SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BVV6

- TALD3_HUMAN

UniProt

Q9BVV6 - TALD3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
Protein TALPID3
Gene
KIAA0586, TALPID3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Required for ciliogenesis and sonic hedgehog/SHH signaling By similarity.

GO - Biological processi

  1. cilium assembly Source: MGI
  2. cilium morphogenesis Source: UniProtKB
  3. regulation of establishment of protein localization Source: MGI
  4. smoothened signaling pathway Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cilium biogenesis/degradation

Names & Taxonomyi

Protein namesi
Recommended name:
Protein TALPID3
Gene namesi
Synonyms:TALPID3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:19960. KIAA0586.

Subcellular locationi

Cytoplasmcytoskeletonmicrotubule organizing centercentrosome 2 Publications

GO - Cellular componenti

  1. centrosome Source: UniProtKB
  2. ciliary basal body Source: MGI
  3. cytoplasm Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134992213.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 15331533Protein TALPID3
PRO_0000050766Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki380 – 380Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

MaxQBiQ9BVV6.
PaxDbiQ9BVV6.
PRIDEiQ9BVV6.

PTM databases

PhosphoSiteiQ9BVV6.

Expressioni

Gene expression databases

ArrayExpressiQ9BVV6.
BgeeiQ9BVV6.
CleanExiHS_KIAA0586.
GenevestigatoriQ9BVV6.

Organism-specific databases

HPAiHPA000846.
HPA050249.

Interactioni

Protein-protein interaction databases

BioGridi115130. 3 interactions.
STRINGi9606.ENSP00000261244.

Structurei

3D structure databases

ProteinModelPortaliQ9BVV6.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni467 – 55488Required for centrosomal localization By similarity
Add
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili182 – 22342 Reviewed prediction
Add
BLAST
Coiled coili467 – 50135 Reviewed prediction
Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi247 – 2504Poly-Gln
Compositional biasi1180 – 11878Poly-Pro

Sequence similaritiesi

Belongs to the TALPID3 family.

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG40443.
HOGENOMiHOG000168599.
HOVERGENiHBG052187.
InParanoidiQ9BVV6.
OMAiIQWVEQE.
OrthoDBiEOG7SXW2T.
PhylomeDBiQ9BVV6.
TreeFamiTF332939.

