Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BW11

- MAD3_HUMAN

UniProt

Q9BW11 - MAD3_HUMAN

Protein

Max dimerization protein 3

Gene

MXD3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5- Experimental evidence at transcript leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 102 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Transcriptional repressor. Binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation By similarity.By similarity

    GO - Molecular functioni

    1. DNA binding Source: UniProtKB-KW

    GO - Biological processi

    1. negative regulation of transcription, DNA-templated Source: Ensembl
    2. transcription, DNA-templated Source: UniProtKB-KW

    Keywords - Molecular functioni

    Repressor

    Keywords - Biological processi

    Transcription, Transcription regulation

    Keywords - Ligandi

    DNA-binding

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Max dimerization protein 3
    Short name:
    Max dimerizer 3
    Alternative name(s):
    Class C basic helix-loop-helix protein 13
    Short name:
    bHLHc13
    Max-associated protein 3
    Max-interacting transcriptional repressor MAD3
    Myx
    Gene namesi
    Name:MXD3
    Synonyms:BHLHC13, MAD3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 5

    Organism-specific databases

    HGNCiHGNC:14008. MXD3.

    Subcellular locationi

    Nucleus PROSITE-ProRule annotation

    GO - Cellular componenti

    1. nucleus Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134892226.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 206206Max dimerization protein 3PRO_0000253707Add
    BLAST

    Proteomic databases

    PaxDbiQ9BW11.
    PRIDEiQ9BW11.

    PTM databases

    PhosphoSiteiQ9BW11.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9BW11.
    BgeeiQ9BW11.
    CleanExiHS_MXD3.
    GenevestigatoriQ9BW11.

    Interactioni

    Subunit structurei

    Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX. Interacts with SIN3A AND SIN3B. Interacts with RNF17 By similarity.By similarity

    Protein-protein interaction databases

    BioGridi123658. 6 interactions.
    IntActiQ9BW11. 1 interaction.
    MINTiMINT-1468092.
    STRINGi9606.ENSP00000401867.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BW11.
    SMRiQ9BW11. Positions 59-136.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini57 – 10953bHLHPROSITE-ProRule annotationAdd
    BLAST

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni8 – 2518Interaction with SIN3A and SIN3BBy similarityAdd
    BLAST

    Sequence similaritiesi

    Contains 1 bHLH (basic helix-loop-helix) domain.PROSITE-ProRule annotation

    Phylogenomic databases

    eggNOGiNOG247787.
    HOGENOMiHOG000247060.
    HOVERGENiHBG006314.
    InParanoidiQ9BW11.
    KOiK09114.
    OrthoDBiEOG76T9V0.
    PhylomeDBiQ9BW11.
    TreeFamiTF315654.

    Family and domain databases

    Gene3Di4.10.280.10. 1 hit.
    InterProiIPR011598. bHLH_dom.
    [Graphical view]
    PfamiPF00010. HLH. 1 hit.
    [Graphical view]
    SMARTiSM00353. HLH. 1 hit.
    [Graphical view]
    SUPFAMiSSF47459. SSF47459. 1 hit.
    PROSITEiPS50888. BHLH. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BW11-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MEPLASNIQV LLQAAEFLER REREAEHGYA SLCPHRSPGP IHRRKKRPPQ    50
    APGAQDSGRS VHNELEKRRR AQLKRCLERL KQQMPLGADC ARYTTLSLLR 100
    RARMHIQKLE DQEQRARQLK ERLRSKQQSL QRQLEQLRGL AGAAERERLR 150
    ADSLDSSGLS SERSDSDQEE LEVDVESLVF GGEAELLRGF VAGQEHSYSH 200
    GGGAWL 206
    Length:206
    Mass (Da):23,477
    Last modified:June 1, 2001 - v1
    Checksum:i2C49E02C10F9FC2E
    GO
    Isoform 2 (identifier: Q9BW11-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         60-68: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:197
    Mass (Da):22,384
    Checksum:i25B97E27D10D5CC2
    GO
    Isoform 3 (identifier: Q9BW11-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         169-206: EELEVDVESLVFGGEAELLRGFVAGQEHSYSHGGGAWL → VLPNENGGTPNHRPTGRGNNISSHH

    Note: No experimental confirmation available.

