]
ENST00000404205; ENSP00000385827; ENSG00000118004. [Q9BWP8-8]
ENST00000418971; ENSP00000411770; ENSG00000118004. [Q9BWP8-10]
GeneIDi78989.
KEGGihsa:78989.
UCSCiuc002qxz.5. human. [Q9BWP8-1]

Organism-specific databases

CTDi78989.
GeneCardsiCOLEC11.
HGNCiHGNC:17213. COLEC11.
HPAiHPA035241.
MalaCardsiCOLEC11.
MIMi265050. phenotype.
612502. gene.
neXtProtiNX_Q9BWP8.
Orphaneti293843. Craniofacial-ulnar-renal syndrome.
PharmGKBiPA26737.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IS48. Eukaryota.
ENOG4110NRD. LUCA.
GeneTreeiENSGT00700000104102.
HOGENOMiHOG000085660.
HOVERGENiHBG108270.
InParanoidiQ9BWP8.
KOiK10066.
OMAiDMGDKGQ.
OrthoDBiEOG7HXCVB.
PhylomeDBiQ9BWP8.
TreeFamiTF330481.

Enzyme and pathway databases

ReactomeiR-HSA-3000480. Scavenging by Class A Receptors.

Miscellaneous databases

ChiTaRSiCOLEC11. human.
GenomeRNAii78989.
NextBioi35535444.
PROiQ9BWP8.
SOURCEiSearch...

Gene expression databases

BgeeiQ9BWP8.
CleanExiHS_COLEC11.
ExpressionAtlasiQ9BWP8. baseline and differential.
GenevisibleiQ9BWP8. HS.

Family and domain databases

Gene3Di3.10.100.10. 1 hit.
InterProiIPR001304. C-type_lectin.
IPR016186. C-type_lectin-like.
IPR018378. C-type_lectin_CS.
IPR016187. C-type_lectin_fold.
IPR008160. Collagen.
[Graphical view]
PfamiPF01391. Collagen. 2 hits.
PF00059. Lectin_C. 1 hit.
[Graphical view]
SMARTiSM00034. CLECT. 1 hit.
[Graphical view]
SUPFAMiSSF56436. SSF56436. 1 hit.
PROSITEiPS00615. C_TYPE_LECTIN_1. 1 hit.
PS50041. C_TYPE_LECTIN_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1; 2; 3; 4; 5; 6; 7 AND 8), FUNCTION, TISSUE SPECIFICITY.
    Tissue: Kidney.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 10), VARIANT ARG-219.
    Tissue: Lung and Ovary.
  4. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 9).
    Tissue: Neuroblastoma.
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 26-271 (ISOFORM 3).
    Tissue: Endometrium.
  8. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.
  10. Cited for: VARIANTS 3MC2 PRO-169; SER-204 AND SER-217 DEL.

Entry informationi

Entry nameiCOL11_HUMAN
AccessioniPrimary (citable) accession number: Q9BWP8
Secondary accession number(s): A1IGE4
, A1IGE5, A1IGE6, A7VJJ2, A7VJJ3, A7VJJ4, A7VJJ5, B2R9M5, B4E1G0, J3KQY9, Q5CZ85, Q7Z6N1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 15, 2008
Last sequence update: June 1, 2001
Last modified: May 11, 2016
This is version 134 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.