Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BW27

- NUP85_HUMAN

UniProt

Q9BW27 - NUP85_HUMAN

Protein

Nuclear pore complex protein Nup85

Gene

NUP85

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 105 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Essential component of the nuclear pore complex (NPC) that seems to be required for NPC assembly and maintenance. As part of the NPC Nup107-160 subcomplex plays a role in RNA export and in tethering NUP98/Nup98 and NUP153 to the nucleus. The Nup107-160 complex seems to be required for spindle assembly during mitosis. NUP85 is required for membrane clustering of CCL2-activated CCR2. Seems to be involved in CCR2-mediated chemotaxis of monocytes and may link activated CCR2 to the phosphatidyl-inositol 3-kinase-Rac-lammellipodium protrusion cascade.3 Publications

    GO - Molecular functioni

    1. protein binding Source: UniProtKB

    GO - Biological processi

    1. carbohydrate metabolic process Source: Reactome
    2. cytokine-mediated signaling pathway Source: Reactome
    3. glucose transport Source: Reactome
    4. hexose transport Source: Reactome
    5. lamellipodium assembly Source: Ensembl
    6. macrophage chemotaxis Source: Ensembl
    7. mitotic cell cycle Source: Reactome
    8. mitotic nuclear envelope disassembly Source: Reactome
    9. mRNA transport Source: UniProtKB-KW
    10. protein transport Source: UniProtKB-KW
    11. regulation of glucose transport Source: Reactome
    12. small molecule metabolic process Source: Reactome
    13. transmembrane transport Source: Reactome
    14. viral process Source: Reactome

    Keywords - Biological processi

    mRNA transport, Protein transport, Translocation, Transport

    Enzyme and pathway databases

    ReactomeiREACT_115831. ISG15 antiviral mechanism.
    REACT_150425. Resolution of Sister Chromatid Cohesion.
    REACT_150471. Separation of Sister Chromatids.
    REACT_163931. Nuclear Pore Complex (NPC) Disassembly.
    REACT_6190. Rev-mediated nuclear export of HIV RNA.
    REACT_6804. Regulation of Glucokinase by Glucokinase Regulatory Protein.
    REACT_682. Mitotic Prometaphase.
    REACT_7991. Vpr-mediated nuclear import of PICs.
    REACT_9395. Nuclear import of Rev protein.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nuclear pore complex protein Nup85
    Alternative name(s):
    85 kDa nucleoporin
    FROUNT
    Nucleoporin Nup75
    Nucleoporin Nup85
    Pericentrin-1
    Gene namesi
    Name:NUP85
    Synonyms:NUP75, PCNT1
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 17

    Organism-specific databases

    HGNCiHGNC:8734. NUP85.

    Subcellular locationi

    Nucleusnuclear pore complex. Chromosomecentromerekinetochore. Cytoplasmcytoskeletonspindle. Cytoplasm. Nucleus membrane
    Note: During mitosis, localizes to the kinetochores and spindle poles. Upon CCl2 stimulation translocates from the cytoplasm to the membrane and colocalizes with CCR2 at the front of migrating cells.

    GO - Cellular componenti

    1. condensed chromosome kinetochore Source: UniProtKB-SubCell
    2. cytosol Source: Reactome
    3. membrane Source: UniProtKB
    4. nuclear envelope Source: Reactome
    5. nuclear membrane Source: UniProtKB-SubCell
    6. nuclear pore outer ring Source: UniProtKB
    7. spindle Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Centromere, Chromosome, Cytoplasm, Cytoskeleton, Kinetochore, Membrane, Nuclear pore complex, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142671241.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 656656Nuclear pore complex protein Nup85PRO_0000324187Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine1 Publication
    Modified residuei92 – 921N6-acetyllysineBy similarity
    Modified residuei223 – 2231Phosphoserine1 Publication

    Keywords - PTMi

    Acetylation, Phosphoprotein

    Proteomic databases

    MaxQBiQ9BW27.
    PaxDbiQ9BW27.
    PRIDEiQ9BW27.

    PTM databases

    PhosphoSiteiQ9BW27.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9BW27.
    BgeeiQ9BW27.
    CleanExiHS_NUP85.
    GenevestigatoriQ9BW27.

    Organism-specific databases

    HPAiHPA062595.

    Interactioni

    Subunit structurei

    Component of the nuclear pore complex (NPC). Component of the NPC Nup107-160 subcomplex, consisting of at least NUP107, NUP98/Nup96, NUP160, NUP133, NUP85, NUP37, NUP43 and SEC13. Interacts with NUP160, NUP133 and SEC13. Interacts with NUP37, NUP107 and NUP43. Interacts with CCR2.4 Publications

    Protein-protein interaction databases

    BioGridi122985. 19 interactions.
    IntActiQ9BW27. 15 interactions.
    MINTiMINT-1408017.
    STRINGi9606.ENSP00000245544.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BW27.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the nucleoporin Nup85 family.Curated

    Phylogenomic databases

    eggNOGiNOG275863.
    HOGENOMiHOG000230494.
    HOVERGENiHBG059778.
    InParanoidiQ9BW27.
    KOiK14304.
    OMAiHSLWQLA.
    PhylomeDBiQ9BW27.
    TreeFamiTF323240.

    Family and domain databases

    InterProiIPR011502. Nucleoporin_Nup85.
    [Graphical view]
    PfamiPF07575. Nucleopor_Nup85. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BW27-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEELDGEPTV TLIPGVNSKK NQMYFDWGPG EMLVCETSFN KKEKSEMVPS    50
    CPFIYIIRKD VDVYSQILRK LFNESHGIFL GLQRIDEELT GKSRKSQLVR 100
    VSKNYRSVIR ACMEEMHQVA IAAKDPANGR QFSSQVSILS AMELIWNLCE 150
    ILFIEVAPAG PLLLHLLDWV RLHVCEVDSL SADVLGSENP SKHDSFWNLV 200
    TILVLQGRLD EARQMLSKEA DASPASAGIC RIMGDLMRTM PILSPGNTQT 250
    LTELELKWQH WHEECERYLQ DSTFATSPHL ESLLKIMLGD EAALLEQKEL 300
    LSNWYHFLVT RLLYSNPTVK PIDLHYYAQS SLDLFLGGES SPEPLDNILL 350
    AAFEFDIHQV IKECSIALSN WWFVAHLTDL LDHCKLLQSH NLYFGSNMRE 400
    FLLLEYASGL FAHPSLWQLG VDYFDYCPEL GRVSLELHIE RIPLNTEQKA 450
    LKVLRICEQR QMTEQVRSIC KILAMKAVRN NRLGSALSWS IRAKDAAFAT 500
    LVSDRFLRDY CERGCFSDLD LIDNLGPAMM LSDRLTFLGK YREFHRMYGE 550
    KRFADAASLL LSLMTSRIAP RSFWMTLLTD ALPLLEQKQV IFSAEQTYEL 600
    MRCLEDLTSR RPVHGESDTE QLQDDDIETT KVEMLRLSLA RNLARAIIRE 650
    GSLEGS 656
    Length:656
    Mass (Da):75,019
    Last modified:June 1, 2001 - v1
    Checksum:i1AE2BA17D9CADF3D
    GO
    Isoform 2 (identifier: Q9BW27-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-31: MEELDGEPTVTLIPGVNSKKNQMYFDWGPGE → MAASSAARSPFCQQWSSSGTCVRFFLLKWPQ
         32-199: Missing.
         591-656: IFSAEQTYEL...IIREGSLEGS → KVAAAVVFFA...VVLPVRVYSP

    Note: No experimental confirmation available.

    Show »
    Length:462
    Mass (Da):52,599
    Checksum:i43974BA2EDF165DF
    GO
    Isoform 3 (identifier: Q9BW27-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-46: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:610
    Mass (Da):69,800
    Checksum:i9DAEB179E3BD6FD4
    GO

    Sequence cautioni

    The sequence CAD38749.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti501 – 5011L → P in BAB14130. (PubMed:14702039)Curated

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 4646Missing in isoform 3. CuratedVSP_056079Add
    BLAST
    Alternative sequencei1 – 3131MEELD…WGPGE → MAASSAARSPFCQQWSSSGT CVRFFLLKWPQ in isoform 2. 1 PublicationVSP_056080Add
    BLAST
    Alternative sequencei32 – 199168Missing in isoform 2. 1 PublicationVSP_056081Add
    BLAST
    Alternative sequencei591 – 65666IFSAE…SLEGS → KVAAAVVFFACQSLLELSCI AVADVRVSSFVVLPVRVYSP in isoform 2. 1 PublicationVSP_056082Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF514995 mRNA. Translation: AAM76706.1.
    AF498261 mRNA. Translation: AAM18528.1.
    AK022611 mRNA. Translation: BAB14130.1.
    AK297574 mRNA. Translation: BAG59965.1.
    AK298519 mRNA. Translation: BAG60723.1.
    AL833893 mRNA. Translation: CAD38749.1. Different initiation.
    AC022211 Genomic DNA. No translation available.
    CH471099 Genomic DNA. Translation: EAW89251.1.
    BC000697 mRNA. Translation: AAH00697.1.
    CCDSiCCDS32730.1.
    RefSeqiNP_079120.1. NM_024844.3.
    UniGeneiHs.362817.

    Genome annotation databases

    EnsembliENST00000245544; ENSP00000245544; ENSG00000125450.
    ENST00000447371; ENSP00000408261; ENSG00000125450.
    ENST00000541827; ENSP00000441762; ENSG00000125450.
    GeneIDi79902.
    KEGGihsa:79902.
    UCSCiuc002jng.1. human.

    Polymorphism databases

    DMDMi74733394.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF514995 mRNA. Translation: AAM76706.1 .
    AF498261 mRNA. Translation: AAM18528.1 .
    AK022611 mRNA. Translation: BAB14130.1 .
    AK297574 mRNA. Translation: BAG59965.1 .
    AK298519 mRNA. Translation: BAG60723.1 .
    AL833893 mRNA. Translation: CAD38749.1 . Different initiation.
    AC022211 Genomic DNA. No translation available.
    CH471099 Genomic DNA. Translation: EAW89251.1 .
    BC000697 mRNA. Translation: AAH00697.1 .
    CCDSi CCDS32730.1.
    RefSeqi NP_079120.1. NM_024844.3.
    UniGenei Hs.362817.

    3D structure databases

    ProteinModelPortali Q9BW27.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122985. 19 interactions.
    IntActi Q9BW27. 15 interactions.
    MINTi MINT-1408017.
    STRINGi 9606.ENSP00000245544.

    PTM databases

    PhosphoSitei Q9BW27.

    Polymorphism databases

    DMDMi 74733394.

    Proteomic databases

    MaxQBi Q9BW27.
    PaxDbi Q9BW27.
    PRIDEi Q9BW27.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000245544 ; ENSP00000245544 ; ENSG00000125450 .
    ENST00000447371 ; ENSP00000408261 ; ENSG00000125450 .
    ENST00000541827 ; ENSP00000441762 ; ENSG00000125450 .
    GeneIDi 79902.
    KEGGi hsa:79902.
    UCSCi uc002jng.1. human.

    Organism-specific databases

    CTDi 79902.
    GeneCardsi GC17P073201.
    HGNCi HGNC:8734. NUP85.
    HPAi HPA062595.
    MIMi 170285. gene.
    neXtProti NX_Q9BW27.
    PharmGKBi PA142671241.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG275863.
    HOGENOMi HOG000230494.
    HOVERGENi HBG059778.
    InParanoidi Q9BW27.
    KOi K14304.
    OMAi HSLWQLA.
    PhylomeDBi Q9BW27.
    TreeFami TF323240.

    Enzyme and pathway databases

    Reactomei REACT_115831. ISG15 antiviral mechanism.
    REACT_150425. Resolution of Sister Chromatid Cohesion.
    REACT_150471. Separation of Sister Chromatids.
    REACT_163931. Nuclear Pore Complex (NPC) Disassembly.
    REACT_6190. Rev-mediated nuclear export of HIV RNA.
    REACT_6804. Regulation of Glucokinase by Glucokinase Regulatory Protein.
    REACT_682. Mitotic Prometaphase.
    REACT_7991. Vpr-mediated nuclear import of PICs.
    REACT_9395. Nuclear import of Rev protein.

    Miscellaneous databases

    ChiTaRSi NUP85. human.
    GeneWikii NUP85.
    GenomeRNAii 79902.
    NextBioi 69751.
    PROi Q9BW27.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BW27.
    Bgeei Q9BW27.
    CleanExi HS_NUP85.
    Genevestigatori Q9BW27.

