Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Cell cycle regulator of non-homologous end joining

Gene

CYREN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Isoform 1: Cell-cycle-specific inhibitor of classical non-homologous end joining (NHEJ) of DNA double-strand break (DSB) repair during the S and G2 phases (PubMed:28959974). Acts as a regulator of DNA repair pathway choice by specifically inhibiting classical NHEJ during the S and G2 phases, thereby promoting error-free repair by homologous recombination during cell cycle phases when sister chromatids are present (PubMed:28959974). Preferentially protects single-stranded overhangs at break sites by inhibiting classical NHEJ, thereby creating a local environment that favors homologous recombination (PubMed:28959974). Acts via interaction with XRCC5/Ku80 and XRCC6/Ku70, interaction restricted during the S and G2 phases only (PubMed:28959974). Molecular mechanisms governing classical NHEJ inhibition via interaction with XRCC5/Ku80 and XRCC6/Ku70 are unknown (PubMed:28959974). May act as a regulator of proteasome (By similarity).By similarity1 Publication
Isoform 4: Cell-cycle-specific inhibitor of classical non-homologous end joining (NHEJ) of DNA double-strand break (DSB) repair during the S and G2 phases (PubMed:24610814, PubMed:28959974). Acts as a regulator of DNA repair pathway choice by specifically inhibiting classical NHEJ during the S and G2 phases, thereby promoting error-free repair by homologous recombination during cell cycle phases when sister chromatids are present (PubMed:28959974). Preferentially protects single-stranded overhangs at break sites by inhibiting classical NHEJ, thereby creating a local environment that favors homologous recombination (PubMed:28959974). Acts via interaction with XRCC5/Ku80 and XRCC6/Ku70, interaction restricted during the S and G2 phases only (PubMed:28959974). Molecular mechanisms governing classical NHEJ inhibition via interaction with XRCC5/Ku80 and XRCC6/Ku70 are unknown (PubMed:28959974).2 Publications

GO - Biological processi

  • double-strand break repair via nonhomologous end joining Source: UniProtKB
  • negative regulation of double-strand break repair via nonhomologous end joining Source: UniProtKB

Keywordsi

Biological processDNA damage, DNA repair

Names & Taxonomyi

Protein namesi
Recommended name:
Cell cycle regulator of non-homologous end joining1 Publication
Short name:
Cell cycle regulator of NHEJ1 Publication
Alternative name(s):
Modulator of retrovirus infection homologBy similarity
Gene namesi
Name:CYREN1 Publication
Synonyms:C7orf49Imported, MRIBy similarity
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

EuPathDBiHostDB:ENSG00000122783.16.
HGNCiHGNC:22432. C7orf49.
MIMi616980. gene.
neXtProtiNX_Q9BWK5.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi11R → A: Abolishes interaction with XRCC5/Ku80 and XRCC6/Ku70 and ability to inhibit classical non-homologous end joining (NHEJ). 1 Publication1
Mutagenesisi14P → A: Abolishes interaction with XRCC5/Ku80 and XRCC6/Ku70 and ability to inhibit classical non-homologous end joining (NHEJ). 1 Publication1
Mutagenesisi16W → A: Abolishes interaction with XRCC5/Ku80 and XRCC6/Ku70 and ability to inhibit classical non-homologous end joining (NHEJ). 1 Publication1

Organism-specific databases

DisGeNETi78996.
OpenTargetsiENSG00000122783.
PharmGKBiPA162380533.

Polymorphism and mutation databases

BioMutaiMRI.
DMDMi182676205.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003209481 – 157Cell cycle regulator of non-homologous end joiningAdd BLAST157

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9BWK5.
MaxQBiQ9BWK5.
PaxDbiQ9BWK5.
PeptideAtlasiQ9BWK5.
PRIDEiQ9BWK5.

PTM databases

iPTMnetiQ9BWK5.
PhosphoSitePlusiQ9BWK5.

Expressioni

Gene expression databases

BgeeiENSG00000122783.
CleanExiHS_C7orf49.
ExpressionAtlasiQ9BWK5. baseline and differential.
GenevisibleiQ9BWK5. HS.

Organism-specific databases

HPAiHPA020060.

Interactioni

Subunit structurei

Isoform 1: Interacts (via KBM motif) with XRCC5/Ku80 and XRCC6/Ku70 heterodimer; interaction is restricted during the S and G2 phases (PubMed:24610814, PubMed:28959974). Isoform 4: Interacts (via KBM motif) with XRCC5/Ku80 and XRCC6/Ku70 heterodimer; interaction is restricted during the S and G2 phases (PubMed:24610814, PubMed:28959974). Isoform 3: Does not interact with XRCC5/Ku80 and XRCC6/Ku70 heterodimer (PubMed:24610814).2 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
ERCC6L2H7BXQ93EBI-8787584,EBI-10300946

Protein-protein interaction databases

BioGridi122467. 1 interactor.
IntActiQ9BWK5. 4 interactors.
STRINGi9606.ENSP00000376823.

Structurei

3D structure databases

ProteinModelPortaliQ9BWK5.
SMRiQ9BWK5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Motif

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Motifi1 – 21KBM1 PublicationAdd BLAST21

Domaini

The KBM (Ku-binding motif) mediates interaction with XRCC5/Ku80 and XRCC6/Ku70.1 Publication

Phylogenomic databases

eggNOGiENOG410J164. Eukaryota.
ENOG4111BHE. LUCA.
GeneTreeiENSGT00390000013192.
HOGENOMiHOG000113652.
HOVERGENiHBG108145.
InParanoidiQ9BWK5.
OMAiRTVYCMN.
OrthoDBiEOG091G0UN3.
PhylomeDBiQ9BWK5.
TreeFamiTF336925.

Family and domain databases

InterProiView protein in InterPro
IPR028278. MRI.
PANTHERiPTHR14566. PTHR14566. 1 hit.
PfamiView protein in Pfam
PF15325. MRI. 1 hit.

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BWK5-1) [UniParc]FASTAAdd to basket
Also known as: CYREN-11 Publication, MRI-11 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
METLQSETKT RVLPSWLTAQ VATKNVAPMK APKRMRMAAV PVAAARLPAT
60 70 80 90 100
RTVYCMNEAE IVDVALGILI ESRKQEKACE QPALAGADNP EHSPPCSVSP
110 120 130 140 150
HTSSGSSSEE EDSGKQALAP GLSPSQRPGG SSSACSRSPE EEEEEDVLKY

VREIFFS
Length:157
Mass (Da):16,829
Last modified:February 26, 2008 - v2
Checksum:iEA52CB3CCD231B74
GO
Isoform 2 (identifier: Q9BWK5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: METLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAA → MRLESLCHLCLACLFF

Note: No experimental confirmation available.
Show »
Length:128
Mass (Da):13,846
Checksum:i4F043DF622743C67
GO
Isoform 3 (identifier: Q9BWK5-3) [UniParc]FASTAAdd to basket
Also known as: CYREN-31 Publication, MRI-31 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: Missing.

Show »
Length:102
Mass (Da):10,804
Checksum:i7D64A9733BB43204
GO
Isoform 4 (identifier: Q9BWK5-4) [UniParc]FASTAAdd to basket
Also known as: CYREN-21 Publication, MRI-21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     47-69: LPATRTVYCMNEAEIVDVALGIL → CDSSGQKTPANLTPCDKDCVLHE
     70-157: Missing.

Show »
Length:69
Mass (Da):7,482
Checksum:i582A4325901CF300
GO

Sequence cautioni

The sequence AAH00168 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03932082P → L in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs776124276Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0317671 – 55Missing in isoform 3. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_0317681 – 45METLQ…PVAAA → MRLESLCHLCLACLFF in isoform 2. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_05852447 – 69LPATR…ALGIL → CDSSGQKTPANLTPCDKDCV LHE in isoform 4. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_05852570 – 157Missing in isoform 4. 1 PublicationAdd BLAST88

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026103 mRNA. No translation available.
AK130795 mRNA. Translation: BAC85431.1.
AC083862 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24064.1.
CH471070 Genomic DNA. Translation: EAW83840.1.
CH471070 Genomic DNA. Translation: EAW83841.1.
BC000168 mRNA. Translation: AAH00168.1. Different initiation.
BC067350 mRNA. Translation: AAH67350.1.
CCDSiCCDS5838.2. [Q9BWK5-1]
CCDS59082.1. [Q9BWK5-3]
CCDS75663.1. [Q9BWK5-4]
RefSeqiNP_001230678.1. NM_001243749.1. [Q9BWK5-4]
NP_001230680.1. NM_001243751.1. [Q9BWK5-4]
NP_001230681.1. NM_001243752.1. [Q9BWK5-4]
NP_001230682.1. NM_001243753.1. [Q9BWK5-4]
NP_001230683.1. NM_001243754.1. [Q9BWK5-3]
NP_001230684.1. NM_001243755.1. [Q9BWK5-3]
NP_001292558.1. NM_001305629.1.
NP_076938.2. NM_024033.3. [Q9BWK5-1]
XP_016868078.1. XM_017012589.1. [Q9BWK5-1]
XP_016868079.1. XM_017012590.1. [Q9BWK5-1]
XP_016868080.1. XM_017012591.1. [Q9BWK5-1]
XP_016868082.1. XM_017012593.1. [Q9BWK5-3]
XP_016868083.1. XM_017012594.1. [Q9BWK5-3]
XP_016868084.1. XM_017012595.1. [Q9BWK5-4]
UniGeneiHs.643113.
Hs.725212.
Hs.732134.
Hs.742852.
Hs.744954.

Genome annotation databases

EnsembliENST00000393114; ENSP00000376823; ENSG00000122783. [Q9BWK5-1]
ENST00000424142; ENSP00000400024; ENSG00000122783. [Q9BWK5-3]
ENST00000483029; ENSP00000473365; ENSG00000122783. [Q9BWK5-3]
ENST00000617987; ENSP00000480430; ENSG00000122783. [Q9BWK5-4]
ENST00000620897; ENSP00000481014; ENSG00000122783. [Q9BWK5-3]
GeneIDi78996.
KEGGihsa:78996.
UCSCiuc003vsl.4. human. [Q9BWK5-1]
uc022amb.2. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiCYREN_HUMAN
AccessioniPrimary (citable) accession number: Q9BWK5
Secondary accession number(s): A0A024R780
, A0A087WWQ8, Q6NWZ4, Q6ZNR5
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: January 31, 2018
This is version 113 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Caution

Was initially reported to stimulate non-homologous end joining in vitro (PubMed:24610814). This result was not confirmed by another group (PubMed:28959974). The difference was possibly due to the consequences of oversaturating the reaction with recombinant protein in vitro (PubMed:28959974).2 Publications

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome