Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BVV6

- TALD3_HUMAN

UniProt

Q9BVV6 - TALD3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Protein TALPID3

Gene

KIAA0586

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Required for ciliogenesis and sonic hedgehog/SHH signaling.By similarity

GO - Biological processi

  1. cilium assembly Source: MGI
  2. cilium morphogenesis Source: UniProtKB
  3. regulation of establishment of protein localization Source: MGI
  4. smoothened signaling pathway Source: UniProtKB
Complete GO annotation...

Keywords - Biological processi

Cilium biogenesis/degradation

Names & Taxonomyi

Protein namesi
Recommended name:
Protein TALPID3
Gene namesi
Name:KIAA0586
Synonyms:TALPID3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 14

Organism-specific databases

HGNCiHGNC:19960. KIAA0586.

Subcellular locationi

Cytoplasmcytoskeletonmicrotubule organizing centercentrosome 2 Publications

GO - Cellular componenti

  1. centrosome Source: UniProtKB
  2. ciliary basal body Source: MGI
  3. cytoplasm Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm, Cytoskeleton

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134992213.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 15331533Protein TALPID3PRO_0000050766Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Cross-linki380 – 380Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin)1 Publication

Keywords - PTMi

Isopeptide bond, Ubl conjugation

Proteomic databases

MaxQBiQ9BVV6.
PaxDbiQ9BVV6.
PRIDEiQ9BVV6.

PTM databases

PhosphoSiteiQ9BVV6.

Expressioni

Gene expression databases

BgeeiQ9BVV6.
CleanExiHS_KIAA0586.
ExpressionAtlasiQ9BVV6. baseline and differential.
GenevestigatoriQ9BVV6.

Organism-specific databases

HPAiHPA000846.
HPA050249.

Interactioni

Protein-protein interaction databases

BioGridi115130. 3 interactions.
STRINGi9606.ENSP00000261244.

Structurei

3D structure databases

ProteinModelPortaliQ9BVV6.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni467 – 55488Required for centrosomal localizationBy similarityAdd
BLAST

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili182 – 22342Sequence AnalysisAdd
BLAST
Coiled coili467 – 50135Sequence AnalysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi247 – 2504Poly-Gln
Compositional biasi1180 – 11878Poly-Pro

Sequence similaritiesi

Belongs to the TALPID3 family.Curated

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiNOG40443.
GeneTreeiENSGT00390000012397.
HOGENOMiHOG000168599.
HOVERGENiHBG052187.
InParanoidiQ9BVV6.
OMAiIQWVEQE.
OrthoDBiEOG7SXW2T.
PhylomeDBiQ9BVV6.
TreeFamiTF332939.

Family and domain databases

InterProiIPR029246. TALPID3.
[Graphical view]
PANTHERiPTHR15721. PTHR15721. 1 hit.
PfamiPF15324. TALPID3. 1 hit.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BVV6-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MPVKRLREVV SQNHGDHLVL LKDELPCVPP ALSANKRLPV GTGTSLNGTS
60 70 80 90 100
RGSSDLTSAR NCYQPLLENP MVSESDFSKD VAVQVLPLDK IEENNKQKAN
110 120 130 140 150
DIFISQYTMG QKDALRTVLK QKAQSMPVFK EVKVHLLEDA GIEKDAVTQE
160 170 180 190 200
TRISPSGIDS ATTVAAATAA AIATAAPLIK VQSDLEAKVN SVTELLSKLQ
210 220 230 240 250
ETDKHLQRVT EQQTSIQRKQ EKLHCHDHEK QMNVFMEQHI RHLEKLQQQQ
260 270 280 290 300
IDIQTHFISA ALKTSSFQPV SMPSSRAVEK YSVKPEHPNL GSCNPSLYNT
310 320 330 340 350
FASKQAPLKE VEDTSFDKQK SPLETPAPRR FAPVPVSRDD ELSKRENLLE
360 370 380 390 400
EKENMEVSCH RGNVRLLEQI LNNNDSLTRK SESSNTTSLT RSKIGWTPEK
410 420 430 440 450
TNRFPSCEEL ETTKVTMQKS DDVLHDLGQK EKETNSMVQP KESLSMLKLP
460 470 480 490 500
DLPQNSVKLQ TTNTTRSVLK DAEKILRGVQ NNKKVLEENL EAIIRAKDGA
510 520 530 540 550
AMYSLINALS TNREMSEKIR IRKTVDEWIK TISAEIQDEL SRTDYEQKRF
560 570 580 590 600
DQKNQRTKKG QNMTKDIRTN TQDKTVNKSV IPRKHSQKQI EEHFRNLPMR
610 620 630 640 650
GMPASSLQKE RKEGLLKATT VIQDEDYMLQ VYGKPVYQGH RSTLKKGPYL
660 670 680 690 700
RFNSPSPKSR PQRPKVIERV KGTKVKSIRT QTDFYATKPK KMDSKMKHSV
710 720 730 740 750
PVLPHGDQQY LFSPSREMPT FSGTLEGHLI PMAILLGQTQ SNSDTMPPAG
760 770 780 790 800
VIVSKPHPVT VTTSIPPSSR KVETGVKKPN IAIVEMKSEK KDPPQLTVQV
810 820 830 840 850
LPSVDIDSIS NSSADVLSPL SSPKEASLPP VQTWIKTPEI MKVDEEEVKF
860 870 880 890 900
PGTNFDEIID VIQEEEKCDE IPDSEPILEF NRSVKADSTK YNGPPFPPVA
910 920 930 940 950
STFQPTADIL DKVIERKETL ENSLIQWVEQ EIMSRIISGL FPVQQQIAPS
960 970 980 990 1000
ISVSVSETSE PLTSDIVEGT SSGALQLFVD AGVPVNSNVI KHFVNEALAE
1010 1020 1030 1040 1050
TIAVMLGDRE AKKQGPVATG VSGDASTNET YLPARVCTPL PTPQPTPPCS
1060 1070 1080 1090 1100
PSSPAKECVL VKTPDSSPCD SDHDMAFPVK EICAEKGDDM PAIMLVNTPT
1110 1120 1130 1140 1150
VTPTTTPPPA AAVFTPTLSD ISIDKLKVSS PELPKPWGDG DLPLEEENPN
1160 1170 1180 1190 1200
SPQEELHPRA IVMSVAKDEE PESMDFPAQP PPPEPVPFMP FPAGTKAPSP
1210 1220 1230 1240 1250
SQMPGSDSST LESTLSVTVT ETETLDKPIS EGEILFSCGQ KLAPKILEDI
1260 1270 1280 1290 1300
GLYLTNLNDS LSSTLHDAVE MEDDPPSEGQ VIRMSHKKFH ADAILSFAKQ
1310 1320 1330 1340 1350
NQESAVSQQA VYHSEDLENS VGELSEGQRP QLTAAAENIL MGHSLYMQPP
1360 1370 1380 1390 1400
VTNTQSLDQQ CDPKPLSRQF DTVSGSIYED SCASHGPMSL GELELEPNSK
1410 1420 1430 1440 1450
LVLPTTLLTA QENDVNLPVA AEDFSQYQLK QNQDVKQVEH KPSQSYLRVR
1460 1470 1480 1490 1500
NKSDIAPSQQ QVSPGDMDRT QIELNPYLTC VFSGGKAVPL SASQMPPAKM
1510 1520 1530
SVMLPSVNLE DCSQSLSLST MQEDMESSGA DTF
Length:1,533
Mass (Da):169,307
Last modified:April 5, 2011 - v4
Checksum:i031F5F28D63FD612
GO
Isoform 2 (identifier: Q9BVV6-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MKGSEVSLEKKKKIKM
     538-613: Missing.

Note: No experimental confirmation available.

Show »
Length:1,472
Mass (Da):161,895
Checksum:i63C425B27AC49E13
GO
Isoform 3 (identifier: Q9BVV6-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MFWCGTCFVTNNMKGSEVSLEKKKKIKM
     122-122: K → NVSLCLTGWSDHSGVITTHCSLYLLRLMRSSHLSLPSSWDYR
     1485-1532: GKAVPLSASQ...EDMESSGADT → LGVHVKKVSC...RQPAQCLCHW

Note: No experimental confirmation available.Curated

Show »
Length:1,644
Mass (Da):182,002
Checksum:iA1E4498F393D0822
GO
Isoform 4 (identifier: Q9BVV6-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-70: Missing.
     122-122: K → NVSLCLTGWSDHSGVITTHCSLYLLRLMRSSHLSLPSSWDYR

Show »
Length:1,504
Mass (Da):166,422
Checksum:i1AD93094E18A3F5D
GO

Sequence cautioni

The sequence BAA25512.2 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti1041 – 10411P → A in BAA25512. (PubMed:9628581)Curated
Sequence conflicti1041 – 10411P → A in BAG64028. (PubMed:14702039)Curated
Sequence conflicti1041 – 10411P → A in EAW80740. 1 PublicationCurated
Sequence conflicti1041 – 10411P → A in AAH66647. (PubMed:15489334)Curated
Isoform 3 (identifier: Q9BVV6-3)
Sequence conflicti1568 – 15681L → P in BAG64028. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti828 – 8281L → P.5 Publications
Corresponds to variant rs1748986 [ dbSNP | Ensembl ].
VAR_069108

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 7070Missing in isoform 4. 1 PublicationVSP_046387Add
BLAST
Alternative sequencei1 – 11M → MKGSEVSLEKKKKIKM in isoform 2. 1 PublicationVSP_040642
Alternative sequencei1 – 11M → MFWCGTCFVTNNMKGSEVSL EKKKKIKM in isoform 3. 1 PublicationVSP_046005
Alternative sequencei122 – 1221K → NVSLCLTGWSDHSGVITTHC SLYLLRLMRSSHLSLPSSWD YR in isoform 3 and isoform 4. 2 PublicationsVSP_046006
Alternative sequencei538 – 61376Missing in isoform 2. 1 PublicationVSP_040643Add
BLAST
Alternative sequencei1485 – 153248GKAVP…SGADT → LGVHVKKVSCIGKLGLWRFV IQIISSPRWESSATLRFTDA PCQDVSDAAVSEPRGLLSVS ESQHNAGGHGVFGGRYLLNG KRQPAQCLCHW in isoform 3. 1 PublicationVSP_046007Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY359881 mRNA. Translation: AAQ63404.1.
AB011158 mRNA. Translation: BAA25512.2. Different initiation.
AK302836 mRNA. Translation: BAG64028.1.
AL135752 Genomic DNA. No translation available.
AL139021 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW80740.1.
BC000900 mRNA. Translation: AAH00900.1.
BC066647 mRNA. Translation: AAH66647.2.
CCDSiCCDS45115.1. [Q9BVV6-2]
CCDS58320.1. [Q9BVV6-3]
CCDS58321.1. [Q9BVV6-1]
CCDS58322.1. [Q9BVV6-4]
PIRiT00344.
RefSeqiNP_001231118.1. NM_001244189.1. [Q9BVV6-3]
NP_001231119.1. NM_001244190.1. [Q9BVV6-1]
NP_001231120.1. NM_001244191.1.
NP_001231121.1. NM_001244192.1. [Q9BVV6-4]
NP_001231122.1. NM_001244193.1.
NP_055564.3. NM_014749.3. [Q9BVV6-2]
UniGeneiHs.232532.

Genome annotation databases

EnsembliENST00000261244; ENSP00000261244; ENSG00000100578. [Q9BVV6-2]
ENST00000354386; ENSP00000346359; ENSG00000100578. [Q9BVV6-3]
ENST00000423743; ENSP00000399427; ENSG00000100578. [Q9BVV6-4]
ENST00000556134; ENSP00000452351; ENSG00000100578. [Q9BVV6-4]
ENST00000619416; ENSP00000478083; ENSG00000100578. [Q9BVV6-1]
GeneIDi9786.
KEGGihsa:9786.
UCSCiuc001xdu.4. human. [Q9BVV6-1]
uc001xdv.4. human. [Q9BVV6-2]

Polymorphism databases

DMDMi327478601.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AY359881 mRNA. Translation: AAQ63404.1 .
AB011158 mRNA. Translation: BAA25512.2 . Different initiation.
AK302836 mRNA. Translation: BAG64028.1 .
AL135752 Genomic DNA. No translation available.
AL139021 Genomic DNA. No translation available.
CH471061 Genomic DNA. Translation: EAW80740.1 .
BC000900 mRNA. Translation: AAH00900.1 .
BC066647 mRNA. Translation: AAH66647.2 .
CCDSi CCDS45115.1. [Q9BVV6-2 ]
CCDS58320.1. [Q9BVV6-3 ]
CCDS58321.1. [Q9BVV6-1 ]
CCDS58322.1. [Q9BVV6-4 ]
PIRi T00344.
RefSeqi NP_001231118.1. NM_001244189.1. [Q9BVV6-3 ]
NP_001231119.1. NM_001244190.1. [Q9BVV6-1 ]
NP_001231120.1. NM_001244191.1.
NP_001231121.1. NM_001244192.1. [Q9BVV6-4 ]
NP_001231122.1. NM_001244193.1.
NP_055564.3. NM_014749.3. [Q9BVV6-2 ]
UniGenei Hs.232532.

3D structure databases

ProteinModelPortali Q9BVV6.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 115130. 3 interactions.
STRINGi 9606.ENSP00000261244.

PTM databases

PhosphoSitei Q9BVV6.

Polymorphism databases

DMDMi 327478601.

Proteomic databases

MaxQBi Q9BVV6.
PaxDbi Q9BVV6.
PRIDEi Q9BVV6.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000261244 ; ENSP00000261244 ; ENSG00000100578 . [Q9BVV6-2 ]
ENST00000354386 ; ENSP00000346359 ; ENSG00000100578 . [Q9BVV6-3 ]
ENST00000423743 ; ENSP00000399427 ; ENSG00000100578 . [Q9BVV6-4 ]
ENST00000556134 ; ENSP00000452351 ; ENSG00000100578 . [Q9BVV6-4 ]
ENST00000619416 ; ENSP00000478083 ; ENSG00000100578 . [Q9BVV6-1 ]
GeneIDi 9786.
KEGGi hsa:9786.
UCSCi uc001xdu.4. human. [Q9BVV6-1 ]
uc001xdv.4. human. [Q9BVV6-2 ]

Organism-specific databases

CTDi 9786.
GeneCardsi GC14P058894.
HGNCi HGNC:19960. KIAA0586.
HPAi HPA000846.
HPA050249.
MIMi 610178. gene.
neXtProti NX_Q9BVV6.
PharmGKBi PA134992213.
HUGEi Search...
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG40443.
GeneTreei ENSGT00390000012397.
HOGENOMi HOG000168599.
HOVERGENi HBG052187.
InParanoidi Q9BVV6.
OMAi IQWVEQE.
OrthoDBi EOG7SXW2T.
PhylomeDBi Q9BVV6.
TreeFami TF332939.

Miscellaneous databases

GenomeRNAii 9786.
NextBioi 35535343.
SOURCEi Search...

Gene expression databases

Bgeei Q9BVV6.
CleanExi HS_KIAA0586.
ExpressionAtlasi Q9BVV6. baseline and differential.
Genevestigatori Q9BVV6.

Family and domain databases

InterProi IPR029246. TALPID3.
[Graphical view ]
PANTHERi PTHR15721. PTHR15721. 1 hit.
Pfami PF15324. TALPID3. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Cloning an isoform of KIAA0586 gene related to spermatogenesis."
    Zhen Y., Huo R., Lu L., Xu M., Yin L.L., Xu Z.Y., Li J.M., Zhou Z.M., Sha J.H.
    Submitted (AUG-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 4), VARIANT PRO-828.
  2. "Prediction of the coding sequences of unidentified human genes. IX. The complete sequences of 100 new cDNA clones from brain which can code for large proteins in vitro."
    Nagase T., Ishikawa K., Miyajima N., Tanaka A., Kotani H., Nomura N., Ohara O.
    DNA Res. 5:31-39(1998) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT PRO-828.
    Tissue: Brain.
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT PRO-828.
    Tissue: Testis.
  4. "The DNA sequence and analysis of human chromosome 14."
    Heilig R., Eckenberg R., Petit J.-L., Fonknechten N., Da Silva C., Cattolico L., Levy M., Barbe V., De Berardinis V., Ureta-Vidal A., Pelletier E., Vico V., Anthouard V., Rowen L., Madan A., Qin S., Sun H., Du H.
    , Pepin K., Artiguenave F., Robert C., Cruaud C., Bruels T., Jaillon O., Friedlander L., Samson G., Brottier P., Cure S., Segurens B., Aniere F., Samain S., Crespeau H., Abbasi N., Aiach N., Boscus D., Dickhoff R., Dors M., Dubois I., Friedman C., Gouyvenoux M., James R., Madan A., Mairey-Estrada B., Mangenot S., Martins N., Menard M., Oztas S., Ratcliffe A., Shaffer T., Trask B., Vacherie B., Bellemere C., Belser C., Besnard-Gonnet M., Bartol-Mavel D., Boutard M., Briez-Silla S., Combette S., Dufosse-Laurent V., Ferron C., Lechaplais C., Louesse C., Muselet D., Magdelenat G., Pateau E., Petit E., Sirvain-Trukniewicz P., Trybou A., Vega-Czarny N., Bataille E., Bluet E., Bordelais I., Dubois M., Dumont C., Guerin T., Haffray S., Hammadi R., Muanga J., Pellouin V., Robert D., Wunderle E., Gauguet G., Roy A., Sainte-Marthe L., Verdier J., Verdier-Discala C., Hillier L.W., Fulton L., McPherson J., Matsuda F., Wilson R., Scarpelli C., Gyapay G., Wincker P., Saurin W., Quetier F., Waterston R., Hood L., Weissenbach J.
    Nature 421:601-607(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA], VARIANT PRO-828.
  6. "Proteomic characterization of the human centrosome by protein correlation profiling."
    Andersen J.S., Wilkinson C.J., Mayor T., Mortensen P., Nigg E.A., Mann M.
    Nature 426:570-574(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION [LARGE SCALE ANALYSIS].
    Tissue: Lymphoblast.
  7. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2), VARIANT PRO-828.
    Tissue: Placenta and Skin.
  8. "Tryptic digestion of ubiquitin standards reveals an improved strategy for identifying ubiquitinated proteins by mass spectrometry."
    Denis N.J., Vasilescu J., Lambert J.-P., Smith J.C., Figeys D.
    Proteomics 7:868-874(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: UBIQUITINATION [LARGE SCALE ANALYSIS] AT LYS-380.
    Tissue: Mammary cancer.
  9. "The Talpid3 gene (KIAA0586) encodes a centrosomal protein that is essential for primary cilia formation."
    Yin Y., Bangs F., Paton I.R., Prescott A., James J., Davey M.G., Whitley P., Genikhovich G., Technau U., Burt D.W., Tickle C.
    Development 136:655-664(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION.

Entry informationi

Entry nameiTALD3_HUMAN
AccessioniPrimary (citable) accession number: Q9BVV6
Secondary accession number(s): B4DZB6
, E7EWM8, J3KQH9, O60328, Q6NYC6, Q6UV20
Entry historyi
Integrated into UniProtKB/Swiss-Prot: January 23, 2002
Last sequence update: April 5, 2011
Last modified: October 29, 2014
This is version 96 of the entry and version 4 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 14
    Human chromosome 14: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3