Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Max dimerization protein 3

Gene

MXD3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Transcriptional repressor. Binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation (By similarity).By similarity

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Repressor

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding

Names & Taxonomyi

Protein namesi
Recommended name:
Max dimerization protein 3
Short name:
Max dimerizer 3
Alternative name(s):
Class C basic helix-loop-helix protein 13
Short name:
bHLHc13
Max-associated protein 3
Max-interacting transcriptional repressor MAD3
Myx
Gene namesi
Name:MXD3
Synonyms:BHLHC13, MAD3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 5

Organism-specific databases

HGNCiHGNC:14008. MXD3.

Subcellular locationi

  • Nucleus PROSITE-ProRule annotation

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134892226.

Polymorphism and mutation databases

BioMutaiMXD3.
DMDMi74733390.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 206206Max dimerization protein 3PRO_0000253707Add
BLAST

Proteomic databases

PaxDbiQ9BW11.
PRIDEiQ9BW11.

PTM databases

PhosphoSiteiQ9BW11.

Expressioni

Gene expression databases

BgeeiQ9BW11.
CleanExiHS_MXD3.
ExpressionAtlasiQ9BW11. baseline and differential.
GenevisibleiQ9BW11. HS.

Interactioni

Subunit structurei

Efficient DNA binding requires dimerization with another bHLH protein. Binds DNA as a heterodimer with MAX. Interacts with SIN3A AND SIN3B. Interacts with RNF17 (By similarity).By similarity

Binary interactionsi

WithEntry#Exp.IntActNotes
KRTAP10-7P604093EBI-741574,EBI-10172290
NOTCH2NLQ7Z3S93EBI-741574,EBI-945833

Protein-protein interaction databases

BioGridi123658. 8 interactions.
IntActiQ9BW11. 3 interactions.
MINTiMINT-1468092.
STRINGi9606.ENSP00000401867.

Structurei

3D structure databases

ProteinModelPortaliQ9BW11.
SMRiQ9BW11. Positions 59-136.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini57 – 10953bHLHPROSITE-ProRule annotationAdd
BLAST

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni8 – 2518Interaction with SIN3A and SIN3BBy similarityAdd
BLAST

Sequence similaritiesi

Contains 1 bHLH (basic helix-loop-helix) domain.PROSITE-ProRule annotation

Phylogenomic databases

eggNOGiNOG247787.
GeneTreeiENSGT00510000046360.
HOGENOMiHOG000247060.
HOVERGENiHBG006314.
InParanoidiQ9BW11.
KOiK09114.
OMAiEWTKRTL.
OrthoDBiEOG76T9V0.
PhylomeDBiQ9BW11.
TreeFamiTF315654.

Family and domain databases

Gene3Di4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
[Graphical view]
PfamiPF00010. HLH. 1 hit.
[Graphical view]
SMARTiSM00353. HLH. 1 hit.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BW11-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MEPLASNIQV LLQAAEFLER REREAEHGYA SLCPHRSPGP IHRRKKRPPQ
60 70 80 90 100
APGAQDSGRS VHNELEKRRR AQLKRCLERL KQQMPLGADC ARYTTLSLLR
110 120 130 140 150
RARMHIQKLE DQEQRARQLK ERLRSKQQSL QRQLEQLRGL AGAAERERLR
160 170 180 190 200
ADSLDSSGLS SERSDSDQEE LEVDVESLVF GGEAELLRGF VAGQEHSYSH

GGGAWL
Length:206
Mass (Da):23,477
Last modified:June 1, 2001 - v1
Checksum:i2C49E02C10F9FC2E
GO
Isoform 2 (identifier: Q9BW11-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     60-68: Missing.

Note: No experimental confirmation available.
Show »
Length:197
Mass (Da):22,384
Checksum:i25B97E27D10D5CC2
GO
Isoform 3 (identifier: Q9BW11-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     169-206: EELEVDVESLVFGGEAELLRGFVAGQEHSYSHGGGAWL → VLPNENGGTPNHRPTGRGNNISSHH

Note: No experimental confirmation available.
Show »
Length:193
Mass (Da):22,065
Checksum:iFBA651F2D547B225
GO
Isoform 4 (identifier: Q9BW11-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     169-206: EELEVDVESL...SYSHGGGAWL → GECPEAEGLC...GRGNNISSHH

Note: No experimental confirmation available.
Show »
Length:388
Mass (Da):42,821
Checksum:iB340733F42A5F00E
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti88 – 881A → G in AAP97233 (Ref. 1) Curated
Sequence conflicti129 – 1291S → G in BAD96299 (Ref. 3) Curated
Sequence conflicti134 – 1352LE → WM in AAP97233 (Ref. 1) Curated
Sequence conflicti155 – 1551D → N in AAP97233 (Ref. 1) Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti114 – 1141Q → H.
Corresponds to variant rs35691394 [ dbSNP | Ensembl ].
VAR_049546

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei60 – 689Missing in isoform 2. 1 PublicationVSP_021109
Alternative sequencei169 – 20638EELEV…GGAWL → VLPNENGGTPNHRPTGRGNN ISSHH in isoform 3. 1 PublicationVSP_021110Add
BLAST
Alternative sequencei169 – 20638EELEV…GGAWL → GECPEAEGLCGPRGEPGLLT GPLPAQRSWRWMWRAWCLGV RPSCCGASSPARSTATRTAA APGYDVPHPGRASALYSCQA HLPGRSPPQAFRAARSHLLE WTKRTLVWEQVLPKHPAAGC QAGPLEGKGQDSSGPPWTPA GQAAWARAQAFGSAAPKGTG SLLGLFPSWTRPPAFASHKL YSIFIKSLFHNFPSIVLPNE NGGTPNHRPTGRGNNISSHH in isoform 4. 1 PublicationVSP_057220Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF114834 mRNA. Translation: AAP97233.1.
AK057034 mRNA. Translation: BAB71352.1.
AK303397 mRNA. Translation: BAG64453.1.
AK316468 mRNA. Translation: BAH14839.1.
AK222579 mRNA. Translation: BAD96299.1.
AL833959 mRNA. Translation: CAD38809.2.
AC146507 Genomic DNA. No translation available.
BC000745 mRNA. Translation: AAH00745.1.
CCDSiCCDS4416.1. [Q9BW11-1]
CCDS47347.1. [Q9BW11-3]
RefSeqiNP_001136407.1. NM_001142935.1. [Q9BW11-3]
NP_112590.1. NM_031300.3. [Q9BW11-1]
UniGeneiHs.743332.

Genome annotation databases

EnsembliENST00000423571; ENSP00000389716; ENSG00000213347. [Q9BW11-4]
ENST00000427908; ENSP00000416921; ENSG00000213347. [Q9BW11-3]
ENST00000439742; ENSP00000401867; ENSG00000213347. [Q9BW11-1]
ENST00000513063; ENSP00000421463; ENSG00000213347. [Q9BW11-1]
GeneIDi83463.
KEGGihsa:83463.
UCSCiuc003mga.3. human.
uc003mgb.2. human. [Q9BW11-1]
uc010jkk.2. human. [Q9BW11-3]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF114834 mRNA. Translation: AAP97233.1.
AK057034 mRNA. Translation: BAB71352.1.
AK303397 mRNA. Translation: BAG64453.1.
AK316468 mRNA. Translation: BAH14839.1.
AK222579 mRNA. Translation: BAD96299.1.
AL833959 mRNA. Translation: CAD38809.2.
AC146507 Genomic DNA. No translation available.
BC000745 mRNA. Translation: AAH00745.1.
CCDSiCCDS4416.1. [Q9BW11-1]
CCDS47347.1. [Q9BW11-3]
RefSeqiNP_001136407.1. NM_001142935.1. [Q9BW11-3]
NP_112590.1. NM_031300.3. [Q9BW11-1]
UniGeneiHs.743332.

3D structure databases

ProteinModelPortaliQ9BW11.
SMRiQ9BW11. Positions 59-136.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123658. 8 interactions.
IntActiQ9BW11. 3 interactions.
MINTiMINT-1468092.
STRINGi9606.ENSP00000401867.

PTM databases

PhosphoSiteiQ9BW11.

Polymorphism and mutation databases

BioMutaiMXD3.
DMDMi74733390.

Proteomic databases

PaxDbiQ9BW11.
PRIDEiQ9BW11.

Protocols and materials databases

DNASUi83463.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000423571; ENSP00000389716; ENSG00000213347. [Q9BW11-4]
ENST00000427908; ENSP00000416921; ENSG00000213347. [Q9BW11-3]
ENST00000439742; ENSP00000401867; ENSG00000213347. [Q9BW11-1]
ENST00000513063; ENSP00000421463; ENSG00000213347. [Q9BW11-1]
GeneIDi83463.
KEGGihsa:83463.
UCSCiuc003mga.3. human.
uc003mgb.2. human. [Q9BW11-1]
uc010jkk.2. human. [Q9BW11-3]

Organism-specific databases

CTDi83463.
GeneCardsiGC05M176744.
HGNCiHGNC:14008. MXD3.
MIMi609450. gene.
neXtProtiNX_Q9BW11.
PharmGKBiPA134892226.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG247787.
GeneTreeiENSGT00510000046360.
HOGENOMiHOG000247060.
HOVERGENiHBG006314.
InParanoidiQ9BW11.
KOiK09114.
OMAiEWTKRTL.
OrthoDBiEOG76T9V0.
PhylomeDBiQ9BW11.
TreeFamiTF315654.

Miscellaneous databases

ChiTaRSiMXD3. human.
GenomeRNAii83463.
NextBioi35476771.
PROiQ9BW11.
SOURCEiSearch...

Gene expression databases

BgeeiQ9BW11.
CleanExiHS_MXD3.
ExpressionAtlasiQ9BW11. baseline and differential.
GenevisibleiQ9BW11. HS.

Family and domain databases

Gene3Di4.10.280.10. 1 hit.
InterProiIPR011598. bHLH_dom.
[Graphical view]
PfamiPF00010. HLH. 1 hit.
[Graphical view]
SMARTiSM00353. HLH. 1 hit.
[Graphical view]
SUPFAMiSSF47459. SSF47459. 1 hit.
PROSITEiPS50888. BHLH. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Cloning and sequencing of a new human cDNA homologous to Rattus norvegicus Myx mRNA."
    Zhang P.Z., Yu L., Ding J.B., Dai F.Y., Fu S.N., Zhao S.Y.
    Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 3 AND 4).
    Tissue: Thymus.
  3. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Coronary artery.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Testis.
  5. "The DNA sequence and comparative analysis of human chromosome 5."
    Schmutz J., Martin J., Terry A., Couronne O., Grimwood J., Lowry S., Gordon L.A., Scott D., Xie G., Huang W., Hellsten U., Tran-Gyamfi M., She X., Prabhakar S., Aerts A., Altherr M., Bajorek E., Black S.
    , Branscomb E., Caoile C., Challacombe J.F., Chan Y.M., Denys M., Detter J.C., Escobar J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Israni S., Jett J., Kadner K., Kimball H., Kobayashi A., Lopez F., Lou Y., Martinez D., Medina C., Morgan J., Nandkeshwar R., Noonan J.P., Pitluck S., Pollard M., Predki P., Priest J., Ramirez L., Retterer J., Rodriguez A., Rogers S., Salamov A., Salazar A., Thayer N., Tice H., Tsai M., Ustaszewska A., Vo N., Wheeler J., Wu K., Yang J., Dickson M., Cheng J.-F., Eichler E.E., Olsen A., Pennacchio L.A., Rokhsar D.S., Richardson P., Lucas S.M., Myers R.M., Rubin E.M.
    Nature 431:268-274(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung.

Entry informationi

Entry nameiMAD3_HUMAN
AccessioniPrimary (citable) accession number: Q9BW11
Secondary accession number(s): B4E0J1
, Q53HK1, Q7Z4Y0, Q8NDJ7, Q96ME3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 17, 2006
Last sequence update: June 1, 2001
Last modified: June 24, 2015
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 5
    Human chromosome 5: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.