SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BW11

- MAD3_HUMAN

UniProt

Q9BW11 - MAD3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Max dimerization protein 3

Gene
MXD3, BHLHC13, MAD3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at transcript leveli

Functioni

Transcriptional repressor. Binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation By similarity.

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW

GO - Biological processi

  1. negative regulation of transcription, DNA-templated Source: Ensembl
  2. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Max dimerization protein 3
Short name:
Max dimerizer 3
Alternative name(s):
Class C basic helix-loop-helix protein 13
Short name:
bHLHc13
Max-associated protein 3
Max-interacting transcriptional repressor MAD3
Myx
Gene namesi
Name:MXD3
Synonyms:BHLHC13, MAD3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 5

Organism-specific databases

HGNCiHGNC:14008. MXD3.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. nucleus Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134892226.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 206206Max dimerization protein 3PRO_0000253707Add
BLAST

Proteomic databases

PaxDbiQ9BW11.
PRIDEiQ9BW11.

PTM databases

PhosphoSiteiQ9BW11.

Expressioni

Gene expression databases

ArrayExpressiQ9BW11.
BgeeiQ9BW11.
CleanExiHS_MXD3.
GenevestigatoriQ9BW11.

Interactioni

Subunit structurei

Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX. Interacts with SIN3A AND SIN3B. Interacts with RNF17 By similarity.

Protein-protein interaction databases

BioGridi123658. 6 interactions.
IntActiQ9BW11. 1 interaction.
MINTiMINT-1468092.
STRINGi9606.ENSP00000401867.

Structurei

3D structure databases

ProteinModelPortaliQ9BW11.
SMRiQ9BW11. Positions 59-136.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini57 – 10953bHLHAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni8 – 2518Interaction with SIN3A and SIN3B By similarityAdd
BLAST

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG247787.
HOGENOMiHOG000247060.
HOVERGENiHBG006314.
InParanoidiQ9BW11.
KOiK09114.
OrthoDBiEOG76T9V0.
PhylomeDBiQ9BW11.
TreeFamiTF315654.

Family and domain databases

Gene3Di4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
[Graphical view]
PfamiPF00010. HLH. 1 hit.
[Graphical view]
SMARTiSM00353. HLH. 1 hit.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BW11-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MEPLASNIQV LLQAAEFLER REREAEHGYA SLCPHRSPGP IHRRKKRPPQ    50
APGAQDSGRS VHNELEKRRR AQLKRCLERL KQQMPLGADC ARYTTLSLLR 100
RARMHIQKLE DQEQRARQLK ERLRSKQQSL QRQLEQLRGL AGAAERERLR 150
ADSLDSSGLS SERSDSDQEE LEVDVESLVF GGEAELLRGF VAGQEHSYSH 200
GGGAWL 206
Length:206
Mass (Da):23,477
Last modified:June 1, 2001 - v1
Checksum:i2C49E02C10F9FC2E
GO
Isoform 2 (identifier: Q9BW11-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     60-68: Missing.

Note: No experimental confirmation available.

Show »
Length:197
Mass (Da):22,384
Checksum:i25B97E27D10D5CC2
GO
Isoform 3 (identifier: Q9BW11-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     169-206: EELEVDVESLVFGGEAELLRGFVAGQEHSYSHGGGAWL → VLPNENGGTPNHRPTGRGNNISSHH

Note: No experimental confirmation available.

Show »
Length:193
Mass (Da):22,065
Checksum:iFBA651F2D547B225
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti114 – 1141Q → H.
Corresponds to variant rs35691394 [ dbSNP | Ensembl ].
VAR_049546

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei60 – 689Missing in isoform 2. VSP_021109
Alternative sequencei169 – 20638EELEV…GGAWL → VLPNENGGTPNHRPTGRGNN ISSHH in isoform 3. VSP_021110Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti88 – 881A → G in AAP97233. 1 Publication
Sequence conflicti129 – 1291S → G in BAD96299. 1 Publication
Sequence conflicti134 – 1352LE → WM in AAP97233. 1 Publication
Sequence conflicti155 – 1551D → N in AAP97233. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF114834 mRNA. Translation: AAP97233.1.
AK057034 mRNA. Translation: BAB71352.1.
AK222579 mRNA. Translation: BAD96299.1.
AL833959 Transcribed RNA. Translation: CAD38809.2.
BC000745 mRNA. Translation: AAH00745.1.
CCDSiCCDS4416.1. [Q9BW11-1]
CCDS47347.1. [Q9BW11-3]
RefSeqiNP_001136407.1. NM_001142935.1. [Q9BW11-3]
NP_112590.1. NM_031300.3. [Q9BW11-1]
UniGeneiHs.743332.

Genome annotation databases

EnsembliENST00000427908; ENSP00000416921; ENSG00000213347. [Q9BW11-3]
ENST00000439742; ENSP00000401867; ENSG00000213347. [Q9BW11-1]
ENST00000513063; ENSP00000421463; ENSG00000213347. [Q9BW11-1]
GeneIDi83463.
KEGGihsa:83463.
UCSCiuc003mgb.2. human. [Q9BW11-1]
uc010jkk.2. human. [Q9BW11-3]

Polymorphism databases

DMDMi74733390.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF114834 mRNA. Translation: AAP97233.1 .
AK057034 mRNA. Translation: BAB71352.1 .
AK222579 mRNA. Translation: BAD96299.1 .
AL833959 Transcribed RNA. Translation: CAD38809.2 .
BC000745 mRNA. Translation: AAH00745.1 .
CCDSi CCDS4416.1. [Q9BW11-1 ]
CCDS47347.1. [Q9BW11-3 ]
RefSeqi NP_001136407.1. NM_001142935.1. [Q9BW11-3 ]
NP_112590.1. NM_031300.3. [Q9BW11-1 ]
UniGenei Hs.743332.

3D structure databases

ProteinModelPortali Q9BW11.
SMRi Q9BW11. Positions 59-136.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 123658. 6 interactions.
IntActi Q9BW11. 1 interaction.
MINTi MINT-1468092.
STRINGi 9606.ENSP00000401867.

PTM databases

PhosphoSitei Q9BW11.

Polymorphism databases

DMDMi 74733390.

Proteomic databases

PaxDbi Q9BW11.
PRIDEi Q9BW11.

Protocols and materials databases

DNASUi 83463.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000427908 ; ENSP00000416921 ; ENSG00000213347 . [Q9BW11-3 ]
ENST00000439742 ; ENSP00000401867 ; ENSG00000213347 . [Q9BW11-1 ]
ENST00000513063 ; ENSP00000421463 ; ENSG00000213347 . [Q9BW11-1 ]
GeneIDi 83463.
KEGGi hsa:83463.
UCSCi uc003mgb.2. human. [Q9BW11-1 ]
uc010jkk.2. human. [Q9BW11-3 ]

Organism-specific databases

CTDi 83463.
GeneCardsi GC05M176733.
HGNCi HGNC:14008. MXD3.
MIMi 609450. gene.
neXtProti NX_Q9BW11.
PharmGKBi PA134892226.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG247787.
HOGENOMi HOG000247060.
HOVERGENi HBG006314.
InParanoidi Q9BW11.
KOi K09114.
OrthoDBi EOG76T9V0.
PhylomeDBi Q9BW11.
TreeFami TF315654.

Miscellaneous databases

ChiTaRSi MXD3. human.
GenomeRNAii 83463.
NextBioi 72389.
PROi Q9BW11.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9BW11.
Bgeei Q9BW11.
CleanExi HS_MXD3.
Genevestigatori Q9BW11.

Family and domain databases

Gene3Di 4.10.280.10. 1 hit.
InterProi IPR011598. bHLH_dom.
[Graphical view ]
Pfami PF00010. HLH. 1 hit.
[Graphical view ]
SMARTi SM00353. HLH. 1 hit.
[Graphical view ]
SUPFAMi SSF47459. SSF47459. 1 hit.
PROSITEi PS50888. BHLH. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Cloning and sequencing of a new human cDNA homologous to Rattus norvegicus Myx mRNA."
    Zhang P.Z., Yu L., Ding J.B., Dai F.Y., Fu S.N., Zhao S.Y.
    Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
  3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Coronary artery.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.

Entry informationi

Entry nameiMAD3_HUMAN
AccessioniPrimary (citable) accession number: Q9BW11
Secondary accession number(s): Q53HK1
, Q7Z4Y0, Q8NDJ7, Q96ME3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: June 1, 2001
Last modified: July 9, 2014
This is version 101 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi