Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BW27

- NUP85_HUMAN

UniProt

Q9BW27 - NUP85_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nuclear pore complex protein Nup85

Gene

NUP85

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Essential component of the nuclear pore complex (NPC) that seems to be required for NPC assembly and maintenance. As part of the NPC Nup107-160 subcomplex plays a role in RNA export and in tethering NUP98/Nup98 and NUP153 to the nucleus. The Nup107-160 complex seems to be required for spindle assembly during mitosis. NUP85 is required for membrane clustering of CCL2-activated CCR2. Seems to be involved in CCR2-mediated chemotaxis of monocytes and may link activated CCR2 to the phosphatidyl-inositol 3-kinase-Rac-lammellipodium protrusion cascade.3 Publications

GO - Biological processi

  1. carbohydrate metabolic process Source: Reactome
  2. cytokine-mediated signaling pathway Source: Reactome
  3. glucose transport Source: Reactome
  4. hexose transport Source: Reactome
  5. lamellipodium assembly Source: Ensembl
  6. macrophage chemotaxis Source: Ensembl
  7. mitotic cell cycle Source: Reactome
  8. mitotic nuclear envelope disassembly Source: Reactome
  9. mRNA transport Source: UniProtKB-KW
  10. protein transport Source: UniProtKB-KW
  11. regulation of glucose transport Source: Reactome
  12. small molecule metabolic process Source: Reactome
  13. transmembrane transport Source: Reactome
  14. viral process Source: Reactome
Complete GO annotation...

Keywords - Biological processi

mRNA transport, Protein transport, Translocation, Transport

Enzyme and pathway databases

ReactomeiREACT_115831. ISG15 antiviral mechanism.
REACT_150425. Resolution of Sister Chromatid Cohesion.
REACT_150471. Separation of Sister Chromatids.
REACT_163931. Nuclear Pore Complex (NPC) Disassembly.
REACT_267668. Transcriptional regulation by small RNAs.
REACT_6190. Rev-mediated nuclear export of HIV RNA.
REACT_6354. Viral Messenger RNA Synthesis.
REACT_6804. Regulation of Glucokinase by Glucokinase Regulatory Protein.
REACT_682. Mitotic Prometaphase.
REACT_7991. Vpr-mediated nuclear import of PICs.
REACT_9395. Nuclear import of Rev protein.

Names & Taxonomyi

Protein namesi
Recommended name:
Nuclear pore complex protein Nup85
Alternative name(s):
85 kDa nucleoporin
FROUNT
Nucleoporin Nup75
Nucleoporin Nup85
Pericentrin-1
Gene namesi
Name:NUP85
Synonyms:NUP75, PCNT1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 17

Organism-specific databases

HGNCiHGNC:8734. NUP85.

Subcellular locationi

Nucleusnuclear pore complex. Chromosomecentromerekinetochore. Cytoplasmcytoskeletonspindle. Cytoplasm. Nucleus membrane
Note: During mitosis, localizes to the kinetochores and spindle poles. Upon CCl2 stimulation translocates from the cytoplasm to the membrane and colocalizes with CCR2 at the front of migrating cells.

GO - Cellular componenti

  1. cytoskeleton Source: UniProtKB-KW
  2. cytosol Source: Reactome
  3. kinetochore Source: UniProtKB-KW
  4. membrane Source: UniProtKB
  5. nuclear envelope Source: Reactome
  6. nuclear pore outer ring Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Kinetochore, Membrane, Nuclear pore complex, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142671241.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 656656Nuclear pore complex protein Nup85PRO_0000324187Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine1 Publication
Modified residuei92 – 921N6-acetyllysineBy similarity
Modified residuei223 – 2231Phosphoserine1 Publication

Keywords - PTMi

Acetylation, Phosphoprotein

Proteomic databases

MaxQBiQ9BW27.
PaxDbiQ9BW27.
PRIDEiQ9BW27.

