Q9BWF3 (RBM4_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 114.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: RNA-binding protein 4 Alternative name(s): Lark homolog Short name=hLark RNA-binding motif protein 4 RNA-binding motif protein 4a | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 364 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | RNA-binding factor involved in multiple aspects of cellular processes like alternative splicing of pre-mRNA and translation regulation. Modulates alternative 5'-splice site and exon selection. Acts as a muscle cell differentiation-promoting factor. Activates exon skipping of the PTB pre-mRNA during muscle cell differentiation. Antagonizes the activity of the splicing factor PTBP1 to modulate muscle cell-specific exon selection of alpha tropomyosin. Binds to intronic pyrimidine-rich sequence of the TPM1 and MAPT pre-mRNAs. Required for the translational activation of PER1 mRNA in response to circadian clock. Binds directly to the 3'-UTR of the PER1 mRNA. Exerts a suppressive activity on Cap-dependent translation via binding to CU-rich responsive elements within the 3'UTR of mRNAs, a process increased under stress conditions or during myocytes differentiation. Recruits EIF4A1 to stimulate IRES-dependent translation initiation in respons to cellular stress. Associates to internal ribosome entry segment (IRES) in target mRNA species under stress conditions. Plays a role for miRNA-guided RNA cleavage and translation suppression by promoting association of EIF2C2-containing miRNPs with their cognate target mRNAs. Associates with miRNAs during muscle cell differentiation. Binds preferentially to 5'-CGCGCG[GCA]-3' motif in vitro. Ref.7 Ref.8 Ref.11 Ref.12 Ref.13 Ref.14 Ref.18 Ref.22 Ref.23 |
| Subunit structure | Interacts with TNPO3; the interaction mediates nuclear import of the protein and is disrupted by nuclear Ran bound to GTP. Interacts with EIF4G1 and WT1. Interacts with EIF4A1; the interaction is modulated under stress-induced conditions. Interacts with EIF2C1. Interacts with EIF2C2; the interaction occurs under both cell proliferation and differentiation conditions and in a RNA- and phosphorylation-independent manner. Interacts with DDX5; the interaction occurs in a RNA-independent manner. Ref.7 Ref.11 Ref.13 Ref.14 Ref.18 Ref.23 |
| Subcellular location | Nucleus. Nucleus › nucleolus. Nucleus speckle. Cytoplasm. Cytoplasmic granule. Note: Undergoes continuous nucleocytoplasmic shuttling. Upon nuclear import colocalizes with SR proteins in nuclear speckles. Arsenite stress-induced phosphorylation increases its subcellular relocalization from the nucleus to the cytoplasm and to cytoplasmic stress granules (SG) via a p38 MAPK signaling pathway. Primarily localized in nucleus and nucleoli under cell growth conditions and accumulated in the cytoplasm and cytoplasm perinuclear granules upon muscle cell differentiation. Ref.7 Ref.10 Ref.11 Ref.13 Ref.16 Ref.18 |
| Tissue specificity | Expressed in the cerebellum. Expressed in neurons and glial cells, including layers II neurons in the frontal cortex and CA1 pyramidal neurons in the hippocampus. Expressed in heart, liver, pancreas, skeletal muscle, placenta, primary fibroblasts and peripheral blood monocytes (at protein level). Ubiquitously expressed. Highly expressed in heart, placenta and skeletal muscle. Weakly expressed in pancreas, kidney, liver, lung and brain. Ref.7 Ref.8 Ref.12 Ref.16 |
| Developmental stage | Found to be expressed in fetal brain. Down-regulated in fetal Down syndrome (DS) brain. Ref.6 |
| Post-translational modification | Phosphorylation on Ser-309 is induced upon cell muscle differentiation By similarity. Phosphorylated. Phosphorylated in vitro on Ser-309 by SRPK1. Phosphorylation on Ser-309 is induced upon cell stress signaling, which alters its subcellular localization and may modulate its activity on IRES-mediated mRNA translation. Ref.13 |
| Sequence similarities | Contains 1 CCHC-type zinc finger. Contains 2 RRM (RNA recognition motif) domains. |
| Sequence caution | The sequence AAC51293.1 differs from that shown. Reason: Frameshift at position 234. |
Ontologies
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BWF3-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BWF3-2) The sequence of this isoform differs from the canonical sequence as follows: 139-177: KRMHVQLSTS...EGHWSKECPI → EPPSLGRGLN...TAVGWLVMKK 178-364: Missing. | ||||||
| Note: May be due to an intron retention. | ||||||
| Isoform 3 (identifier: Q9BWF3-3) The sequence of this isoform differs from the canonical sequence as follows: 139-143: KRMHV → GMCVG 144-364: Missing. | ||||||
| Note: May be due to exon skipping. | ||||||
| Isoform 4 (identifier: Q9BWF3-4) The sequence of this isoform differs from the canonical sequence as follows: 140-364: RMHVQLSTSR...YADRARYSAF → ITPVTEGYCCCNKGHTYIFKNCNLILESRKSRRC | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||
Molecule processing | ||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 364 | 364 | RNA-binding protein 4 | PRO_0000081754 | ||||||||||||||||
Regions | ||||||||||||||||||||
| Domain | 2 – 72 | 71 | RRM 1 | |||||||||||||||||
| Domain | 78 – 148 | 71 | RRM 2 | |||||||||||||||||
| Zinc finger | 160 – 177 | 18 | CCHC-type | |||||||||||||||||
| Region | 196 – 364 | 169 | Interaction with TNPO3 | |||||||||||||||||
| Compositional bias | 233 – 239 | 7 | Poly-Ala | |||||||||||||||||
| Compositional bias | 282 – 295 | 14 | Poly-Ala | |||||||||||||||||
Amino acid modifications | ||||||||||||||||||||
| Modified residue | 309 | 1 | Phosphoserine Ref.13 | |||||||||||||||||
Natural variations | ||||||||||||||||||||
| Alternative sequence | 139 – 177 | 39 | KRMHV…KECPI → EPPSLGRGLNTRLCAENGWI SKRRGLVKITAVGWLVMKK in isoform 2. | VSP_013414 | ||||||||||||||||
| Alternative sequence | 139 – 143 | 5 | KRMHV → GMCVG in isoform 3. | VSP_013413 | ||||||||||||||||
| Alternative sequence | 140 – 364 | 225 | RMHVQ…RYSAF → ITPVTEGYCCCNKGHTYIFK NCNLILESRKSRRC in isoform 4. | VSP_044493 | ||||||||||||||||
| Alternative sequence | 144 – 364 | 221 | Missing in isoform 3. | VSP_013415 | ||||||||||||||||
| Alternative sequence | 178 – 364 | 187 | Missing in isoform 2. | VSP_013416 | ||||||||||||||||
Experimental info | ||||||||||||||||||||
| Mutagenesis | 37 | 1 | Y → A: Abrogates regulation of alternative splice site selection; when associated with A-39; A-113 and A-115. Ref.7 | |||||||||||||||||
| Mutagenesis | 39 | 1 | F → A: Abrogates regulation of alternative splice site selection; when associated with A-37; A-113 and A-115. Ref.7 | |||||||||||||||||
| Mutagenesis | 113 | 1 | Y → A: Abrogates regulation of alternative splice site selection; when associated with A-37; A-39 and A-115. Ref.7 | |||||||||||||||||
| Mutagenesis | 115 | 1 | F → A: Abrogates regulation of alternative splice site selection; when associated with A-37; A-39 and A-113. Ref.7 | |||||||||||||||||
| Mutagenesis | 309 | 1 | S → A: Inhibits IRES-mediated mRNA translation. Does not inhibit interaction with EIF4A1. Inhibits localization in cytoplasm and cytoplasmiic granules upon cell muscle differentiation. Inhibits negative regulation of translation involved in gene silencing by miRNA. Ref.13 Ref.18 Ref.22 | |||||||||||||||||
| Sequence conflict | 52 | 1 | I → M in BAG64902. Ref.2 | |||||||||||||||||
Secondary structure | ||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||
| Beta strand | 2 – 8 | 7 | ||||||||||||||||||
| Helix | 15 – 23 | 9 | ||||||||||||||||||
| Beta strand | 28 – 34 | 7 | ||||||||||||||||||
| Beta strand | 37 – 44 | 8 | ||||||||||||||||||
| Helix | 45 – 55 | 11 | ||||||||||||||||||
| Beta strand | 66 – 68 | 3 | ||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A novel zinc finger-containing RNA-binding protein conserved from fruitflies to humans." Jackson F.R., Banfi S., Guffanti A., Rossi E. Genomics 41:444-452(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1). |
| [2] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 4). Tissue: Testis and Trachea. |
| [3] | "The full-ORF clone resource of the German cDNA consortium." Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I. BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Brain. |
| [4] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 2 AND 3). Tissue: Lung, Pancreas and Skin. |
| [6] | "Manifold decreased protein levels of matrin 3, reduced motor protein HMP and hlark in fetal Down's syndrome brain." Bernert G., Fountoulakis M., Lubec G. Proteomics 2:1752-1757(2002) [PubMed] [Europe PMC] [Abstract] Cited for: DEVELOPMENTAL STAGE. |
| [7] | "A novel splicing regulator shares a nuclear import pathway with SR proteins." Lai M.-C., Kuo H.-W., Chang W.-C., Tarn W.-Y. EMBO J. 22:1359-1369(2003) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH TNPO3, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, MUTAGENESIS OF TYR-37; PHE-39; TYR-113 AND PHE-115. |
| [8] | "Exon selection in alpha-tropomyosin mRNA is regulated by the antagonistic action of RBM4 and PTB." Lin J.C., Tarn W.Y. Mol. Cell. Biol. 25:10111-10121(2005) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, RNA-BINDING, TISSUE SPECIFICITY. |
| [9] | "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks." Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M. Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [10] | "Lark is the splicing factor RBM4 and exhibits unique subnuclear localization properties." Markus M.A., Morris B.J. DNA Cell Biol. 25:457-464(2006) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION. |
| [11] | "WT1 interacts with the splicing protein RBM4 and regulates its ability to modulate alternative splicing in vivo." Markus M.A., Heinrich B., Raitskin O., Adams D.J., Mangs H., Goy C., Ladomery M., Sperling R., Stamm S., Morris B.J. Exp. Cell Res. 312:3379-3388(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH WT1, SUBCELLULAR LOCATION. |
| [12] | "RBM4 interacts with an intronic element and stimulates tau exon 10 inclusion." Kar A., Havlioglu N., Tarn W.Y., Wu J.Y. J. Biol. Chem. 281:24479-24488(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, RNA-BINDING, TISSUE SPECIFICITY. |
| [13] | "Cell stress modulates the function of splicing regulatory protein RBM4 in translation control." Lin J.C., Hsu M., Tarn W.Y. Proc. Natl. Acad. Sci. U.S.A. 104:2235-2240(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH EIF4A1 AND EIF4G1, PHOSPHORYLATION AT SER-309, ASSOCIATION WITH IRES OF MRNAS, SUBCELLULAR LOCATION, MUTAGENESIS OF SER-309. |
| [14] | "Proteomic and functional analysis of Argonaute-containing mRNA-protein complexes in human cells." Hoeck J., Weinmann L., Ender C., Ruedel S., Kremmer E., Raabe M., Urlaub H., Meister G. EMBO Rep. 8:1052-1060(2007) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH EIF2C1 AND EIF2C2. |
| [15] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [16] | "The LARK/RBM4a protein is highly expressed in cerebellum as compared to cerebrum." Pfuhl T., Mamiani A., Durr M., Welter S., Stieber J., Ankara J., Liss M., Dobner T., Schmitt A., Falkai P., Kremmer E., Jung V., Barth S., Grasser F.A. Neurosci. Lett. 444:11-15(2008) [PubMed] [Europe PMC] [Abstract] Cited for: SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [17] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [18] | "RNA-binding motif protein 4 translocates to cytoplasmic granules and suppresses translation via argonaute2 during muscle cell differentiation." Lin J.C., Tarn W.Y. J. Biol. Chem. 284:34658-34665(2009) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH EIF2C2, MUTAGENESIS OF SER-309, SUBCELLULAR LOCATION. |
| [19] | "Rapid and systematic analysis of the RNA recognition specificities of RNA-binding proteins." Ray D., Kazan H., Chan E.T., Pena Castillo L., Chaudhry S., Talukder S., Blencowe B.J., Morris Q., Hughes T.R. Nat. Biotechnol. 27:667-670(2009) [PubMed] [Europe PMC] [Abstract] Cited for: RNA-BINDING. |
| [20] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| [21] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [22] | "RBM4 down-regulates PTB and antagonizes its activity in muscle cell-specific alternative splicing." Lin J.C., Tarn W.Y. J. Cell Biol. 193:509-520(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, MUTAGENESIS OF SER-309. |
| [23] | "RNA helicase p68 (DDX5) regulates tau exon 10 splicing by modulating a stem-loop structure at the 5' splice site." Kar A., Fushimi K., Zhou X., Ray P., Shi C., Chen X., Liu Z., Chen S., Wu J.Y. Mol. Cell. Biol. 31:1812-1821(2011) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, INTERACTION WITH DDX5, RNA-BINDING. |
| [24] | "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation." Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B. Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| [25] | "Solution structure of RNA binding domain 1 in RNA-binding protein 30." RIKEN structural genomics initiative (RSGI) Submitted (OCT-2006) to the PDB data bank Cited for: STRUCTURE BY NMR OF 1-77. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U89505 mRNA. Translation: AAC51293.1. Frameshift. AK097592 mRNA. Translation: BAG53492.1. AK303984 mRNA. Translation: BAG64902.1. AL832566 mRNA. Translation: CAH10593.1. AP001157 Genomic DNA. No translation available. BC000307 mRNA. Translation: AAH00307.1. BC021120 mRNA. Translation: AAH21120.1. BC032735 mRNA. Translation: AAH32735.1. BC064960 mRNA. Translation: AAH64960.1. | ||||||||||||
| IPI | IPI00003704. IPI00556034. IPI00908491. IPI00940890. | ||||||||||||
| RefSeq | NP_001185772.1. NM_001198843.1. NP_001185773.1. NM_001198844.1. NP_002887.2. NM_002896.3. | ||||||||||||
| UniGene | Hs.523822. Hs.728823. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9BWF3. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| DIP | DIP-44199N. | ||||||||||||
| IntAct | Q9BWF3. 2 interactions. | ||||||||||||
| MINT | MINT-1187795. | ||||||||||||
| STRING | 9606.ENSP00000309166. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9BWF3. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 62511089. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9BWF3. | ||||||||||||
| PRIDE | Q9BWF3. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 5936. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000310092; ENSP00000309166; ENSG00000173933. ENST00000396053; ENSP00000413497; ENSG00000173933. ENST00000398692; ENSP00000381680; ENSG00000173933. ENST00000408993; ENSP00000386561; ENSG00000173933. ENST00000409406; ENSP00000386894; ENSG00000173933. ENST00000483858; ENSP00000435821; ENSG00000173933. ENST00000530235; ENSP00000432150; ENSG00000173933. ENST00000532968; ENSP00000432020; ENSG00000173933. | ||||||||||||
| GeneID | 5936. | ||||||||||||
| KEGG | hsa:5936. | ||||||||||||
| UCSC | uc001oiv.3. human. uc001oiw.2. human. uc001oix.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 5936. | ||||||||||||
| GeneCards | GC11P066406. | ||||||||||||
| HGNC | HGNC:9901. RBM4. | ||||||||||||
| MIM | 602571. gene. | ||||||||||||
| neXtProt | NX_Q9BWF3. | ||||||||||||
| PharmGKB | PA34266. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG294108. | ||||||||||||
| HOGENOM | HOG000026790. | ||||||||||||
| HOVERGEN | HBG062217. | ||||||||||||
| KO | K13187. | ||||||||||||
| OMA | IPTIDTC. | ||||||||||||
| OrthoDB | EOG4NP74W. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9BWF3. | ||||||||||||
| Bgee | Q9BWF3. | ||||||||||||
| CleanEx | HS_RBM4. | ||||||||||||
| Genevestigator | Q9BWF3. | ||||||||||||
| GermOnline | ENSG00000173933. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 3.30.70.330. 2 hits. 4.10.60.10. 1 hit. | ||||||||||||
| InterPro | IPR012677. Nucleotide-bd_a/b_plait. IPR000504. RRM_dom. IPR001878. Znf_CCHC. [Graphical view] | ||||||||||||
| Pfam | PF00076. RRM_1. 2 hits. PF00098. zf-CCHC. 1 hit. [Graphical view] | ||||||||||||
| SMART | SM00360. RRM. 2 hits. SM00343. ZnF_C2HC. 1 hit. [Graphical view] | ||||||||||||
| PROSITE | PS50102. RRM. 2 hits. PS50158. ZF_CCHC. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| ChiTaRS | RBM4. human. | ||||||||||||
| EvolutionaryTrace | Q9BWF3. | ||||||||||||
| GenomeRNAi | 5936. | ||||||||||||
| NextBio | 23140. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | RBM4_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BWF3 Secondary accession number(s): B3KUN0 Q8WU85 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
