Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BVI0

- PHF20_HUMAN

UniProt

Q9BVI0 - PHF20_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

PHD finger protein 20

Gene

PHF20

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Methyllysine-binding protein, component of the MOF histone acetyltransferase protein complex. Not required for maintaining the global histone H4 'Lys-16' acetylation (H4K16ac) levels or locus specific histone acetylation, but instead works downstream in transcriptional regulation of MOF target genes (By similarity). As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. Contributes to methyllysine-dependent p53/TP53 stabilization and up-regulation after DNA damage.By similarity2 Publications

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
DNA bindingi257 – 26913A.T hookAdd
BLAST
Zinc fingeri452 – 47726C2H2-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri654 – 70047PHD-typeAdd
BLAST

GO - Molecular functioni

  1. DNA binding Source: UniProtKB-KW
  2. zinc ion binding Source: InterPro

GO - Biological processi

  1. chromatin organization Source: Reactome
  2. histone H4-K16 acetylation Source: UniProtKB
  3. histone H4-K5 acetylation Source: UniProtKB
  4. histone H4-K8 acetylation Source: UniProtKB
  5. regulation of transcription, DNA-templated Source: UniProtKB-KW
  6. transcription, DNA-templated Source: UniProtKB-KW
Complete GO annotation...

Keywords - Molecular functioni

Chromatin regulator

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiREACT_172610. HATs acetylate histones.

Names & Taxonomyi

Protein namesi
Recommended name:
PHD finger protein 20
Alternative name(s):
Glioma-expressed antigen 2
Hepatocellular carcinoma-associated antigen 58
Novel zinc finger protein
Transcription factor TZP
Gene namesi
Name:PHF20
Synonyms:C20orf104, GLEA2, HCA58, NZF, TZP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 20

Organism-specific databases

HGNCiHGNC:16098. PHF20.

Subcellular locationi

Nucleus 1 Publication

GO - Cellular componenti

  1. cytoplasm Source: HPA
  2. histone acetyltransferase complex Source: UniProtKB
  3. MLL1 complex Source: UniProtKB
  4. nuclear membrane Source: HPA
  5. nucleoplasm Source: Reactome
  6. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi96 – 961C → S: Abolishes homodimerization. 1 Publication
Mutagenesisi97 – 971W → A: Abolishes interaction with methylated p53. 1 Publication
Mutagenesisi100 – 1001C → S: Abolishes homodimerization. 1 Publication
Mutagenesisi103 – 1031Y → A: Abolishes interaction with methylated p53. 1 Publication

Organism-specific databases

PharmGKBiPA25644.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 10121012PHD finger protein 20PRO_0000059310Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Disulfide bondi96 – 96Interchain (with C-100)1 Publication
Disulfide bondi100 – 100Interchain (with C-96)1 Publication
Modified residuei159 – 1591Phosphoserine1 Publication
Modified residuei843 – 8431N6-acetyllysine1 Publication
Modified residuei878 – 8781Phosphoserine2 Publications
Modified residuei880 – 8801Phosphoserine2 Publications

Keywords - PTMi

Acetylation, Disulfide bond, Phosphoprotein

Proteomic databases

MaxQBiQ9BVI0.
PaxDbiQ9BVI0.
PRIDEiQ9BVI0.

PTM databases

PhosphoSiteiQ9BVI0.

Expressioni

Tissue specificityi

Expressed in heart, kidney, liver, lung, pancreas, placenta, spleen and testis. Not expressed in brain, skeletal muscle, colon, ovary, prostate, small intestine and thymus. Expressed in colon and ovary cancer cell lines while it is not expressed in the respective normal tissues.1 Publication

Gene expression databases

BgeeiQ9BVI0.
CleanExiHS_PHF20.
ExpressionAtlasiQ9BVI0. baseline and differential.
GenevestigatoriQ9BVI0.

Organism-specific databases

HPAiHPA029619.
HPA029620.
HPA029621.

Interactioni

Subunit structurei

Homodimer; disulfide-linked. Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, KAT8/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Component of the NSL complex at least composed of MOF/KAT8, KANSL1, KANSL2, KANSL3, MCRS1, PHF20, OGT1/OGT, WDR5 and HCFC1.3 Publications

Binary interactionsi

WithEntry#Exp.IntActNotes
HIST1H3DP684316EBI-2560802,EBI-79722
HIST2H4BP628053EBI-2560802,EBI-302023

Protein-protein interaction databases

BioGridi119393. 10 interactions.
IntActiQ9BVI0. 6 interactions.
MINTiMINT-2829252.

Structurei

Secondary structure

1
1012
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi18 – 225
Beta strandi28 – 3710
Turni38 – 414
Beta strandi42 – 476
Helixi52 – 543
Beta strandi56 – 594
Beta strandi92 – 965
Beta strandi102 – 1109
Beta strandi114 – 1207
Beta strandi125 – 1295
Helixi130 – 1323
Beta strandi133 – 1353

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2LDMNMR-A84-147[»]
3P8DX-ray2.00A/B84-147[»]
3Q1JX-ray2.35A4-69[»]
3QIIX-ray2.30A83-150[»]
3SD4X-ray1.93A/B4-69[»]
ProteinModelPortaliQ9BVI0.
SMRiQ9BVI0. Positions 4-68, 85-137, 652-698.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9BVI0.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini4 – 6966Tudor 1Add
BLAST
Domaini83 – 14765Tudor 2Add
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi162 – 22160Lys-richAdd
BLAST
Compositional biasi523 – 55230Lys-richAdd
BLAST

Domaini

The Tudor domain 2 mediates reading of dimethyl-lysine residues.
The Tudor domain 1 doesn't bind dimethyl-lysine residues, due to an atypical and occluded aromatic cage.

Sequence similaritiesi

Contains 1 A.T hook DNA-binding domain.Curated
Contains 1 C2H2-type zinc finger.PROSITE-ProRule annotation
Contains 1 PHD-type zinc finger.Curated
Contains 2 Tudor domains.Curated

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri452 – 47726C2H2-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri654 – 70047PHD-typeAdd
BLAST

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiCOG2940.
GeneTreeiENSGT00390000006451.
HOVERGENiHBG053586.
InParanoidiQ9BVI0.
KOiK18402.
OMAiENTMKTE.
OrthoDBiEOG7RZ5PD.
PhylomeDBiQ9BVI0.
TreeFamiTF106475.

Family and domain databases

Gene3Di3.30.40.10. 1 hit.
InterProiIPR017956. AT_hook_DNA-bd_motif.
IPR022255. DUF3776.
IPR002999. Tudor.
IPR019786. Zinc_finger_PHD-type_CS.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view]
PfamiPF12618. DUF3776. 1 hit.
PF00628. PHD. 1 hit.
[Graphical view]
SMARTiSM00384. AT_hook. 1 hit.
SM00249. PHD. 1 hit.
SM00333. TUDOR. 2 hits.
SM00355. ZnF_C2H2. 1 hit.
[Graphical view]
SUPFAMiSSF57903. SSF57903. 1 hit.
PROSITEiPS01359. ZF_PHD_1. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 1 hit.
PS50157. ZINC_FINGER_C2H2_2. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BVI0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTKHPPNRRG ISFEVGAQLE ARDRLKNWYP AHIEDIDYEE GKVLIHFKRW
60 70 80 90 100
NHRYDEWFCW DSPYLRPLEK IQLRKEGLHE EDGSSEFQIN EQVLACWSDC
110 120 130 140 150
RFYPAKVTAV NKDGTYTVKF YDGVVQTVKH IHVKAFSKDQ NIVGNARPKE
160 170 180 190 200
TDHKSLSSSP DKREKFKEQR KATVNVKKDK EDKPLKTEKR PKQPDKEGKL
210 220 230 240 250
ICSEKGKVSE KSLPKNEKED KENISENDRE YSGDAQVDKK PENDIVKSPQ
260 270 280 290 300
ENLREPKRKR GRPPSIAPTA VDSNSQTLQP ITLELRRRKI SKGCEVPLKR
310 320 330 340 350
PRLDKNSSQE KSKNYSENTD KDLSRRRSSR LSTNGTHEIL DPDLVVSDLV
360 370 380 390 400
DTDPLQDTLS STKESEEGQL KSALEAGQVS SALTCHSFGD GSGAAGLELN
410 420 430 440 450
CPSMGENTMK TEPTSPLVEL QEISTVEVTN TFKKTDDFGS SNAPAVDLDH
460 470 480 490 500
KFRCKVVDCL KFFRKAKLLH YHMKYFHGME KSLEPEESPG KRHVQTRGPS
510 520 530 540 550
ASDKPSQETL TRKRVSASSP TTKDKEKNKE KKFKEFVRVK PKKKKKKKKK
560 570 580 590 600
TKPECPCSEE ISDTSQEPSP PKAFAVTRCG SSHKPGVHMS PQLHGPESGH
610 620 630 640 650
HKGKVKALEE DNLSESSSES FLWSDDEYGQ DVDVTTNPDE ELDGDDRYDF
660 670 680 690 700
EVVRCICEVQ EENDFMIQCE ECQCWQHGVC MGLLEENVPE KYTCYVCQDP
710 720 730 740 750
PGQRPGFKYW YDKEWLSRGH MHGLAFLEEN YSHQNAKKIV ATHQLLGDVQ
760 770 780 790 800
RVIEVLHGLQ LKMSILQSRE HPDLPLWCQP WKQHSGEGRS HFRNIPVTDT
810 820 830 840 850
RSKEEAPSYR TLNGAVEKPR PLALPLPRSV EESYITSEHC YQKPRAYYPA
860 870 880 890 900
VEQKLVVETR GSALDDAVNP LHENGDDSLS PRLGWPLDQD RSKGDSDPKP
910 920 930 940 950
GSPKVKEYVS KKALPEEAPA RKLLDRGGEG LLSSQHQWQF NLLTHVESLQ
960 970 980 990 1000
DEVTHRMDSI EKELDVLESW LDYTGELEPP EPLARLPQLK HCIKQLLMDL
1010
GKVQQIALCC ST
Length:1,012
Mass (Da):115,386
Last modified:July 11, 2003 - v2
Checksum:i1CDBADC23D007503
GO
Isoform 2 (identifier: Q9BVI0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-273: VDKKPENDIVKSPQENLREPKRKRGRPPSIAPTAVDS → KTRQTPFHSSYCCGFKLSNFATNNIGTEKKENIKRM
     274-1012: Missing.

Show »
Length:272
Mass (Da):31,856
Checksum:i11C579B3C0050A12
GO

Sequence cautioni

The sequence AAF34184.1 differs from that shown. Reason: Frameshift at position 260.
The sequence AAK19748.1 differs from that shown. Reason: Frameshift at positions 635, 653 and 655.

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti221 – 2222KE → QG in AAG49888. (PubMed:11703362)Curated
Sequence conflicti226 – 2261E → G in AAG49888. (PubMed:11703362)Curated
Sequence conflicti372 – 3721S → F in AAH80598. (PubMed:15489334)Curated
Sequence conflicti516 – 5161S → F in AAG49888. (PubMed:11703362)Curated
Sequence conflicti532 – 5321K → E in BAG37103. (PubMed:14702039)Curated
Sequence conflicti671 – 6711E → G in BAG37103. (PubMed:14702039)Curated
Isoform 2 (identifier: Q9BVI0-2)
Sequence conflicti237 – 2393KTR → KKTS in AAF34184. (PubMed:12097419)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti605 – 6051V → M.1 Publication
Corresponds to variant rs17431878 [ dbSNP | Ensembl ].
VAR_051600

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei237 – 27337VDKKP…TAVDS → KTRQTPFHSSYCCGFKLSNF ATNNIGTEKKENIKRM in isoform 2. 1 PublicationVSP_007760Add
BLAST
Alternative sequencei274 – 1012739Missing in isoform 2. 1 PublicationVSP_007761Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF220416 mRNA. Translation: AAF34184.1. Frameshift.
AF348207 mRNA. Translation: AAK19748.1. Frameshift.
AY027523 mRNA. Translation: AAK13046.1.
AK314503 mRNA. Translation: BAG37103.1.
AL109965, AL078461 Genomic DNA. Translation: CAI19247.1.
AL078461, AL109965 Genomic DNA. Translation: CAI43145.1.
CH471077 Genomic DNA. Translation: EAW76153.1.
CH471077 Genomic DNA. Translation: EAW76155.1.
CH471077 Genomic DNA. Translation: EAW76156.1.
CH471077 Genomic DNA. Translation: EAW76157.1.
BC048210 mRNA. Translation: AAH48210.1.
BC080598 mRNA. Translation: AAH80598.1.
BC093405 mRNA. Translation: AAH93405.1.
BC150178 mRNA. Translation: AAI50179.1.
AF258787 mRNA. Translation: AAG49888.1.
CCDSiCCDS13268.1. [Q9BVI0-1]
RefSeqiNP_057520.2. NM_016436.4. [Q9BVI0-1]
UniGeneiHs.517044.

Genome annotation databases

EnsembliENST00000374012; ENSP00000363124; ENSG00000025293. [Q9BVI0-1]
GeneIDi51230.
KEGGihsa:51230.
UCSCiuc002xei.1. human. [Q9BVI0-1]

Polymorphism databases

DMDMi32699605.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF220416 mRNA. Translation: AAF34184.1 . Frameshift.
AF348207 mRNA. Translation: AAK19748.1 . Frameshift.
AY027523 mRNA. Translation: AAK13046.1 .
AK314503 mRNA. Translation: BAG37103.1 .
AL109965 , AL078461 Genomic DNA. Translation: CAI19247.1 .
AL078461 , AL109965 Genomic DNA. Translation: CAI43145.1 .
CH471077 Genomic DNA. Translation: EAW76153.1 .
CH471077 Genomic DNA. Translation: EAW76155.1 .
CH471077 Genomic DNA. Translation: EAW76156.1 .
CH471077 Genomic DNA. Translation: EAW76157.1 .
BC048210 mRNA. Translation: AAH48210.1 .
BC080598 mRNA. Translation: AAH80598.1 .
BC093405 mRNA. Translation: AAH93405.1 .
BC150178 mRNA. Translation: AAI50179.1 .
AF258787 mRNA. Translation: AAG49888.1 .
CCDSi CCDS13268.1. [Q9BVI0-1 ]
RefSeqi NP_057520.2. NM_016436.4. [Q9BVI0-1 ]
UniGenei Hs.517044.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2LDM NMR - A 84-147 [» ]
3P8D X-ray 2.00 A/B 84-147 [» ]
3Q1J X-ray 2.35 A 4-69 [» ]
3QII X-ray 2.30 A 83-150 [» ]
3SD4 X-ray 1.93 A/B 4-69 [» ]
ProteinModelPortali Q9BVI0.
SMRi Q9BVI0. Positions 4-68, 85-137, 652-698.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119393. 10 interactions.
IntActi Q9BVI0. 6 interactions.
MINTi MINT-2829252.

PTM databases

PhosphoSitei Q9BVI0.

Polymorphism databases

DMDMi 32699605.

Proteomic databases

MaxQBi Q9BVI0.
PaxDbi Q9BVI0.
PRIDEi Q9BVI0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000374012 ; ENSP00000363124 ; ENSG00000025293 . [Q9BVI0-1 ]
GeneIDi 51230.
KEGGi hsa:51230.
UCSCi uc002xei.1. human. [Q9BVI0-1 ]

Organism-specific databases

CTDi 51230.
GeneCardsi GC20P034359.
HGNCi HGNC:16098. PHF20.
HPAi HPA029619.
HPA029620.
HPA029621.
MIMi 610335. gene.
neXtProti NX_Q9BVI0.
PharmGKBi PA25644.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG2940.
GeneTreei ENSGT00390000006451.
HOVERGENi HBG053586.
InParanoidi Q9BVI0.
KOi K18402.
OMAi ENTMKTE.
OrthoDBi EOG7RZ5PD.
PhylomeDBi Q9BVI0.
TreeFami TF106475.

Enzyme and pathway databases

Reactomei REACT_172610. HATs acetylate histones.

Miscellaneous databases

ChiTaRSi PHF20. human.
EvolutionaryTracei Q9BVI0.
GeneWikii PHF20.
GenomeRNAii 51230.
NextBioi 54328.
PROi Q9BVI0.
SOURCEi Search...