Family and domain databases

InterProiIPR029246. TALPID3.
[Graphical view]
PANTHERiPTHR15721. PTHR15721. 1 hit.
PfamiPF15324. TALPID3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BVV6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MPVKRLREVV SQNHGDHLVL LKDELPCVPP ALSANKRLPV GTGTSLNGTS     50
RGSSDLTSAR NCYQPLLENP MVSESDFSKD VAVQVLPLDK IEENNKQKAN 100
DIFISQYTMG QKDALRTVLK QKAQSMPVFK EVKVHLLEDA GIEKDAVTQE 150
TRISPSGIDS ATTVAAATAA AIATAAPLIK VQSDLEAKVN SVTELLSKLQ 200
ETDKHLQRVT EQQTSIQRKQ EKLHCHDHEK QMNVFMEQHI RHLEKLQQQQ 250
IDIQTHFISA ALKTSSFQPV SMPSSRAVEK YSVKPEHPNL GSCNPSLYNT 300
FASKQAPLKE VEDTSFDKQK SPLETPAPRR FAPVPVSRDD ELSKRENLLE 350
EKENMEVSCH RGNVRLLEQI LNNNDSLTRK SESSNTTSLT RSKIGWTPEK 400
TNRFPSCEEL ETTKVTMQKS DDVLHDLGQK EKETNSMVQP KESLSMLKLP 450
DLPQNSVKLQ TTNTTRSVLK DAEKILRGVQ NNKKVLEENL EAIIRAKDGA 500
AMYSLINALS TNREMSEKIR IRKTVDEWIK TISAEIQDEL SRTDYEQKRF 550
DQKNQRTKKG QNMTKDIRTN TQDKTVNKSV IPRKHSQKQI EEHFRNLPMR 600
GMPASSLQKE RKEGLLKATT VIQDEDYMLQ VYGKPVYQGH RSTLKKGPYL 650
RFNSPSPKSR PQRPKVIERV KGTKVKSIRT QTDFYATKPK KMDSKMKHSV 700
PVLPHGDQQY LFSPSREMPT FSGTLEGHLI PMAILLGQTQ SNSDTMPPAG 750
VIVSKPHPVT VTTSIPPSSR KVETGVKKPN IAIVEMKSEK KDPPQLTVQV 800
LPSVDIDSIS NSSADVLSPL SSPKEASLPP VQTWIKTPEI MKVDEEEVKF 850
PGTNFDEIID VIQEEEKCDE IPDSEPILEF NRSVKADSTK YNGPPFPPVA 900
STFQPTADIL DKVIERKETL ENSLIQWVEQ EIMSRIISGL FPVQQQIAPS 950
ISVSVSETSE PLTSDIVEGT SSGALQLFVD AGVPVNSNVI KHFVNEALAE 1000
TIAVMLGDRE AKKQGPVATG VSGDASTNET YLPARVCTPL PTPQPTPPCS 1050
PSSPAKECVL VKTPDSSPCD SDHDMAFPVK EICAEKGDDM PAIMLVNTPT 1100
VTPTTTPPPA AAVFTPTLSD ISIDKLKVSS PELPKPWGDG DLPLEEENPN 1150
SPQEELHPRA IVMSVAKDEE PESMDFPAQP PPPEPVPFMP FPAGTKAPSP 1200
SQMPGSDSST LESTLSVTVT ETETLDKPIS EGEILFSCGQ KLAPKILEDI 1250
GLYLTNLNDS LSSTLHDAVE MEDDPPSEGQ VIRMSHKKFH ADAILSFAKQ 1300
NQESAVSQQA VYHSEDLENS VGELSEGQRP QLTAAAENIL MGHSLYMQPP 1350
VTNTQSLDQQ CDPKPLSRQF DTVSGSIYED SCASHGPMSL GELELEPNSK 1400
LVLPTTLLTA QENDVNLPVA AEDFSQYQLK QNQDVKQVEH KPSQSYLRVR 1450
NKSDIAPSQQ QVSPGDMDRT QIELNPYLTC VFSGGKAVPL SASQMPPAKM 1500
SVMLPSVNLE DCSQSLSLST MQEDMESSGA DTF 1533
Length:1,533
Mass (Da):169,307
Last modified:April 5, 2011 - v4
Checksum:i031F5F28D63FD612
GO
Isoform 2 (identifier: Q9BVV6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKGSEVSLEKKKKIKM
     538-613: Missing.

Note: No experimental confirmation available.

Show »
Length:1,472
Mass (Da):161,895
Checksum:i63C425B27AC49E13
GO
Isoform 3 (identifier: Q9BVV6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFWCGTCFVTNNMKGSEVSLEKKKKIKM
     122-122: K → NVSLCLTGWSDHSGVITTHCSLYLLRLMRSSHLSLPSSWDYR
     1485-1532: GKAVPLSASQ...EDMESSGADT → LGVHVKKVSC...RQPAQCLCHW

Note: No experimental confirmation available.

