Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Modulator of retrovirus infection homolog

Gene

MRI

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 3 out of 5-Experimental evidence at protein leveli

Functioni

May act as a regulator of proteasome.By similarity

Names & Taxonomyi

Protein namesi
Recommended name:
Modulator of retrovirus infection homolog
Gene namesi
Name:MRI
Synonyms:C7orf49
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:22432. C7orf49.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162380533.

Polymorphism and mutation databases

BioMutaiMRI.
DMDMi182676205.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 157157Modulator of retrovirus infection homologPRO_0000320948Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionineCombined sources

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9BWK5.
MaxQBiQ9BWK5.
PaxDbiQ9BWK5.
PRIDEiQ9BWK5.

Expressioni

Gene expression databases

BgeeiQ9BWK5.
CleanExiHS_C7orf49.
ExpressionAtlasiQ9BWK5. baseline and differential.
GenevisibleiQ9BWK5. HS.

Organism-specific databases

HPAiHPA020060.

Interactioni

Binary interactionsi

WithEntry#Exp.IntActNotes
ERCC6L2H7BXQ93EBI-8787584,EBI-10300946

Protein-protein interaction databases

BioGridi122467. 1 interaction.
IntActiQ9BWK5. 2 interactions.
STRINGi9606.ENSP00000376823.

Structurei

3D structure databases

ProteinModelPortaliQ9BWK5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410J164. Eukaryota.
ENOG4111BHE. LUCA.
GeneTreeiENSGT00390000013192.
HOGENOMiHOG000113652.
HOVERGENiHBG108145.
InParanoidiQ9BWK5.
OMAiRTVYCMN.
OrthoDBiEOG70S77V.
PhylomeDBiQ9BWK5.
TreeFamiTF336925.

Family and domain databases

InterProiIPR028278. MRI.
[Graphical view]
PANTHERiPTHR14566. PTHR14566. 1 hit.
PfamiPF15325. MRI. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BWK5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
METLQSETKT RVLPSWLTAQ VATKNVAPMK APKRMRMAAV PVAAARLPAT
60 70 80 90 100
RTVYCMNEAE IVDVALGILI ESRKQEKACE QPALAGADNP EHSPPCSVSP
110 120 130 140 150
HTSSGSSSEE EDSGKQALAP GLSPSQRPGG SSSACSRSPE EEEEEDVLKY

VREIFFS
Length:157
Mass (Da):16,829
Last modified:February 26, 2008 - v2
Checksum:iEA52CB3CCD231B74
GO
Isoform 2 (identifier: Q9BWK5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: METLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAA → MRLESLCHLCLACLFF

Note: No experimental confirmation available.
Show »
Length:128
Mass (Da):13,846
Checksum:i4F043DF622743C67
GO
Isoform 3 (identifier: Q9BWK5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: Missing.

Show »
Length:102
Mass (Da):10,804
Checksum:i7D64A9733BB43204
GO

Sequence cautioni

The sequence AAH00168.1 differs from that shown. Reason: Erroneous initiation. Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti82 – 821P → L in a colorectal cancer sample; somatic mutation. 1 Publication
VAR_039320

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 5555Missing in isoform 3. 1 PublicationVSP_031767Add
BLAST
Alternative sequencei1 – 4545METLQ…PVAAA → MRLESLCHLCLACLFF in isoform 2. 1 PublicationVSP_031768Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK130795 mRNA. Translation: BAC85431.1.
AC083862 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24064.1.
BC000168 mRNA. Translation: AAH00168.1. Different initiation.
BC067350 mRNA. Translation: AAH67350.1.
CCDSiCCDS5838.2. [Q9BWK5-1]
CCDS59082.1. [Q9BWK5-3]
RefSeqiNP_001230678.1. NM_001243749.1.
NP_001230680.1. NM_001243751.1.
NP_001230681.1. NM_001243752.1.
NP_001230682.1. NM_001243753.1.
NP_001230683.1. NM_001243754.1. [Q9BWK5-3]
NP_001230684.1. NM_001243755.1. [Q9BWK5-3]
NP_001292558.1. NM_001305629.1.
NP_076938.2. NM_024033.3. [Q9BWK5-1]
UniGeneiHs.643113.
Hs.725212.
Hs.732134.
Hs.742852.
Hs.744954.

Genome annotation databases

EnsembliENST00000393114; ENSP00000376823; ENSG00000122783. [Q9BWK5-1]
ENST00000424142; ENSP00000400024; ENSG00000122783. [Q9BWK5-3]
ENST00000483029; ENSP00000473365; ENSG00000122783. [Q9BWK5-3]
ENST00000620897; ENSP00000481014; ENSG00000122783. [Q9BWK5-3]
GeneIDi78996.
KEGGihsa:78996.
UCSCiuc003vsl.4. human. [Q9BWK5-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK130795 mRNA. Translation: BAC85431.1.
AC083862 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24064.1.
BC000168 mRNA. Translation: AAH00168.1. Different initiation.
BC067350 mRNA. Translation: AAH67350.1.
CCDSiCCDS5838.2. [Q9BWK5-1]
CCDS59082.1. [Q9BWK5-3]
RefSeqiNP_001230678.1. NM_001243749.1.
NP_001230680.1. NM_001243751.1.
NP_001230681.1. NM_001243752.1.
NP_001230682.1. NM_001243753.1.
NP_001230683.1. NM_001243754.1. [Q9BWK5-3]
NP_001230684.1. NM_001243755.1. [Q9BWK5-3]
NP_001292558.1. NM_001305629.1.
NP_076938.2. NM_024033.3. [Q9BWK5-1]
UniGeneiHs.643113.
Hs.725212.
Hs.732134.
Hs.742852.
Hs.744954.