    Show »
    Length:193
    Mass (Da):22,065
    Checksum:iFBA651F2D547B225
    GO

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti88 – 881A → G in AAP97233. 1 PublicationCurated
    Sequence conflicti129 – 1291S → G in BAD96299. 1 PublicationCurated
    Sequence conflicti134 – 1352LE → WM in AAP97233. 1 PublicationCurated
    Sequence conflicti155 – 1551D → N in AAP97233. 1 PublicationCurated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti114 – 1141Q → H.
    Corresponds to variant rs35691394 [ dbSNP | Ensembl ].
    VAR_049546

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei60 – 689Missing in isoform 2. 1 PublicationVSP_021109
    Alternative sequencei169 – 20638EELEV…GGAWL → VLPNENGGTPNHRPTGRGNN ISSHH in isoform 3. 1 PublicationVSP_021110Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF114834 mRNA. Translation: AAP97233.1.
    AK057034 mRNA. Translation: BAB71352.1.
    AK222579 mRNA. Translation: BAD96299.1.
    AL833959 Transcribed RNA. Translation: CAD38809.2.
    BC000745 mRNA. Translation: AAH00745.1.
    CCDSiCCDS4416.1. [Q9BW11-1]
    CCDS47347.1. [Q9BW11-3]
    RefSeqiNP_001136407.1. NM_001142935.1. [Q9BW11-3]
    NP_112590.1. NM_031300.3. [Q9BW11-1]
    UniGeneiHs.743332.

    Genome annotation databases

    EnsembliENST00000427908; ENSP00000416921; ENSG00000213347. [Q9BW11-3]
    ENST00000439742; ENSP00000401867; ENSG00000213347. [Q9BW11-1]
    ENST00000513063; ENSP00000421463; ENSG00000213347. [Q9BW11-1]
    GeneIDi83463.
    KEGGihsa:83463.
    UCSCiuc003mgb.2. human. [Q9BW11-1]
    uc010jkk.2. human. [Q9BW11-3]

    Polymorphism databases

    DMDMi74733390.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF114834 mRNA. Translation: AAP97233.1 .
    AK057034 mRNA. Translation: BAB71352.1 .
    AK222579 mRNA. Translation: BAD96299.1 .
    AL833959 Transcribed RNA. Translation: CAD38809.2 .
    BC000745 mRNA. Translation: AAH00745.1 .
    CCDSi CCDS4416.1. [Q9BW11-1 ]
    CCDS47347.1. [Q9BW11-3 ]
    RefSeqi NP_001136407.1. NM_001142935.1. [Q9BW11-3 ]
    NP_112590.1. NM_031300.3. [Q9BW11-1 ]
    UniGenei Hs.743332.

    3D structure databases

    ProteinModelPortali Q9BW11.
    SMRi Q9BW11. Positions 59-136.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 123658. 6 interactions.
    IntActi Q9BW11. 1 interaction.
    MINTi MINT-1468092.
    STRINGi 9606.ENSP00000401867.

    PTM databases

    PhosphoSitei Q9BW11.

    Polymorphism databases

    DMDMi 74733390.

    Proteomic databases

    PaxDbi Q9BW11.
    PRIDEi Q9BW11.

    Protocols and materials databases

    DNASUi 83463.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000427908 ; ENSP00000416921 ; ENSG00000213347 . [Q9BW11-3 ]
    ENST00000439742 ; ENSP00000401867 ; ENSG00000213347 . [Q9BW11-1 ]
    ENST00000513063 ; ENSP00000421463 ; ENSG00000213347 . [Q9BW11-1 ]
    GeneIDi 83463.
    KEGGi hsa:83463.
    UCSCi uc003mgb.2. human. [Q9BW11-1 ]
    uc010jkk.2. human. [Q9BW11-3 ]

    Organism-specific databases

    CTDi 83463.
    GeneCardsi GC05M176733.
    HGNCi HGNC:14008. MXD3.
    MIMi 609450. gene.
    neXtProti NX_Q9BW11.
    PharmGKBi PA134892226.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG247787.
    HOGENOMi HOG000247060.
    HOVERGENi HBG006314.
    InParanoidi Q9BW11.
    KOi K09114.
    OrthoDBi EOG76T9V0.
    PhylomeDBi Q9BW11.
    TreeFami TF315654.

    Miscellaneous databases

    ChiTaRSi MXD3. human.
    GenomeRNAii 83463.
    NextBioi 72389.
    PROi Q9BW11.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BW11.
    Bgeei Q9BW11.
    CleanExi HS_MXD3.
    Genevestigatori Q9BW11.

    Family and domain databases

    Gene3Di 4.10.280.10. 1 hit.
    InterProi IPR011598. bHLH_dom.
    [Graphical view ]
    Pfami PF00010. HLH. 1 hit.
    [Graphical view ]
    SMARTi SM00353. HLH. 1 hit.
    [Graphical view ]
    SUPFAMi SSF47459. SSF47459. 1 hit.
    PROSITEi PS50888. BHLH. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning and sequencing of a new human cDNA homologous to Rattus norvegicus Myx mRNA."
      Zhang P.Z., Yu L., Ding J.B., Dai F.Y., Fu S.N., Zhao S.Y.
      Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
      Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Coronary artery.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Testis.
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lung.

    Entry informationi

    Entry nameiMAD3_HUMAN
    AccessioniPrimary (citable) accession number: Q9BW11
    Secondary accession number(s): Q53HK1
    , Q7Z4Y0, Q8NDJ7, Q96ME3
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 17, 2006
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 102 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 5
      Human chromosome 5: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3