Show »
Length:1,644
Mass (Da):182,002
Checksum:iA1E4498F393D0822
GO
Isoform 4 (identifier: Q9BVV6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.
     122-122: K → NVSLCLTGWSDHSGVITTHCSLYLLRLMRSSHLSLPSSWDYR

Show »
Length:1,504
Mass (Da):166,422
Checksum:i1AD93094E18A3F5D
GO

Sequence cautioni

The sequence BAA25512.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti828 – 8281L → P.5 Publications
Corresponds to variant rs1748986 [ dbSNP | Ensembl ].
VAR_069108

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7070Missing in isoform 4.
VSP_046387Add
BLAST
Alternative sequencei1 – 11M → MKGSEVSLEKKKKIKM in isoform 2.
VSP_040642
Alternative sequencei1 – 11M → MFWCGTCFVTNNMKGSEVSL EKKKKIKM in isoform 3.
VSP_046005
Alternative sequencei122 – 1221K → NVSLCLTGWSDHSGVITTHC SLYLLRLMRSSHLSLPSSWD YR in isoform 3 and isoform 4.
VSP_046006
Alternative sequencei538 – 61376Missing in isoform 2.
VSP_040643Add
BLAST
Alternative sequencei1485 – 153248GKAVP…SGADT → LGVHVKKVSCIGKLGLWRFV IQIISSPRWESSATLRFTDA PCQDVSDAAVSEPRGLLSVS ESQHNAGGHGVFGGRYLLNG KRQPAQCLCHW in isoform 3.
VSP_046007Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1041 – 10411P → A in BAA25512. 1 Publication
Sequence conflicti1041 – 10411P → A in BAG64028. 1 Publication
Sequence conflicti1041 – 10411P → A in EAW80740. 1 Publication
Sequence conflicti1041 – 10411P → A in AAH66647. 1 Publication
Isoform 3 (identifier: Q9BVV6-3)
Sequence conflicti1568 – 15681L → P in BAG64028. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY359881 mRNA. Translation: AAQ63404.1.
AB011158 mRNA. Translation: BAA25512.2. Different initiation.
AK302836 mRNA. Translation: BAG64028.1.
AL135752 Genomic DNA. No translation available.
AL139021 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW80740.1.
BC000900 mRNA. Translation: AAH00900.1.
BC066647 mRNA. Translation: AAH66647.2.
CCDSiCCDS45115.1. [Q9BVV6-2]
CCDS58320.1. [Q9BVV6-3]
CCDS58321.1. [Q9BVV6-1]
CCDS58322.1. [Q9BVV6-4]
PIRiT00344.
RefSeqiNP_001231118.1. NM_001244189.1. [Q9BVV6-3]
NP_001231119.1. NM_001244190.1. [Q9BVV6-1]
NP_001231120.1. NM_001244191.1.
NP_001231121.1. NM_001244192.1. [Q9BVV6-4]
NP_001231122.1. NM_001244193.1.
NP_055564.3. NM_014749.3. [Q9BVV6-2]
UniGeneiHs.232532.

Genome annotation databases

EnsembliENST00000261244; ENSP00000261244; ENSG00000100578. [Q9BVV6-2]
ENST00000354386; ENSP00000346359; ENSG00000100578. [Q9BVV6-3]
ENST00000423743; ENSP00000399427; ENSG00000100578. [Q9BVV6-4]
ENST00000556134; ENSP00000452351; ENSG00000100578. [Q9BVV6-1]
GeneIDi9786.
KEGGihsa:9786.
UCSCiuc001xdu.4. human. [Q9BVV6-1]
uc001xdv.4. human. [Q9BVV6-2]

Polymorphism databases

DMDMi327478601.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY359881 mRNA. Translation: AAQ63404.1 .
AB011158 mRNA. Translation: BAA25512.2 . Different initiation.
AK302836 mRNA. Translation: BAG64028.1 .
AL135752 Genomic DNA. No translation available.
AL139021 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW80740.1 .
BC000900 mRNA. Translation: AAH00900.1 .
BC066647 mRNA. Translation: AAH66647.2 .
CCDSi CCDS45115.1. [Q9BVV6-2 ]
CCDS58320.1. [Q9BVV6-3 ]
CCDS58321.1. [Q9BVV6-1 ]
CCDS58322.1. [Q9BVV6-4 ]
PIRi T00344.
RefSeqi NP_001231118.1. NM_001244189.1. [Q9BVV6-3 ]
NP_001231119.1. NM_001244190.1. [Q9BVV6-1 ]
NP_001231120.1. NM_001244191.1.
NP_001231121.1. NM_001244192.1. [Q9BVV6-4 ]
NP_001231122.1. NM_001244193.1.
NP_055564.3. NM_014749.3. [Q9BVV6-2 ]
UniGenei Hs.232532.