PTM databases

PhosphoSiteiQ9BW27.

Expressioni

Gene expression databases

BgeeiQ9BW27.
CleanExiHS_NUP85.
ExpressionAtlasiQ9BW27. baseline and differential.
GenevestigatoriQ9BW27.

Organism-specific databases

HPAiHPA062595.

Interactioni

Subunit structurei

Component of the nuclear pore complex (NPC). Component of the NPC Nup107-160 subcomplex, consisting of at least NUP107, NUP98/Nup96, NUP160, NUP133, NUP85, NUP37, NUP43 and SEC13. Interacts with NUP160, NUP133 and SEC13. Interacts with NUP37, NUP107 and NUP43. Interacts with CCR2.4 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
CCR2A0A024R2Q03EBI-716392,EBI-9822346

Protein-protein interaction databases

BioGridi122985. 26 interactions.
IntActiQ9BW27. 16 interactions.
MINTiMINT-1408017.
STRINGi9606.ENSP00000245544.

Structurei

3D structure databases

ProteinModelPortaliQ9BW27.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the nucleoporin Nup85 family.Curated

Phylogenomic databases

eggNOGiNOG275863.
GeneTreeiENSGT00390000000204.
HOGENOMiHOG000230494.
HOVERGENiHBG059778.
InParanoidiQ9BW27.
KOiK14304.
OMAiHSLWQLA.
PhylomeDBiQ9BW27.
TreeFamiTF323240.

Family and domain databases

InterProiIPR011502. Nucleoporin_Nup85.
[Graphical view]
PfamiPF07575. Nucleopor_Nup85. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BW27-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEELDGEPTV TLIPGVNSKK NQMYFDWGPG EMLVCETSFN KKEKSEMVPS
60 70 80 90 100
CPFIYIIRKD VDVYSQILRK LFNESHGIFL GLQRIDEELT GKSRKSQLVR
110 120 130 140 150
VSKNYRSVIR ACMEEMHQVA IAAKDPANGR QFSSQVSILS AMELIWNLCE
160 170 180 190 200
ILFIEVAPAG PLLLHLLDWV RLHVCEVDSL SADVLGSENP SKHDSFWNLV
210 220 230 240 250
TILVLQGRLD EARQMLSKEA DASPASAGIC RIMGDLMRTM PILSPGNTQT
260 270 280 290 300
LTELELKWQH WHEECERYLQ DSTFATSPHL ESLLKIMLGD EAALLEQKEL
310 320 330 340 350
LSNWYHFLVT RLLYSNPTVK PIDLHYYAQS SLDLFLGGES SPEPLDNILL
360 370 380 390 400
AAFEFDIHQV IKECSIALSN WWFVAHLTDL LDHCKLLQSH NLYFGSNMRE
410 420 430 440 450
FLLLEYASGL FAHPSLWQLG VDYFDYCPEL GRVSLELHIE RIPLNTEQKA
460 470 480 490 500
LKVLRICEQR QMTEQVRSIC KILAMKAVRN NRLGSALSWS IRAKDAAFAT
510 520 530 540 550
LVSDRFLRDY CERGCFSDLD LIDNLGPAMM LSDRLTFLGK YREFHRMYGE
560 570 580 590 600
KRFADAASLL LSLMTSRIAP RSFWMTLLTD ALPLLEQKQV IFSAEQTYEL
610 620 630 640 650
MRCLEDLTSR RPVHGESDTE QLQDDDIETT KVEMLRLSLA RNLARAIIRE

GSLEGS
Length:656
Mass (Da):75,019
Last modified:June 1, 2001 - v1
Checksum:i1AE2BA17D9CADF3D
GO
Isoform 2 (identifier: Q9BW27-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MEELDGEPTVTLIPGVNSKKNQMYFDWGPGE → MAASSAARSPFCQQWSSSGTCVRFFLLKWPQ
     32-199: Missing.
     591-656: IFSAEQTYEL...IIREGSLEGS → KVAAAVVFFA...VVLPVRVYSP

Note: No experimental confirmation available.

Show »
Length:462
Mass (Da):52,599
Checksum:i43974BA2EDF165DF
GO
Isoform 3 (identifier: Q9BW27-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-46: Missing.

Note: No experimental confirmation available.

Show »
Length:610
Mass (Da):69,800
Checksum:i9DAEB179E3BD6FD4
GO

Sequence cautioni

The sequence CAD38749.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti501 – 5011L → P in BAB14130. (PubMed:14702039)Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4646Missing in isoform 3. CuratedVSP_056079Add
BLAST
Alternative sequencei1 – 3131MEELD…WGPGE → MAASSAARSPFCQQWSSSGT CVRFFLLKWPQ in isoform 2. 1 PublicationVSP_056080Add
BLAST
Alternative sequencei32 – 199168Missing in isoform 2. 1 PublicationVSP_056081Add
BLAST
Alternative sequencei591 – 65666IFSAE…SLEGS → KVAAAVVFFACQSLLELSCI AVADVRVSSFVVLPVRVYSP in isoform 2. 1 PublicationVSP_056082Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF514995 mRNA. Translation: AAM76706.1.
AF498261 mRNA. Translation: AAM18528.1.
AK022611 mRNA. Translation: BAB14130.1.
AK297574 mRNA. Translation: BAG59965.1.
AK298519 mRNA. Translation: BAG60723.1.
AL833893 mRNA. Translation: CAD38749.1. Different initiation.
AC022211 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89251.1.
BC000697 mRNA. Translation: AAH00697.1.
CCDSiCCDS32730.1. [Q9BW27-1]
RefSeqiNP_079120.1. NM_024844.3. [Q9BW27-1]
UniGeneiHs.362817.

Genome annotation databases

EnsembliENST00000245544; ENSP00000245544; ENSG00000125450. [Q9BW27-1]
GeneIDi79902.
KEGGihsa:79902.
UCSCiuc002jng.1. human. [Q9BW27-1]

Polymorphism databases

DMDMi74733394.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF514995 mRNA. Translation: AAM76706.1 .
AF498261 mRNA. Translation: AAM18528.1 .
AK022611 mRNA. Translation: BAB14130.1 .
AK297574 mRNA. Translation: BAG59965.1 .
AK298519 mRNA. Translation: BAG60723.1 .
AL833893 mRNA. Translation: CAD38749.1 . Different initiation.
AC022211 Genomic DNA. No translation available.
CH471099 Genomic DNA. Translation: EAW89251.1 .
BC000697 mRNA. Translation: AAH00697.1 .
CCDSi CCDS32730.1. [Q9BW27-1 ]
RefSeqi NP_079120.1. NM_024844.3. [Q9BW27-1 ]
UniGenei Hs.362817.

3D structure databases

ProteinModelPortali Q9BW27.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122985. 26 interactions.
IntActi Q9BW27. 16 interactions.
MINTi MINT-1408017.
STRINGi 9606.ENSP00000245544.

PTM databases

PhosphoSitei Q9BW27.

Polymorphism databases

DMDMi 74733394.

Proteomic databases

MaxQBi Q9BW27.
PaxDbi Q9BW27.
PRIDEi Q9BW27.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000245544 ; ENSP00000245544 ; ENSG00000125450 . [Q9BW27-1 ]
GeneIDi 79902.
KEGGi hsa:79902.
UCSCi uc002jng.1. human. [Q9BW27-1 ]

Organism-specific databases

CTDi 79902.
GeneCardsi GC17P073201.
HGNCi HGNC:8734. NUP85.
HPAi HPA062595.
MIMi 170285. gene.
neXtProti NX_Q9BW27.
PharmGKBi PA142671241.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG275863.
GeneTreei ENSGT00390000000204.
HOGENOMi HOG000230494.
HOVERGENi HBG059778.
InParanoidi Q9BW27.
KOi K14304.
OMAi HSLWQLA.
PhylomeDBi Q9BW27.
TreeFami TF323240.

