Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BVV6

- TALD3_HUMAN

UniProt

Q9BVV6 - TALD3_HUMAN

Protein

Protein TALPID3

Gene

KIAA0586

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 95 (01 Oct 2014)
      Sequence version 4 (05 Apr 2011)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Required for ciliogenesis and sonic hedgehog/SHH signaling.By similarity

    GO - Biological processi

    1. cilium assembly Source: MGI
    2. cilium morphogenesis Source: UniProtKB
    3. regulation of establishment of protein localization Source: MGI
    4. smoothened signaling pathway Source: UniProtKB

    Keywords - Biological processi

    Cilium biogenesis/degradation

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Protein TALPID3
    Gene namesi
    Name:KIAA0586
    Synonyms:TALPID3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 14

    Organism-specific databases

    HGNCiHGNC:19960. KIAA0586.

    Subcellular locationi

    Cytoplasmcytoskeletonmicrotubule organizing centercentrosome 2 Publications

    GO - Cellular componenti

    1. centrosome Source: UniProtKB
    2. ciliary basal body Source: MGI
    3. cytoplasm Source: UniProtKB-KW

    Keywords - Cellular componenti

    Cytoplasm, Cytoskeleton

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134992213.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 15331533Protein TALPID3PRO_0000050766Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Cross-linki380 – 380Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication

    Keywords - PTMi

    Isopeptide bond, Ubl conjugation

    Proteomic databases

    MaxQBiQ9BVV6.
    PaxDbiQ9BVV6.
    PRIDEiQ9BVV6.

    PTM databases

    PhosphoSiteiQ9BVV6.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9BVV6.
    BgeeiQ9BVV6.
    CleanExiHS_KIAA0586.
    GenevestigatoriQ9BVV6.

    Organism-specific databases

    HPAiHPA000846.
    HPA050249.

    Interactioni

    Protein-protein interaction databases

    BioGridi115130. 3 interactions.
    STRINGi9606.ENSP00000261244.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BVV6.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni467 – 55488Required for centrosomal localizationBy similarityAdd
    BLAST

    Coiled coil

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Coiled coili182 – 22342Sequence AnalysisAdd
    BLAST
    Coiled coili467 – 50135Sequence AnalysisAdd
    BLAST

    Compositional bias

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Compositional biasi247 – 2504Poly-Gln
    Compositional biasi1180 – 11878Poly-Pro

    Sequence similaritiesi

    Belongs to the TALPID3 family.Curated

    Keywords - Domaini

    Coiled coil

    Phylogenomic databases

    eggNOGiNOG40443.
    HOGENOMiHOG000168599.
    HOVERGENiHBG052187.
    InParanoidiQ9BVV6.
    OMAiIQWVEQE.
    OrthoDBiEOG7SXW2T.
    PhylomeDBiQ9BVV6.
    TreeFamiTF332939.