3D structure databases

ProteinModelPortali Q9BVV6.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115130. 3 interactions.
STRINGi 9606.ENSP00000261244.

PTM databases

PhosphoSitei Q9BVV6.

Polymorphism databases

DMDMi 327478601.

Proteomic databases

MaxQBi Q9BVV6.
PaxDbi Q9BVV6.
PRIDEi Q9BVV6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000261244 ; ENSP00000261244 ; ENSG00000100578 . [Q9BVV6-2 ]
ENST00000354386 ; ENSP00000346359 ; ENSG00000100578 . [Q9BVV6-3 ]
ENST00000423743 ; ENSP00000399427 ; ENSG00000100578 . [Q9BVV6-4 ]
ENST00000556134 ; ENSP00000452351 ; ENSG00000100578 . [Q9BVV6-1 ]
GeneIDi 9786.
KEGGi hsa:9786.
UCSCi uc001xdu.4. human. [Q9BVV6-1 ]
uc001xdv.4. human. [Q9BVV6-2 ]

Organism-specific databases

CTDi 9786.
GeneCardsi GC14P058894.
HGNCi HGNC:19960. KIAA0586.
HPAi HPA000846.
HPA050249.
MIMi 610178. gene.
neXtProti NX_Q9BVV6.
PharmGKBi PA134992213.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG40443.
HOGENOMi HOG000168599.
HOVERGENi HBG052187.
InParanoidi Q9BVV6.
OMAi IQWVEQE.
OrthoDBi EOG7SXW2T.
PhylomeDBi Q9BVV6.
TreeFami TF332939.

Miscellaneous databases

GenomeRNAii 9786.
NextBioi 35535343.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9BVV6.
Bgeei Q9BVV6.
CleanExi HS_KIAA0586.
Genevestigatori Q9BVV6.

Family and domain databases

InterProi IPR029246. TALPID3.
[Graphical view ]
PANTHERi PTHR15721. PTHR15721. 1 hit.
Pfami PF15324. TALPID3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning an isoform of KIAA0586 gene related to spermatogenesis."
    Zhen Y., Huo R., Lu L., Xu M., Yin L.L., Xu Z.Y., Li J.M., Zhou Z.M., Sha J.H.
    Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), VARIANT PRO-828.
  2. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-828.
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT PRO-828.
    Tissue: Testis.
  4. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT PRO-828.
  6. "Proteomic characterization of the human centrosome by protein correlation profiling."
    Andersen J.S., Wilkinson C.J., Mayor T., Mortensen P., Nigg E.A., Mann M.
    Nature 426:570-574(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS].
    Tissue: Lymphoblast.
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT PRO-828.
    Tissue: Placenta and Skin.
  8. "Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry."
    Denis N.J., Vasilescu J., Lambert J.-P., Smith J.C., Figeys D.
    Proteomics 7:868-874(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-380.
    Tissue: Mammary cancer.
  9. "The Talpid3 gene (KIAA0586) encodes a centrosomal protein that is essential for primary cilia formation."
    Yin Y., Bangs F., Paton I.R., Prescott A., James J., Davey M.G., Whitley P., Genikhovich G., Technau U., Burt D.W., Tickle C.
    Development 136:655-664(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.

Entry informationi

Entry nameiTALD3_HUMAN
AccessioniPrimary (citable) accession number: Q9BVV6
Secondary accession number(s): B4DZB6
, E7EWM8, J3KQH9, O60328, Q6NYC6, Q6UV20
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: April 5, 2011
Last modified: September 3, 2014
This is version 94 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi