Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BW11 (MAD3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 101. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Max dimerization protein 3

Short name=Max dimerizer 3
Alternative name(s):
Class C basic helix-loop-helix protein 13
Short name=bHLHc13
Max-associated protein 3
Max-interacting transcriptional repressor MAD3
Myx
Gene names
Name:MXD3
Synonyms:BHLHC13, MAD3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length206 AA.
Sequence statusComplete.
Protein existenceEvidence at transcript level

General annotation (Comments)

Function

Transcriptional repressor. Binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation By similarity.

Subunit structure

Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX. Interacts with SIN3A AND SIN3B. Interacts with RNF17 By similarity.

Subcellular location

Nucleus By similarity.

Sequence similarities

Contains 1 bHLH (basic helix-loop-helix) domain.

Ontologies

Keywords
   Biological processTranscription
Transcription regulation
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
Polymorphism
   LigandDNA-binding
   Molecular functionRepressor
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processnegative regulation of transcription, DNA-templated

Inferred from electronic annotation. Source: Ensembl

transcription, DNA-templated

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentnucleus

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functionDNA binding

Inferred from electronic annotation. Source: UniProtKB-KW

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BW11-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9BW11-2)

The sequence of this isoform differs from the canonical sequence as follows:
     60-68: Missing.
Note: No experimental confirmation available.
Isoform 3 (identifier: Q9BW11-3)

The sequence of this isoform differs from the canonical sequence as follows:
     169-206: EELEVDVESLVFGGEAELLRGFVAGQEHSYSHGGGAWL → VLPNENGGTPNHRPTGRGNNISSHH
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 206206Max dimerization protein 3
PRO_0000253707

Regions

Domain57 – 10953bHLH
Region8 – 2518Interaction with SIN3A and SIN3B By similarity

Natural variations

Alternative sequence60 – 689Missing in isoform 2.
VSP_021109
Alternative sequence169 – 20638EELEV…GGAWL → VLPNENGGTPNHRPTGRGNN ISSHH in isoform 3.
VSP_021110
Natural variant1141Q → H.
Corresponds to variant rs35691394 [ dbSNP | Ensembl ].
VAR_049546

Experimental info

Sequence conflict881A → G in AAP97233. Ref.1
Sequence conflict1291S → G in BAD96299. Ref.3
Sequence conflict134 – 1352LE → WM in AAP97233. Ref.1
Sequence conflict1551D → N in AAP97233. Ref.1

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2001. Version 1.
Checksum: 2C49E02C10F9FC2E

FASTA20623,477
        10         20         30         40         50         60 
MEPLASNIQV LLQAAEFLER REREAEHGYA SLCPHRSPGP IHRRKKRPPQ APGAQDSGRS 

        70         80         90        100        110        120 
VHNELEKRRR AQLKRCLERL KQQMPLGADC ARYTTLSLLR RARMHIQKLE DQEQRARQLK 

       130        140        150        160        170        180 
ERLRSKQQSL QRQLEQLRGL AGAAERERLR ADSLDSSGLS SERSDSDQEE LEVDVESLVF 

       190        200 
GGEAELLRGF VAGQEHSYSH GGGAWL 

« Hide

Isoform 2 [UniParc].

Checksum: 25B97E27D10D5CC2
Show »

FASTA19722,384
Isoform 3 [UniParc].

Checksum: FBA651F2D547B225
Show »

FASTA19322,065

References

[1]"Cloning and sequencing of a new human cDNA homologous to Rattus norvegicus Myx mRNA."
Zhang P.Z., Yu L., Ding J.B., Dai F.Y., Fu S.N., Zhao S.Y.
Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[2]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
[3]Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Coronary artery.
[4]"The full-ORF clone resource of the German cDNA consortium."
Bechtel S., Rosenfelder H., Duda A., Schmidt C.P., Ernst U., Wellenreuther R., Mehrle A., Schuster C., Bahr A., Bloecker H., Heubner D., Hoerlein A., Michel G., Wedler H., Koehrer K., Ottenwaelder B., Poustka A., Wiemann S., Schupp I.
BMC Genomics 8:399-399(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Testis.
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Lung.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF114834 mRNA. Translation: AAP97233.1.
AK057034 mRNA. Translation: BAB71352.1.
AK222579 mRNA. Translation: BAD96299.1.
AL833959 Transcribed RNA. Translation: CAD38809.2.
BC000745 mRNA. Translation: AAH00745.1.
CCDSCCDS4416.1. [Q9BW11-1]
CCDS47347.1. [Q9BW11-3]
RefSeqNP_001136407.1. NM_001142935.1. [Q9BW11-3]
NP_112590.1. NM_031300.3. [Q9BW11-1]
UniGeneHs.743332.

3D structure databases

ProteinModelPortalQ9BW11.
SMRQ9BW11. Positions 59-136.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid123658. 6 interactions.
IntActQ9BW11. 1 interaction.
MINTMINT-1468092.
STRING9606.ENSP00000401867.

PTM databases

PhosphoSiteQ9BW11.

Polymorphism databases

DMDM74733390.

Proteomic databases

PaxDbQ9BW11.
PRIDEQ9BW11.

Protocols and materials databases

DNASU83463.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000427908; ENSP00000416921; ENSG00000213347. [Q9BW11-3]
ENST00000439742; ENSP00000401867; ENSG00000213347. [Q9BW11-1]
ENST00000513063; ENSP00000421463; ENSG00000213347. [Q9BW11-1]
GeneID83463.
KEGGhsa:83463.
UCSCuc003mgb.2. human. [Q9BW11-1]
uc010jkk.2. human. [Q9BW11-3]

Organism-specific databases

CTD83463.
GeneCardsGC05M176733.
HGNCHGNC:14008. MXD3.
MIM609450. gene.
neXtProtNX_Q9BW11.
PharmGKBPA134892226.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG247787.
HOGENOMHOG000247060.
HOVERGENHBG006314.
InParanoidQ9BW11.
KOK09114.
OrthoDBEOG76T9V0.
PhylomeDBQ9BW11.
TreeFamTF315654.

Gene expression databases

ArrayExpressQ9BW11.
BgeeQ9BW11.
CleanExHS_MXD3.
GenevestigatorQ9BW11.

Family and domain databases

Gene3D4.10.280.10. 1 hit.
InterProIPR011598. bHLH_dom.
[Graphical view]
PfamPF00010. HLH. 1 hit.
[Graphical view]
SMARTSM00353. HLH. 1 hit.
[Graphical view]
SUPFAMSSF47459. SSF47459. 1 hit.
PROSITEPS50888. BHLH. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

ChiTaRSMXD3. human.
GenomeRNAi83463.
NextBio72389.
PROQ9BW11.
SOURCESearch...

Entry information

Entry nameMAD3_HUMAN
AccessionPrimary (citable) accession number: Q9BW11
Secondary accession number(s): Q53HK1 expand/collapse secondary AC list , Q7Z4Y0, Q8NDJ7, Q96ME3
Entry history
Integrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: June 1, 2001
Last modified: July 9, 2014
This is version 101 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 5

Human chromosome 5: entries, gene names and cross-references to MIM