    Family and domain databases

    InterProiIPR029246. TALPID3.
    [Graphical view]
    PANTHERiPTHR15721. PTHR15721. 1 hit.
    PfamiPF15324. TALPID3. 1 hit.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BVV6-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MPVKRLREVV SQNHGDHLVL LKDELPCVPP ALSANKRLPV GTGTSLNGTS     50
    RGSSDLTSAR NCYQPLLENP MVSESDFSKD VAVQVLPLDK IEENNKQKAN 100
    DIFISQYTMG QKDALRTVLK QKAQSMPVFK EVKVHLLEDA GIEKDAVTQE 150
    TRISPSGIDS ATTVAAATAA AIATAAPLIK VQSDLEAKVN SVTELLSKLQ 200
    ETDKHLQRVT EQQTSIQRKQ EKLHCHDHEK QMNVFMEQHI RHLEKLQQQQ 250
    IDIQTHFISA ALKTSSFQPV SMPSSRAVEK YSVKPEHPNL GSCNPSLYNT 300
    FASKQAPLKE VEDTSFDKQK SPLETPAPRR FAPVPVSRDD ELSKRENLLE 350
    EKENMEVSCH RGNVRLLEQI LNNNDSLTRK SESSNTTSLT RSKIGWTPEK 400
    TNRFPSCEEL ETTKVTMQKS DDVLHDLGQK EKETNSMVQP KESLSMLKLP 450
    DLPQNSVKLQ TTNTTRSVLK DAEKILRGVQ NNKKVLEENL EAIIRAKDGA 500
    AMYSLINALS TNREMSEKIR IRKTVDEWIK TISAEIQDEL SRTDYEQKRF 550
    DQKNQRTKKG QNMTKDIRTN TQDKTVNKSV IPRKHSQKQI EEHFRNLPMR 600
    GMPASSLQKE RKEGLLKATT VIQDEDYMLQ VYGKPVYQGH RSTLKKGPYL 650
    RFNSPSPKSR PQRPKVIERV KGTKVKSIRT QTDFYATKPK KMDSKMKHSV 700
    PVLPHGDQQY LFSPSREMPT FSGTLEGHLI PMAILLGQTQ SNSDTMPPAG 750
    VIVSKPHPVT VTTSIPPSSR KVETGVKKPN IAIVEMKSEK KDPPQLTVQV 800
    LPSVDIDSIS NSSADVLSPL SSPKEASLPP VQTWIKTPEI MKVDEEEVKF 850
    PGTNFDEIID VIQEEEKCDE IPDSEPILEF NRSVKADSTK YNGPPFPPVA 900
    STFQPTADIL DKVIERKETL ENSLIQWVEQ EIMSRIISGL FPVQQQIAPS 950
    ISVSVSETSE PLTSDIVEGT SSGALQLFVD AGVPVNSNVI KHFVNEALAE 1000
    TIAVMLGDRE AKKQGPVATG VSGDASTNET YLPARVCTPL PTPQPTPPCS 1050
    PSSPAKECVL VKTPDSSPCD SDHDMAFPVK EICAEKGDDM PAIMLVNTPT 1100
    VTPTTTPPPA AAVFTPTLSD ISIDKLKVSS PELPKPWGDG DLPLEEENPN 1150
    SPQEELHPRA IVMSVAKDEE PESMDFPAQP PPPEPVPFMP FPAGTKAPSP 1200
    SQMPGSDSST LESTLSVTVT ETETLDKPIS EGEILFSCGQ KLAPKILEDI 1250
    GLYLTNLNDS LSSTLHDAVE MEDDPPSEGQ VIRMSHKKFH ADAILSFAKQ 1300
    NQESAVSQQA VYHSEDLENS VGELSEGQRP QLTAAAENIL MGHSLYMQPP 1350
    VTNTQSLDQQ CDPKPLSRQF DTVSGSIYED SCASHGPMSL GELELEPNSK 1400
    LVLPTTLLTA QENDVNLPVA AEDFSQYQLK QNQDVKQVEH KPSQSYLRVR 1450
    NKSDIAPSQQ QVSPGDMDRT QIELNPYLTC VFSGGKAVPL SASQMPPAKM 1500
    SVMLPSVNLE DCSQSLSLST MQEDMESSGA DTF 1533
    Length:1,533
    Mass (Da):169,307
    Last modified:April 5, 2011 - v4
    Checksum:i031F5F28D63FD612
    GO
    Isoform 2 (identifier: Q9BVV6-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MKGSEVSLEKKKKIKM
         538-613: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:1,472
    Mass (Da):161,895
    Checksum:i63C425B27AC49E13
    GO
    Isoform 3 (identifier: Q9BVV6-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-1: M → MFWCGTCFVTNNMKGSEVSLEKKKKIKM
         122-122: K → NVSLCLTGWSDHSGVITTHCSLYLLRLMRSSHLSLPSSWDYR
         1485-1532: GKAVPLSASQ...EDMESSGADT → LGVHVKKVSC...RQPAQCLCHW

    Note: No experimental confirmation available.Curated

    Show »
    Length:1,644
    Mass (Da):182,002
    Checksum:iA1E4498F393D0822
    GO
    Isoform 4 (identifier: Q9BVV6-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-70: Missing.
         122-122: K → NVSLCLTGWSDHSGVITTHCSLYLLRLMRSSHLSLPSSWDYR

    Show »
    Length:1,504
    Mass (Da):166,422
    Checksum:i1AD93094E18A3F5D
    GO

    Sequence cautioni

    The sequence BAA25512.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti1041 – 10411P → A in BAA25512. (PubMed:9628581)Curated
    Sequence conflicti1041 – 10411P → A in BAG64028. (PubMed:14702039)Curated
    Sequence conflicti1041 – 10411P → A in EAW80740. 1 PublicationCurated
    Sequence conflicti1041 – 10411P → A in AAH66647. (PubMed:15489334)Curated
    Isoform 3 (identifier: Q9BVV6-3)
    Sequence conflicti1568 – 15681L → P in BAG64028. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti828 – 8281L → P.5 Publications
    Corresponds to variant rs1748986 [ dbSNP | Ensembl ].
    VAR_069108

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 7070Missing in isoform 4. 1 PublicationVSP_046387Add
    BLAST
    Alternative sequencei1 – 11M → MKGSEVSLEKKKKIKM in isoform 2. 1 PublicationVSP_040642
    Alternative sequencei1 – 11M → MFWCGTCFVTNNMKGSEVSL EKKKKIKM in isoform 3. 1 PublicationVSP_046005
    Alternative sequencei122 – 1221K → NVSLCLTGWSDHSGVITTHC SLYLLRLMRSSHLSLPSSWD YR in isoform 3 and isoform 4. 2 PublicationsVSP_046006
    Alternative sequencei538 – 61376Missing in isoform 2. 1 PublicationVSP_040643Add
    BLAST
    Alternative sequencei1485 – 153248GKAVP…SGADT → LGVHVKKVSCIGKLGLWRFV IQIISSPRWESSATLRFTDA PCQDVSDAAVSEPRGLLSVS ESQHNAGGHGVFGGRYLLNG KRQPAQCLCHW in isoform 3. 1 PublicationVSP_046007Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY359881 mRNA. Translation: AAQ63404.1.
    AB011158 mRNA. Translation: BAA25512.2. Different initiation.
    AK302836 mRNA. Translation: BAG64028.1.
    AL135752 Genomic DNA. No translation available.
    AL139021 Genomic DNA. No translation available.
    CH471061 Genomic DNA. Translation: EAW80740.1.
    BC000900 mRNA. Translation: AAH00900.1.
    BC066647 mRNA. Translation: AAH66647.2.
    CCDSiCCDS45115.1. [Q9BVV6-2]
    CCDS58320.1. [Q9BVV6-3]
    CCDS58321.1. [Q9BVV6-1]
    CCDS58322.1. [Q9BVV6-4]
    PIRiT00344.
    RefSeqiNP_001231118.1. NM_001244189.1. [Q9BVV6-3]
    NP_001231119.1. NM_001244190.1. [Q9BVV6-1]
    NP_001231120.1. NM_001244191.1.
    NP_001231121.1. NM_001244192.1. [Q9BVV6-4]
    NP_001231122.1. NM_001244193.1.
    NP_055564.3. NM_014749.3. [Q9BVV6-2]
    UniGeneiHs.232532.

    Genome annotation databases

    EnsembliENST00000261244; ENSP00000261244; ENSG00000100578. [Q9BVV6-2]
    ENST00000354386; ENSP00000346359; ENSG00000100578. [Q9BVV6-3]
    ENST00000423743; ENSP00000399427; ENSG00000100578. [Q9BVV6-4]
    ENST00000556134; ENSP00000452351; ENSG00000100578. [Q9BVV6-1]
    GeneIDi9786.
    KEGGihsa:9786.
    UCSCiuc001xdu.4. human. [Q9BVV6-1]
    uc001xdv.4. human. [Q9BVV6-2]

    Polymorphism databases

    DMDMi327478601.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AY359881 mRNA. Translation: AAQ63404.1 .
    AB011158 mRNA. Translation: BAA25512.2 . Different initiation.
    AK302836 mRNA. Translation: BAG64028.1 .
    AL135752 Genomic DNA. No translation available.
    AL139021 Genomic DNA. No translation available.
    CH471061 Genomic DNA. Translation: EAW80740.1 .
    BC000900 mRNA. Translation: AAH00900.1 .
    BC066647 mRNA. Translation: AAH66647.2 .
    CCDSi CCDS45115.1. [Q9BVV6-2 ]
    CCDS58320.1. [Q9BVV6-3 ]
    CCDS58321.1. [Q9BVV6-1 ]
    CCDS58322.1. [Q9BVV6-4 ]
    PIRi T00344.
    RefSeqi NP_001231118.1. NM_001244189.1. [Q9BVV6-3 ]
    NP_001231119.1. NM_001244190.1. [Q9BVV6-1 ]
    NP_001231120.1. NM_001244191.1.
    NP_001231121.1. NM_001244192.1. [Q9BVV6-4 ]
    NP_001231122.1. NM_001244193.1.
    NP_055564.3. NM_014749.3. [Q9BVV6-2 ]
    UniGenei Hs.232532.