Enzyme and pathway databases

Reactomei REACT_115831. ISG15 antiviral mechanism.
REACT_150425. Resolution of Sister Chromatid Cohesion.
REACT_150471. Separation of Sister Chromatids.
REACT_163931. Nuclear Pore Complex (NPC) Disassembly.
REACT_267668. Transcriptional regulation by small RNAs.
REACT_6190. Rev-mediated nuclear export of HIV RNA.
REACT_6354. Viral Messenger RNA Synthesis.
REACT_6804. Regulation of Glucokinase by Glucokinase Regulatory Protein.
REACT_682. Mitotic Prometaphase.
REACT_7991. Vpr-mediated nuclear import of PICs.
REACT_9395. Nuclear import of Rev protein.

Miscellaneous databases

ChiTaRSi NUP85. human.
GeneWikii NUP85.
GenomeRNAii 79902.
NextBioi 35473393.
PROi Q9BW27.
SOURCEi Search...

Gene expression databases

Bgeei Q9BW27.
CleanExi HS_NUP85.
ExpressionAtlasi Q9BW27. baseline and differential.
Genevestigatori Q9BW27.

Family and domain databases

InterProi IPR011502. Nucleoporin_Nup85.
[Graphical view ]
Pfami PF07575. Nucleopor_Nup85. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Proteomic analysis of the mammalian nuclear pore complex."
    Cronshaw J.M., Krutchinsky A.N., Zhang W., Chait B.T., Matunis M.J.
    J. Cell Biol. 158:915-927(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, IDENTIFICATION IN THE NUCLEAR PORE COMPLEX.
  2. "Pivotal function for cytoplasmic protein FROUNT in CCR2-mediated monocyte chemotaxis."
    Terashima Y., Onai N., Murai M., Enomoto M., Poonpiriya V., Hamada T., Motomura K., Suwa M., Ezaki T., Haga T., Kanegasaki S., Matsushima K.
    Nat. Immunol. 6:827-835(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION IN CCR2 SIGNALING, INTERACTION WITH CCR2, SUBCELLULAR LOCATION.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Testis.
  5. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
    Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
    , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
    Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Colon.
  8. "Removal of a single pore subcomplex results in vertebrate nuclei devoid of nuclear pores."
    Harel A., Orjalo A.V., Vincent T., Lachish-Zalait A., Vasu S., Shah S., Zimmerman E., Elbaum M., Forbes D.J.
    Mol. Cell 11:853-864(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN NPC ASSEMBLY, SUBCELLULAR LOCATION, INTERACTION WITH NUP160; NUP133 AND SEC13.
  9. "The entire Nup107-160 complex, including three new members, is targeted as one entity to kinetochores in mitosis."
    Loieodice I., Alves A., Rabut G., Van Overbeek M., Ellenberg J., Sibarita J.-B., Doye V.
    Mol. Biol. Cell 15:3333-3344(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, IDENTIFICATION IN THE NUP107-160 COMPLEX, INTERACTION WITH NUP37; NUP107; NUP43 AND SEC13.
  10. "The Nup107-160 nucleoporin complex is required for correct bipolar spindle assembly."
    Orjalo A.V., Arnaoutov A., Shen Z., Boyarchuk Y., Zeitlin S.G., Fontoura B., Briggs S., Dasso M., Forbes D.J.
    Mol. Biol. Cell 17:3806-3818(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN SPINDLE ASSSEMBLY, SUBCELLULAR LOCATION.
  11. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-223, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
    Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
    Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiNUP85_HUMAN
AccessioniPrimary (citable) accession number: Q9BW27
Secondary accession number(s): B4DMQ3
, B4DPW1, Q8NDI4, Q9H9U1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: June 1, 2001
Last modified: November 26, 2014
This is version 107 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3