Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Modulator of retrovirus infection homolog

Gene

MRI

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

May participate in the non-homologous end joining pathway of DNA double-strand break (DSB) repair (PubMed:24610814). May act as a regulator of proteasome (By similarity).By similarity1 Publication

GO - Biological processi

  • double-strand break repair via nonhomologous end joining Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

DNA damage, DNA repair

Enzyme and pathway databases

BioCyciZFISH:ENSG00000122783-MONOMER.

Names & Taxonomyi

Protein namesi
Recommended name:
Modulator of retrovirus infection homolog
Gene namesi
Name:MRI
Synonyms:C7orf49
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:22432. C7orf49.

Subcellular locationi

Isoform 1 :
Isoform 3 :
Isoform 4 :

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • nucleus Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi78996.
OpenTargetsiENSG00000122783.
PharmGKBiPA162380533.

Polymorphism and mutation databases

BioMutaiMRI.
DMDMi182676205.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003209481 – 157Modulator of retrovirus infection homologAdd BLAST157

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei1N-acetylmethionineCombined sources1

Keywords - PTMi

Acetylation

Proteomic databases

EPDiQ9BWK5.
MaxQBiQ9BWK5.
PaxDbiQ9BWK5.
PeptideAtlasiQ9BWK5.
PRIDEiQ9BWK5.

PTM databases

iPTMnetiQ9BWK5.
PhosphoSitePlusiQ9BWK5.

Expressioni

Gene expression databases

BgeeiENSG00000122783.
CleanExiHS_C7orf49.
ExpressionAtlasiQ9BWK5. baseline and differential.
GenevisibleiQ9BWK5. HS.

Organism-specific databases

HPAiHPA020060.

Interactioni

Subunit structurei

Both isoform 1 and isoform 4, but not isoform 3, interact with XRCC5/Ku80 and XRCC6/Ku70 heterodimer.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ERCC6L2H7BXQ95EBI-8787584,EBI-10300946

Protein-protein interaction databases

BioGridi122467. 1 interactor.
IntActiQ9BWK5. 3 interactors.
STRINGi9606.ENSP00000376823.

Structurei

3D structure databases

ProteinModelPortaliQ9BWK5.
SMRiQ9BWK5.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410J164. Eukaryota.
ENOG4111BHE. LUCA.
GeneTreeiENSGT00390000013192.
HOGENOMiHOG000113652.
HOVERGENiHBG108145.
InParanoidiQ9BWK5.
OMAiRTVYCMN.
OrthoDBiEOG091G0UN3.
PhylomeDBiQ9BWK5.
TreeFamiTF336925.

Family and domain databases

InterProiIPR028278. MRI.
[Graphical view]
PANTHERiPTHR14566. PTHR14566. 1 hit.
PfamiPF15325. MRI. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BWK5-1) [UniParc]FASTAAdd to basket
Also known as: MRI-11 Publication

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
METLQSETKT RVLPSWLTAQ VATKNVAPMK APKRMRMAAV PVAAARLPAT
60 70 80 90 100
RTVYCMNEAE IVDVALGILI ESRKQEKACE QPALAGADNP EHSPPCSVSP
110 120 130 140 150
HTSSGSSSEE EDSGKQALAP GLSPSQRPGG SSSACSRSPE EEEEEDVLKY

VREIFFS
Length:157
Mass (Da):16,829
Last modified:February 26, 2008 - v2
Checksum:iEA52CB3CCD231B74
GO
Isoform 2 (identifier: Q9BWK5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-45: METLQSETKTRVLPSWLTAQVATKNVAPMKAPKRMRMAAVPVAAA → MRLESLCHLCLACLFF

Note: No experimental confirmation available.
Show »
Length:128
Mass (Da):13,846
Checksum:i4F043DF622743C67
GO
Isoform 3 (identifier: Q9BWK5-3) [UniParc]FASTAAdd to basket
Also known as: MRI-31 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     1-55: Missing.

Show »
Length:102
Mass (Da):10,804
Checksum:i7D64A9733BB43204
GO
Isoform 4 (identifier: Q9BWK5-4) [UniParc]FASTAAdd to basket
Also known as: MRI-21 Publication

The sequence of this isoform differs from the canonical sequence as follows:
     47-69: LPATRTVYCMNEAEIVDVALGIL → CDSSGQKTPANLTPCDKDCVLHE
     70-157: Missing.

Show »
Length:69
Mass (Da):7,482
Checksum:i582A4325901CF300
GO

Sequence cautioni

The sequence AAH00168 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03932082P → L in a colorectal cancer sample; somatic mutation. 1 PublicationCorresponds to variant rs776124276dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0317671 – 55Missing in isoform 3. 1 PublicationAdd BLAST55
Alternative sequenceiVSP_0317681 – 45METLQ…PVAAA → MRLESLCHLCLACLFF in isoform 2. 1 PublicationAdd BLAST45
Alternative sequenceiVSP_05852447 – 69LPATR…ALGIL → CDSSGQKTPANLTPCDKDCV LHE in isoform 4. 1 PublicationAdd BLAST23
Alternative sequenceiVSP_05852570 – 157Missing in isoform 4. 1 PublicationAdd BLAST88

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026103 mRNA. No translation available.
AK130795 mRNA. Translation: BAC85431.1.
AC083862 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24064.1.
CH471070 Genomic DNA. Translation: EAW83840.1.
CH471070 Genomic DNA. Translation: EAW83841.1.
BC000168 mRNA. Translation: AAH00168.1. Different initiation.
BC067350 mRNA. Translation: AAH67350.1.
CCDSiCCDS5838.2. [Q9BWK5-1]
CCDS59082.1. [Q9BWK5-3]
CCDS75663.1. [Q9BWK5-4]
RefSeqiNP_001230678.1. NM_001243749.1. [Q9BWK5-4]
NP_001230680.1. NM_001243751.1. [Q9BWK5-4]
NP_001230681.1. NM_001243752.1. [Q9BWK5-4]
NP_001230682.1. NM_001243753.1. [Q9BWK5-4]
NP_001230683.1. NM_001243754.1. [Q9BWK5-3]
NP_001230684.1. NM_001243755.1. [Q9BWK5-3]
NP_001292558.1. NM_001305629.1.
NP_076938.2. NM_024033.3. [Q9BWK5-1]
XP_016868078.1. XM_017012589.1. [Q9BWK5-1]
XP_016868079.1. XM_017012590.1. [Q9BWK5-1]
XP_016868080.1. XM_017012591.1. [Q9BWK5-1]
XP_016868082.1. XM_017012593.1. [Q9BWK5-3]
XP_016868083.1. XM_017012594.1. [Q9BWK5-3]
XP_016868084.1. XM_017012595.1. [Q9BWK5-4]
UniGeneiHs.643113.
Hs.725212.
Hs.732134.
Hs.742852.
Hs.744954.

Genome annotation databases

EnsembliENST00000393114; ENSP00000376823; ENSG00000122783. [Q9BWK5-1]
ENST00000424142; ENSP00000400024; ENSG00000122783. [Q9BWK5-3]
ENST00000483029; ENSP00000473365; ENSG00000122783. [Q9BWK5-3]
ENST00000617987; ENSP00000480430; ENSG00000122783. [Q9BWK5-4]
ENST00000620897; ENSP00000481014; ENSG00000122783. [Q9BWK5-3]
GeneIDi78996.
KEGGihsa:78996.
UCSCiuc003vsl.4. human. [Q9BWK5-1]
uc022amb.2. human.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK026103 mRNA. No translation available.
AK130795 mRNA. Translation: BAC85431.1.
AC083862 Genomic DNA. No translation available.
CH236950 Genomic DNA. Translation: EAL24064.1.
CH471070 Genomic DNA. Translation: EAW83840.1.
CH471070 Genomic DNA. Translation: EAW83841.1.
BC000168 mRNA. Translation: AAH00168.1. Different initiation.
BC067350 mRNA. Translation: AAH67350.1.
CCDSiCCDS5838.2. [Q9BWK5-1]
CCDS59082.1. [Q9BWK5-3]
CCDS75663.1. [Q9BWK5-4]
RefSeqiNP_001230678.1. NM_001243749.1. [Q9BWK5-4]
NP_001230680.1. NM_001243751.1. [Q9BWK5-4]
NP_001230681.1. NM_001243752.1. [Q9BWK5-4]
NP_001230682.1. NM_001243753.1. [Q9BWK5-4]
NP_001230683.1. NM_001243754.1. [Q9BWK5-3]
NP_001230684.1. NM_001243755.1. [Q9BWK5-3]
NP_001292558.1. NM_001305629.1.
NP_076938.2. NM_024033.3. [Q9BWK5-1]
XP_016868078.1. XM_017012589.1. [Q9BWK5-1]
XP_016868079.1. XM_017012590.1. [Q9BWK5-1]
XP_016868080.1. XM_017012591.1. [Q9BWK5-1]
XP_016868082.1. XM_017012593.1. [Q9BWK5-3]
XP_016868083.1. XM_017012594.1. [Q9BWK5-3]
XP_016868084.1. XM_017012595.1. [Q9BWK5-4]
UniGeneiHs.643113.
Hs.725212.
Hs.732134.
Hs.742852.
Hs.744954.

3D structure databases

ProteinModelPortaliQ9BWK5.
SMRiQ9BWK5.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122467. 1 interactor.
IntActiQ9BWK5. 3 interactors.
STRINGi9606.ENSP00000376823.

PTM databases

iPTMnetiQ9BWK5.
PhosphoSitePlusiQ9BWK5.

Polymorphism and mutation databases

BioMutaiMRI.
DMDMi182676205.

Proteomic databases

EPDiQ9BWK5.
MaxQBiQ9BWK5.
PaxDbiQ9BWK5.
PeptideAtlasiQ9BWK5.
PRIDEiQ9BWK5.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000393114; ENSP00000376823; ENSG00000122783. [Q9BWK5-1]
ENST00000424142; ENSP00000400024; ENSG00000122783. [Q9BWK5-3]
ENST00000483029; ENSP00000473365; ENSG00000122783. [Q9BWK5-3]
ENST00000617987; ENSP00000480430; ENSG00000122783. [Q9BWK5-4]
ENST00000620897; ENSP00000481014; ENSG00000122783. [Q9BWK5-3]
GeneIDi78996.
KEGGihsa:78996.
UCSCiuc003vsl.4. human. [Q9BWK5-1]
uc022amb.2. human.

Organism-specific databases

CTDi78996.
DisGeNETi78996.
GeneCardsiC7orf49.
H-InvDBHIX0007109.
HGNCiHGNC:22432. C7orf49.
HPAiHPA020060.
MIMi616980. gene.
neXtProtiNX_Q9BWK5.
OpenTargetsiENSG00000122783.
PharmGKBiPA162380533.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410J164. Eukaryota.
ENOG4111BHE. LUCA.
GeneTreeiENSGT00390000013192.
HOGENOMiHOG000113652.
HOVERGENiHBG108145.
InParanoidiQ9BWK5.
OMAiRTVYCMN.
OrthoDBiEOG091G0UN3.
PhylomeDBiQ9BWK5.
TreeFamiTF336925.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000122783-MONOMER.

Miscellaneous databases

ChiTaRSiC7orf49. human.
GenomeRNAii78996.
PROiQ9BWK5.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000122783.
CleanExiHS_C7orf49.
ExpressionAtlasiQ9BWK5. baseline and differential.
GenevisibleiQ9BWK5. HS.

Family and domain databases

InterProiIPR028278. MRI.
[Graphical view]
PANTHERiPTHR14566. PTHR14566. 1 hit.
PfamiPF15325. MRI. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiMRI_HUMAN
AccessioniPrimary (citable) accession number: Q9BWK5
Secondary accession number(s): A0A024R780
, A0A087WWQ8, Q6NWZ4, Q6ZNR5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 26, 2008
Last sequence update: February 26, 2008
Last modified: November 30, 2016
This is version 107 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.