Gene expression databases

Bgeei Q9BVI0.
CleanExi HS_PHF20.
ExpressionAtlasi Q9BVI0. baseline and differential.
Genevestigatori Q9BVI0.

Family and domain databases

Gene3Di 3.30.40.10. 1 hit.
InterProi IPR017956. AT_hook_DNA-bd_motif.
IPR022255. DUF3776.
IPR002999. Tudor.
IPR019786. Zinc_finger_PHD-type_CS.
IPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR011011. Znf_FYVE_PHD.
IPR001965. Znf_PHD.
IPR019787. Znf_PHD-finger.
IPR013083. Znf_RING/FYVE/PHD.
[Graphical view ]
Pfami PF12618. DUF3776. 1 hit.
PF00628. PHD. 1 hit.
[Graphical view ]
SMARTi SM00384. AT_hook. 1 hit.
SM00249. PHD. 1 hit.
SM00333. TUDOR. 2 hits.
SM00355. ZnF_C2H2. 1 hit.
[Graphical view ]
SUPFAMi SSF57903. SSF57903. 1 hit.
PROSITEi PS01359. ZF_PHD_1. 1 hit.
PS00028. ZINC_FINGER_C2H2_1. 1 hit.
PS50157. ZINC_FINGER_C2H2_2. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Large scale identification of human hepatocellular carcinoma-associated antigens by autoantibodies."
    Wang Y., Han K.-J., Pang X.-W., Vaughan H.A., Qu W., Dong X.-Y., Peng J.-R., Zhao H.-T., Rui J.-A., Leng X.-S., Cebon J., Burgess A.W., Chen W.-F.
    J. Immunol. 169:1102-1109(2002) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), TISSUE SPECIFICITY, IDENTIFICATION AS ANTIGEN IN HEPATOCELLULAR CARCINOMA.
    Tissue: Hepatoma.
  2. "Cloning and characterization of a novel transcription factor (TZP)."
    Cheng J.Q., Kaneko S., Dan H.C., Testa J.R.
    Submitted (FEB-2001) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA].
    Tissue: Trachea.
  4. "The DNA sequence and comparative analysis of human chromosome 20."
    Deloukas P., Matthews L.H., Ashurst J.L., Burton J., Gilbert J.G.R., Jones M., Stavrides G., Almeida J.P., Babbage A.K., Bagguley C.L., Bailey J., Barlow K.F., Bates K.N., Beard L.M., Beare D.M., Beasley O.P., Bird C.P., Blakey S.E.
    , Bridgeman A.M., Brown A.J., Buck D., Burrill W.D., Butler A.P., Carder C., Carter N.P., Chapman J.C., Clamp M., Clark G., Clark L.N., Clark S.Y., Clee C.M., Clegg S., Cobley V.E., Collier R.E., Connor R.E., Corby N.R., Coulson A., Coville G.J., Deadman R., Dhami P.D., Dunn M., Ellington A.G., Frankland J.A., Fraser A., French L., Garner P., Grafham D.V., Griffiths C., Griffiths M.N.D., Gwilliam R., Hall R.E., Hammond S., Harley J.L., Heath P.D., Ho S., Holden J.L., Howden P.J., Huckle E., Hunt A.R., Hunt S.E., Jekosch K., Johnson C.M., Johnson D., Kay M.P., Kimberley A.M., King A., Knights A., Laird G.K., Lawlor S., Lehvaeslaiho M.H., Leversha M.A., Lloyd C., Lloyd D.M., Lovell J.D., Marsh V.L., Martin S.L., McConnachie L.J., McLay K., McMurray A.A., Milne S.A., Mistry D., Moore M.J.F., Mullikin J.C., Nickerson T., Oliver K., Parker A., Patel R., Pearce T.A.V., Peck A.I., Phillimore B.J.C.T., Prathalingam S.R., Plumb R.W., Ramsay H., Rice C.M., Ross M.T., Scott C.E., Sehra H.K., Shownkeen R., Sims S., Skuce C.D., Smith M.L., Soderlund C., Steward C.A., Sulston J.E., Swann R.M., Sycamore N., Taylor R., Tee L., Thomas D.W., Thorpe A., Tracey A., Tromans A.C., Vaudin M., Wall M., Wallis J.M., Whitehead S.L., Whittaker P., Willey D.L., Williams L., Williams S.A., Wilming L., Wray P.W., Hubbard T., Durbin R.M., Bentley D.R., Beck S., Rogers J.
    Nature 414:865-871(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT MET-605.
    Tissue: Brain, Eye and Lymph.
  7. "Glioma-expressed antigen 2 (GLEA2): a novel protein that can elicit immune responses in glioblastoma patients and some controls."
    Fischer U., Struss A.-K., Hemmer D., Pallasch C.P., Steudel W.-I., Meese E.