3D structure databases

ProteinModelPortaliQ9BWK5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122467. 1 interaction.
IntActiQ9BWK5. 2 interactions.
STRINGi9606.ENSP00000376823.

Polymorphism and mutation databases

BioMutaiMRI.
DMDMi182676205.

Proteomic databases

EPDiQ9BWK5.
MaxQBiQ9BWK5.
PaxDbiQ9BWK5.
PRIDEiQ9BWK5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000393114; ENSP00000376823; ENSG00000122783. [Q9BWK5-1]
ENST00000424142; ENSP00000400024; ENSG00000122783. [Q9BWK5-3]
ENST00000483029; ENSP00000473365; ENSG00000122783. [Q9BWK5-3]
ENST00000620897; ENSP00000481014; ENSG00000122783. [Q9BWK5-3]
GeneIDi78996.
KEGGihsa:78996.
UCSCiuc003vsl.4. human. [Q9BWK5-1]

Organism-specific databases

CTDi78996.
GeneCardsiC7orf49.
H-InvDBHIX0007109.
HGNCiHGNC:22432. C7orf49.
HPAiHPA020060.
neXtProtiNX_Q9BWK5.
PharmGKBiPA162380533.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J164. Eukaryota.
ENOG4111BHE. LUCA.
GeneTreeiENSGT00390000013192.
HOGENOMiHOG000113652.
HOVERGENiHBG108145.
InParanoidiQ9BWK5.
OMAiRTVYCMN.
OrthoDBiEOG70S77V.
PhylomeDBiQ9BWK5.
TreeFamiTF336925.

Miscellaneous databases

ChiTaRSiC7orf49. human.
GenomeRNAii78996.
NextBioi67595.
PROiQ9BWK5.

Gene expression databases

BgeeiQ9BWK5.
CleanExiHS_C7orf49.
ExpressionAtlasiQ9BWK5. baseline and differential.
GenevisibleiQ9BWK5. HS.

Family and domain databases

InterProiIPR028278. MRI.
[Graphical view]
PANTHERiPTHR14566. PTHR14566. 1 hit.
PfamiPF15325. MRI. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Thymus.
  2. "Human chromosome 7: DNA sequence and biology."
    Scherer S.W., Cheung J., MacDonald J.R., Osborne L.R., Nakabayashi K., Herbrick J.-A., Carson A.R., Parker-Katiraee L., Skaug J., Khaja R., Zhang J., Hudek A.K., Li M., Haddad M., Duggan G.E., Fernandez B.A., Kanematsu E., Gentles S.
    , Christopoulos C.C., Choufani S., Kwasnicka D., Zheng X.H., Lai Z., Nusskern D.R., Zhang Q., Gu Z., Lu F., Zeesman S., Nowaczyk M.J., Teshima I., Chitayat D., Shuman C., Weksberg R., Zackai E.H., Grebe T.A., Cox S.R., Kirkpatrick S.J., Rahman N., Friedman J.M., Heng H.H.Q., Pelicci P.G., Lo-Coco F., Belloni E., Shaffer L.G., Pober B., Morton C.C., Gusella J.F., Bruns G.A.P., Korf B.R., Quade B.J., Ligon A.H., Ferguson H., Higgins A.W., Leach N.T., Herrick S.R., Lemyre E., Farra C.G., Kim H.-G., Summers A.M., Gripp K.W., Roberts W., Szatmari P., Winsor E.J.T., Grzeschik K.-H., Teebi A., Minassian B.A., Kere J., Armengol L., Pujana M.A., Estivill X., Wilson M.D., Koop B.F., Tosi S., Moore G.E., Boright A.P., Zlotorynski E., Kerem B., Kroisel P.M., Petek E., Oscier D.G., Mould S.J., Doehner H., Doehner K., Rommens J.M., Vincent J.B., Venter J.C., Li P.W., Mural R.J., Adams M.D., Tsui L.-C.
    Science 300:767-772(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3).
    Tissue: Mammary gland and Placenta.
  4. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  5. Cited for: VARIANT [LARGE SCALE ANALYSIS] LEU-82.

Entry informationi

Entry nameiMRI_HUMAN
AccessioniPrimary (citable) accession number: Q9BWK5
Secondary accession number(s): Q6NWZ4, Q6ZNR5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: March 16, 2016
This is version 101 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.