    3D structure databases

    ProteinModelPortali Q9BVV6.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 115130. 3 interactions.
    STRINGi 9606.ENSP00000261244.

    PTM databases

    PhosphoSitei Q9BVV6.

    Polymorphism databases

    DMDMi 327478601.

    Proteomic databases

    MaxQBi Q9BVV6.
    PaxDbi Q9BVV6.
    PRIDEi Q9BVV6.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000261244 ; ENSP00000261244 ; ENSG00000100578 . [Q9BVV6-2 ]
    ENST00000354386 ; ENSP00000346359 ; ENSG00000100578 . [Q9BVV6-3 ]
    ENST00000423743 ; ENSP00000399427 ; ENSG00000100578 . [Q9BVV6-4 ]
    ENST00000556134 ; ENSP00000452351 ; ENSG00000100578 . [Q9BVV6-1 ]
    GeneIDi 9786.
    KEGGi hsa:9786.
    UCSCi uc001xdu.4. human. [Q9BVV6-1 ]
    uc001xdv.4. human. [Q9BVV6-2 ]

    Organism-specific databases

    CTDi 9786.
    GeneCardsi GC14P058894.
    HGNCi HGNC:19960. KIAA0586.
    HPAi HPA000846.
    HPA050249.
    MIMi 610178. gene.
    neXtProti NX_Q9BVV6.
    PharmGKBi PA134992213.
    HUGEi Search...
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG40443.
    HOGENOMi HOG000168599.
    HOVERGENi HBG052187.
    InParanoidi Q9BVV6.
    OMAi IQWVEQE.
    OrthoDBi EOG7SXW2T.
    PhylomeDBi Q9BVV6.
    TreeFami TF332939.

    Miscellaneous databases

    GenomeRNAii 9786.
    NextBioi 35535343.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BVV6.
    Bgeei Q9BVV6.
    CleanExi HS_KIAA0586.
    Genevestigatori Q9BVV6.

    Family and domain databases

    InterProi IPR029246. TALPID3.
    [Graphical view ]
    PANTHERi PTHR15721. PTHR15721. 1 hit.
    Pfami PF15324. TALPID3. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Cloning an isoform of KIAA0586 gene related to spermatogenesis."
      Zhen Y., Huo R., Lu L., Xu M., Yin L.L., Xu Z.Y., Li J.M., Zhou Z.M., Sha J.H.
      Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), VARIANT PRO-828.
    2. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
      Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
      DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-828.
      Tissue: Brain.
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT PRO-828.
      Tissue: Testis.
    4. "The DNA sequence and analysis of human chromosome 14."
      Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
      , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
      Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT PRO-828.
    6. "Proteomic characterization of the human centrosome by protein correlation profiling."
      Andersen J.S., Wilkinson C.J., Mayor T., Mortensen P., Nigg E.A., Mann M.
      Nature 426:570-574(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS].
      Tissue: Lymphoblast.
    7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT PRO-828.
      Tissue: Placenta and Skin.
    8. "Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry."
      Denis N.J., Vasilescu J., Lambert J.-P., Smith J.C., Figeys D.
      Proteomics 7:868-874(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-380.
      Tissue: Mammary cancer.
    9. "The Talpid3 gene (KIAA0586) encodes a centrosomal protein that is essential for primary cilia formation."
      Yin Y., Bangs F., Paton I.R., Prescott A., James J., Davey M.G., Whitley P., Genikhovich G., Technau U., Burt D.W., Tickle C.
      Development 136:655-664(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiTALD3_HUMAN
    AccessioniPrimary (citable) accession number: Q9BVV6
    Secondary accession number(s): B4DZB6
    , E7EWM8, J3KQH9, O60328, Q6NYC6, Q6UV20
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: January 23, 2002
    Last sequence update: April 5, 2011
    Last modified: October 1, 2014
    This is version 95 of the entry and version 4 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 14
      Human chromosome 14: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3