    Clin. Exp. Immunol. 126:206-213(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 1-543 (ISOFORM 1), IDENTIFICATION AS ANTIGEN IN GLIOBLASTOMA.
    Tissue: Glioblastoma.
  8. Cited for: IDENTIFICATION AS ANTIGEN IN CHILDHOOD MEDULLOBLASTOMA.
  9. "Physical association and coordinate function of the H3 K4 methyltransferase MLL1 and the H4 K16 acetyltransferase MOF."
    Dou Y., Milne T.A., Tackett A.J., Smith E.R., Fukuda A., Wysocka J., Allis C.D., Chait B.T., Hess J.L., Roeder R.G.
    Cell 121:873-885(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION IN THE MLL1/MLL COMPLEX.
  10. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-878 AND SER-880, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-878 AND SER-880, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  12. "Lysine acetylation targets protein complexes and co-regulates major cellular functions."
    Choudhary C., Kumar C., Gnad F., Nielsen M.L., Rehman M., Walther T.C., Olsen J.V., Mann M.
    Science 325:834-840(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT LYS-843, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "Subunit composition and substrate specificity of a MOF-containing histone acetyltransferase distinct from the male-specific lethal (MSL) complex."
    Cai Y., Jin J., Swanson S.K., Cole M.D., Choi S.H., Florens L., Washburn M.P., Conaway J.W., Conaway R.C.
    J. Biol. Chem. 285:4268-4272(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION IN HISTONE H4 ACETYLATION, IDENTIFICATION IN NSL COMPLEX, SUBCELLULAR LOCATION.
  14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  15. "System-wide temporal characterization of the proteome and phosphoproteome of human embryonic stem cell differentiation."
    Rigbolt K.T., Prokhorova T.A., Akimov V., Henningsen J., Johansen P.T., Kratchmarova I., Kassem M., Mann M., Olsen J.V., Blagoev B.
    Sci. Signal. 4:RS3-RS3(2011) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-159, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  16. "Crystal structures of the Tudor domains of human PHF20 reveal novel structural variations on the Royal Family of proteins."
    Adams-Cioaba M.A., Li Z., Tempel W., Guo Y., Bian C., Li Y., Lam R., Min J.
    FEBS Lett. 586:859-865(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) OF 4-69 AND 84-147 AND TUDOR DOMAINS.
  17. "PHF20 is an effector protein of p53 double lysine methylation that stabilizes and activates p53."
    Cui G., Park S., Badeaux A.I., Kim D., Lee J., Thompson J.R., Yan F., Kaneko S., Yuan Z., Botuyan M.V., Bedford M.T., Cheng J.Q., Mer G.
    Nat. Struct. Mol. Biol. 19:916-924(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.0 ANGSTROMS) OF 4-69 AND 84-147, STRUCTURE BY NMR OF 84-147 IN COMPLEX WITH DIMETHYLATED P53 PEPTIDE, FUNCTION, SUBUNIT, DISULFIDE BONDS, MUTAGENESIS OF CYS-96; TRP-97; CYS-100 AND TYR-103.

Entry informationi

Entry nameiPHF20_HUMAN
AccessioniPrimary (citable) accession number: Q9BVI0
Secondary accession number(s): A7E235
, B2RB56, E1P5S3, Q566Q2, Q5JWY9, Q66K49, Q9BWV4, Q9BXA3, Q9BZW3, Q9H421, Q9H4J6, Q9NZ22
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 11, 2003
Last sequence update: July 11, 2003
Last modified: October 29, 2014
This is version 133 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Antibodies against PHF20 are present in sera from patients with hepatocellular carcinoma, glioblastoma and childhood medulloblastula.

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 20
    Human chromosome 20: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  6. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3