    Family and domain databases

    InterProi IPR011502. Nucleoporin_Nup85.
    [Graphical view ]
    Pfami PF07575. Nucleopor_Nup85. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Proteomic analysis of the mammalian nuclear pore complex."
      Cronshaw J.M., Krutchinsky A.N., Zhang W., Chait B.T., Matunis M.J.
      J. Cell Biol. 158:915-927(2002) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, IDENTIFICATION IN THE NUCLEAR PORE COMPLEX.
    2. "Pivotal function for cytoplasmic protein FROUNT in CCR2-mediated monocyte chemotaxis."
      Terashima Y., Onai N., Murai M., Enomoto M., Poonpiriya V., Hamada T., Motomura K., Suwa M., Ezaki T., Haga T., Kanegasaki S., Matsushima K.
      Nat. Immunol. 6:827-835(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION IN CCR2 SIGNALING, INTERACTION WITH CCR2, SUBCELLULAR LOCATION.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Testis.
    5. "DNA sequence of human chromosome 17 and analysis of rearrangement in the human lineage."
      Zody M.C., Garber M., Adams D.J., Sharpe T., Harrow J., Lupski J.R., Nicholson C., Searle S.M., Wilming L., Young S.K., Abouelleil A., Allen N.R., Bi W., Bloom T., Borowsky M.L., Bugalter B.E., Butler J., Chang J.L.
      , Chen C.-K., Cook A., Corum B., Cuomo C.A., de Jong P.J., DeCaprio D., Dewar K., FitzGerald M., Gilbert J., Gibson R., Gnerre S., Goldstein S., Grafham D.V., Grocock R., Hafez N., Hagopian D.S., Hart E., Norman C.H., Humphray S., Jaffe D.B., Jones M., Kamal M., Khodiyar V.K., LaButti K., Laird G., Lehoczky J., Liu X., Lokyitsang T., Loveland J., Lui A., Macdonald P., Major J.E., Matthews L., Mauceli E., McCarroll S.A., Mihalev A.H., Mudge J., Nguyen C., Nicol R., O'Leary S.B., Osoegawa K., Schwartz D.C., Shaw-Smith C., Stankiewicz P., Steward C., Swarbreck D., Venkataraman V., Whittaker C.A., Yang X., Zimmer A.R., Bradley A., Hubbard T., Birren B.W., Rogers J., Lander E.S., Nusbaum C.
      Nature 440:1045-1049(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Colon.
    8. "Removal of a single pore subcomplex results in vertebrate nuclei devoid of nuclear pores."
      Harel A., Orjalo A.V., Vincent T., Lachish-Zalait A., Vasu S., Shah S., Zimmerman E., Elbaum M., Forbes D.J.
      Mol. Cell 11:853-864(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN NPC ASSEMBLY, SUBCELLULAR LOCATION, INTERACTION WITH NUP160; NUP133 AND SEC13.
    9. "The entire Nup107-160 complex, including three new members, is targeted as one entity to kinetochores in mitosis."
      Loieodice I., Alves A., Rabut G., Van Overbeek M., Ellenberg J., Sibarita J.-B., Doye V.
      Mol. Biol. Cell 15:3333-3344(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, IDENTIFICATION IN THE NUP107-160 COMPLEX, INTERACTION WITH NUP37; NUP107; NUP43 AND SEC13.
    10. "The Nup107-160 nucleoporin complex is required for correct bipolar spindle assembly."
      Orjalo A.V., Arnaoutov A., Shen Z., Boyarchuk Y., Zeitlin S.G., Fontoura B., Briggs S., Dasso M., Forbes D.J.
      Mol. Biol. Cell 17:3806-3818(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION IN SPINDLE ASSSEMBLY, SUBCELLULAR LOCATION.
    11. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-223, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. "Lys-N and trypsin cover complementary parts of the phosphoproteome in a refined SCX-based approach."
      Gauci S., Helbig A.O., Slijper M., Krijgsveld J., Heck A.J., Mohammed S.
      Anal. Chem. 81:4493-4501(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    13. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiNUP85_HUMAN
    AccessioniPrimary (citable) accession number: Q9BW27
    Secondary accession number(s): B4DMQ3
    , B4DPW1, Q8NDI4, Q9H9U1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: March 18, 2008
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 105 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 17
      Human chromosome 17: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3