Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Replication initiator 1

Gene

REPIN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Sequence-specific double-stranded DNA-binding protein required for initiation of chromosomal DNA replication. Binds on 5'-ATT-3' reiterated sequences downstream of the origin of bidirectional replication (OBR) and a second, homologous ATT sequence of opposite orientation situated within the OBR zone. Facilitates DNA bending.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri57 – 79C2H2-type 1; atypicalPROSITE-ProRule annotationAdd BLAST23
Zinc fingeri85 – 107C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri116 – 138C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri145 – 168C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri177 – 199C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri236 – 258C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri264 – 286C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri292 – 314C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri375 – 397C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri403 – 425C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri431 – 453C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri459 – 481C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri487 – 509C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri515 – 537C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri543 – 565C2H2-type 15PROSITE-ProRule annotationAdd BLAST23

GO - Molecular functioni

  • DNA binding Source: ProtInc
  • metal ion binding Source: UniProtKB-KW
  • poly(A) RNA binding Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

DNA replication

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:G66-30830-MONOMER.
SignaLinkiQ9BWE0.

Names & Taxonomyi

Protein namesi
Recommended name:
Replication initiator 1
Alternative name(s):
60 kDa origin-specific DNA-binding protein
60 kDa replication initiation region protein
ATT-binding protein
DHFR oribeta-binding protein RIP60
Zinc finger protein 464
Gene namesi
Name:REPIN1
Synonyms:RIP60, ZNF464
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:17922. REPIN1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000214022.
PharmGKBiPA134933473.

Polymorphism and mutation databases

BioMutaiREPIN1.
DMDMi74761300.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002749121 – 567Replication initiator 1Add BLAST567

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei27PhosphoserineCombined sources1
Modified residuei30PhosphothreonineCombined sources1
Modified residuei33N6-acetyllysineCombined sources1
Modified residuei276N6-acetyllysineCombined sources1

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

EPDiQ9BWE0.
MaxQBiQ9BWE0.
PaxDbiQ9BWE0.
PeptideAtlasiQ9BWE0.
PRIDEiQ9BWE0.

PTM databases

iPTMnetiQ9BWE0.
PhosphoSitePlusiQ9BWE0.

Expressioni

Gene expression databases

BgeeiENSG00000214022.
CleanExiHS_REPIN1.
ExpressionAtlasiQ9BWE0. baseline and differential.
GenevisibleiQ9BWE0. HS.

Organism-specific databases

HPAiHPA036022.

Interactioni

Subunit structurei

Homodimers and homomultimers. Found in a complex with RIP60 and RIP100.2 Publications

Protein-protein interaction databases

BioGridi118927. 35 interactors.
IntActiQ9BWE0. 8 interactors.
MINTiMINT-7970644.
STRINGi9606.ENSP00000417291.

Structurei

3D structure databases

ProteinModelPortaliQ9BWE0.
SMRiQ9BWE0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi325 – 372Pro-richAdd BLAST48

Sequence similaritiesi

Contains 15 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri57 – 79C2H2-type 1; atypicalPROSITE-ProRule annotationAdd BLAST23
Zinc fingeri85 – 107C2H2-type 2PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri116 – 138C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri145 – 168C2H2-type 4PROSITE-ProRule annotationAdd BLAST24
Zinc fingeri177 – 199C2H2-type 5PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri236 – 258C2H2-type 6PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri264 – 286C2H2-type 7PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri292 – 314C2H2-type 8PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri375 – 397C2H2-type 9PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri403 – 425C2H2-type 10PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri431 – 453C2H2-type 11PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri459 – 481C2H2-type 12PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri487 – 509C2H2-type 13PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri515 – 537C2H2-type 14PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri543 – 565C2H2-type 15PROSITE-ProRule annotationAdd BLAST23

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129964.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ9BWE0.
OMAiHTRRCQA.
OrthoDBiEOG091G02KC.
PhylomeDBiQ9BWE0.
TreeFamiTF326846.

Family and domain databases

Gene3Di3.30.160.60. 11 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 4 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 15 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 14 hits.
PS50157. ZINC_FINGER_C2H2_2. 14 hits.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BWE0-3) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MLERRCRGPL AMGLAQPRLL SGPSQESPQT LGKESRGLRQ QGTSVAQSGA
60 70 80 90 100
QAPGRAHRCA HCRRHFPGWV ALWLHTRRCQ ARLPLPCPEC GRRFRHAPFL
110 120 130 140 150
ALHRQVHAAA TPDLGFACHL CGQSFRGWVA LVLHLRAHSA AKRPIACPKC
160 170 180 190 200
ERRFWRRKQL RAHLRRCHPP APEARPFICG NCGRSFAQWD QLVAHKRVHV
210 220 230 240 250
AEALEEAAAK ALGPRPRGRP AVTAPRPGGD AVDRPFQCAC CGKRFRHKPN
260 270 280 290 300
LIAHRRVHTG ERPHQCPECG KRFTNKPYLT SHRRIHTGEK PYPCKECGRR
310 320 330 340 350
FRHKPNLLSH SKIHKRSEGS AQAAPGPGSP QLPAGPQESA AEPTPAVPLK
360 370 380 390 400
PAQEPPPGAP PEHPQDPIEA PPSLYSCDDC GRSFRLERFL RAHQRQHTGE
410 420 430 440 450
RPFTCAECGK NFGKKTHLVA HSRVHSGERP FACEECGRRF SQGSHLAAHR
460 470 480 490 500
RDHAPDRPFV CPDCGKAFRH KPYLAAHRRI HTGEKPYVCP DCGKAFSQKS
510 520 530 540 550
NLVSHRRIHT GERPYACPDC DRSFSQKSNL ITHRKSHIRD GAFCCAICGQ
560
TFDDEERLLA HQKKHDV
Length:567
Mass (Da):63,575
Last modified:June 1, 2001 - v1
Checksum:i00D43EC28E176237
GO
Isoform 2 (identifier: Q9BWE0-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MGIGVSLLLQFSLTPGGYRSVGRSRRCSRGSIPRNIPKRSWKKPHPQLCSLQAEEEPM

Note: No experimental confirmation available. Gene prediction based on EST data.
Show »
Length:624
Mass (Da):69,920
Checksum:i552927277BD07931
GO

Sequence cautioni

The sequence AAH00363 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence AAS00386 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence CAB53100 differs from that shown. Reason: Frameshift at position 8.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti136R → L in AAF26712 (PubMed:10606657).Curated1
Sequence conflicti143R → Q in AAF26712 (PubMed:10606657).Curated1
Sequence conflicti165R → Q in CAB53100 (Ref. 2) Curated1
Sequence conflicti173E → A in CAB53100 (Ref. 2) Curated1
Sequence conflicti211A → V in CAB53100 (Ref. 2) Curated1
Sequence conflicti216P → S in CAB53100 (Ref. 2) Curated1
Sequence conflicti396 – 397QH → HD in AAF26712 (PubMed:10606657).Curated2
Sequence conflicti423R → P in AAF26712 (PubMed:10606657).Curated1
Sequence conflicti451R → P in AAF26712 (PubMed:10606657).Curated1
Sequence conflicti476A → R in AAF26712 (PubMed:10606657).Curated1
Sequence conflicti497S → R in CAB53100 (Ref. 2) Curated1
Sequence conflicti514P → S in CAB53100 (Ref. 2) Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03036414L → P.1 PublicationCorresponds to variant rs3735165dbSNPEnsembl.1
Natural variantiVAR_05273049G → R.Corresponds to variant rs35090619dbSNPEnsembl.1
Natural variantiVAR_03036588P → S.1 PublicationCorresponds to variant rs11553624dbSNPEnsembl.1
Natural variantiVAR_03036692R → H.Corresponds to variant rs17173702dbSNPEnsembl.1
Natural variantiVAR_03036797A → V.Corresponds to variant rs17173703dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0540691M → MGIGVSLLLQFSLTPGGYRS VGRSRRCSRGSIPRNIPKRS WKKPHPQLCSLQAEEEPM in isoform 2. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF201303 mRNA. Translation: AAF26712.1.
AJ245553 mRNA. Translation: CAB53100.1. Frameshift.
AC005586 Genomic DNA. Translation: AAS00385.1.
AC005586 Genomic DNA. Translation: AAS00386.1. Sequence problems.
CH471173 Genomic DNA. Translation: EAW54117.1.
CH471173 Genomic DNA. Translation: EAW54118.1.
CH471173 Genomic DNA. Translation: EAW54119.1.
BC000363 mRNA. Translation: AAH00363.2. Different initiation.
BC001760 mRNA. Translation: AAH01760.1.
CCDSiCCDS43677.1. [Q9BWE0-3]
CCDS47745.1. [Q9BWE0-4]
RefSeqiNP_001093165.1. NM_001099695.1. [Q9BWE0-4]
NP_001093166.1. NM_001099696.2. [Q9BWE0-3]
NP_037532.2. NM_013400.3. [Q9BWE0-3]
NP_055189.2. NM_014374.3. [Q9BWE0-3]
XP_005250042.1. XM_005249985.1. [Q9BWE0-3]
XP_006716010.1. XM_006715947.3. [Q9BWE0-4]
XP_006716011.1. XM_006715948.3. [Q9BWE0-4]
XP_006716012.1. XM_006715949.3. [Q9BWE0-4]
XP_006716015.1. XM_006715952.2. [Q9BWE0-3]
XP_006716016.1. XM_006715953.2. [Q9BWE0-3]
XP_011514414.1. XM_011516112.1. [Q9BWE0-3]
XP_016867570.1. XM_017012081.1. [Q9BWE0-3]
XP_016867571.1. XM_017012082.1. [Q9BWE0-3]
UniGeneiHs.647086.
Hs.655734.

Genome annotation databases

EnsembliENST00000397281; ENSP00000380451; ENSG00000214022. [Q9BWE0-3]
ENST00000425389; ENSP00000388287; ENSG00000214022. [Q9BWE0-3]
ENST00000444957; ENSP00000407714; ENSG00000214022. [Q9BWE0-3]
ENST00000489432; ENSP00000417291; ENSG00000214022. [Q9BWE0-4]
GeneIDi29803.
KEGGihsa:29803.
UCSCiuc003whc.2. human. [Q9BWE0-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF201303 mRNA. Translation: AAF26712.1.
AJ245553 mRNA. Translation: CAB53100.1. Frameshift.
AC005586 Genomic DNA. Translation: AAS00385.1.
AC005586 Genomic DNA. Translation: AAS00386.1. Sequence problems.
CH471173 Genomic DNA. Translation: EAW54117.1.
CH471173 Genomic DNA. Translation: EAW54118.1.
CH471173 Genomic DNA. Translation: EAW54119.1.
BC000363 mRNA. Translation: AAH00363.2. Different initiation.
BC001760 mRNA. Translation: AAH01760.1.
CCDSiCCDS43677.1. [Q9BWE0-3]
CCDS47745.1. [Q9BWE0-4]
RefSeqiNP_001093165.1. NM_001099695.1. [Q9BWE0-4]
NP_001093166.1. NM_001099696.2. [Q9BWE0-3]
NP_037532.2. NM_013400.3. [Q9BWE0-3]
NP_055189.2. NM_014374.3. [Q9BWE0-3]
XP_005250042.1. XM_005249985.1. [Q9BWE0-3]
XP_006716010.1. XM_006715947.3. [Q9BWE0-4]
XP_006716011.1. XM_006715948.3. [Q9BWE0-4]
XP_006716012.1. XM_006715949.3. [Q9BWE0-4]
XP_006716015.1. XM_006715952.2. [Q9BWE0-3]
XP_006716016.1. XM_006715953.2. [Q9BWE0-3]
XP_011514414.1. XM_011516112.1. [Q9BWE0-3]
XP_016867570.1. XM_017012081.1. [Q9BWE0-3]
XP_016867571.1. XM_017012082.1. [Q9BWE0-3]
UniGeneiHs.647086.
Hs.655734.

3D structure databases

ProteinModelPortaliQ9BWE0.
SMRiQ9BWE0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi118927. 35 interactors.
IntActiQ9BWE0. 8 interactors.
MINTiMINT-7970644.
STRINGi9606.ENSP00000417291.

PTM databases

iPTMnetiQ9BWE0.
PhosphoSitePlusiQ9BWE0.

Polymorphism and mutation databases

BioMutaiREPIN1.
DMDMi74761300.

Proteomic databases

EPDiQ9BWE0.
MaxQBiQ9BWE0.
PaxDbiQ9BWE0.
PeptideAtlasiQ9BWE0.
PRIDEiQ9BWE0.

Protocols and materials databases

DNASUi29803.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000397281; ENSP00000380451; ENSG00000214022. [Q9BWE0-3]
ENST00000425389; ENSP00000388287; ENSG00000214022. [Q9BWE0-3]
ENST00000444957; ENSP00000407714; ENSG00000214022. [Q9BWE0-3]
ENST00000489432; ENSP00000417291; ENSG00000214022. [Q9BWE0-4]
GeneIDi29803.
KEGGihsa:29803.
UCSCiuc003whc.2. human. [Q9BWE0-3]

Organism-specific databases

CTDi29803.
GeneCardsiREPIN1.
HGNCiHGNC:17922. REPIN1.
HPAiHPA036022.
neXtProtiNX_Q9BWE0.
OpenTargetsiENSG00000214022.
PharmGKBiPA134933473.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00840000129964.
HOGENOMiHOG000234617.
HOVERGENiHBG018163.
InParanoidiQ9BWE0.
OMAiHTRRCQA.
OrthoDBiEOG091G02KC.
PhylomeDBiQ9BWE0.
TreeFamiTF326846.

Enzyme and pathway databases

BioCyciZFISH:G66-30830-MONOMER.
SignaLinkiQ9BWE0.

Miscellaneous databases

ChiTaRSiREPIN1. human.
GeneWikiiREPIN1.
GenomeRNAii29803.
PROiQ9BWE0.

Gene expression databases

BgeeiENSG00000214022.
CleanExiHS_REPIN1.
ExpressionAtlasiQ9BWE0. baseline and differential.
GenevisibleiQ9BWE0. HS.

Family and domain databases

Gene3Di3.30.160.60. 11 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
PfamiPF00096. zf-C2H2. 4 hits.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 15 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 14 hits.
PS50157. ZINC_FINGER_C2H2_2. 14 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiREPI1_HUMAN
AccessioniPrimary (citable) accession number: Q9BWE0
Secondary accession number(s): C9J3L7
, D3DWZ1, Q7LE03, Q9BUZ6, Q9NZH2, Q9UMP5
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 6, 2007
Last sequence update: June 1, 2001
Last modified: November 2, 2016
This is version 125 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.