Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

PHD finger protein 20

Gene

PHF20

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Methyllysine-binding protein, component of the MOF histone acetyltransferase protein complex. Not required for maintaining the global histone H4 'Lys-16' acetylation (H4K16ac) levels or locus specific histone acetylation, but instead works downstream in transcriptional regulation of MOF target genes (By similarity). As part of the NSL complex it may be involved in acetylation of nucleosomal histone H4 on several lysine residues. Contributes to methyllysine-dependent p53/TP53 stabilization and up-regulation after DNA damage.By similarity2 Publications

Miscellaneous

Antibodies against PHF20 are present in sera from patients with hepatocellular carcinoma, glioblastoma and childhood medulloblastula.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
DNA bindingi257 – 269A.T hookAdd BLAST13
Zinc fingeri452 – 477C2H2-typePROSITE-ProRule annotationAdd BLAST26
Zinc fingeri654 – 700PHD-typeAdd BLAST47

GO - Molecular functioni

GO - Biological processi

  • histone H4-K16 acetylation Source: UniProtKB
  • histone H4-K5 acetylation Source: UniProtKB
  • histone H4-K8 acetylation Source: UniProtKB
  • regulation of signal transduction by p53 class mediator Source: Reactome
  • transcription, DNA-templated Source: UniProtKB-KW

Keywordsi

Molecular functionChromatin regulator, DNA-binding
Biological processTranscription, Transcription regulation
LigandMetal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-3214847 HATs acetylate histones
R-HSA-6804757 Regulation of TP53 Degradation
R-HSA-6804759 Regulation of TP53 Activity through Association with Co-factors
R-HSA-69541 Stabilization of p53
SIGNORiQ9BVI0

Names & Taxonomyi

Protein namesi
Recommended name:
PHD finger protein 20
Alternative name(s):
Glioma-expressed antigen 2
Hepatocellular carcinoma-associated antigen 58
Novel zinc finger protein
Transcription factor TZP
Gene namesi
Name:PHF20
Synonyms:C20orf104, GLEA2, HCA58, NZF, TZP
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 20

Organism-specific databases

EuPathDBiHostDB:ENSG00000025293.15
HGNCiHGNC:16098 PHF20
MIMi610335 gene
neXtProtiNX_Q9BVI0

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi96C → S: Abolishes homodimerization. 1 Publication1
Mutagenesisi97W → A: Abolishes interaction with methylated p53. 1 Publication1
Mutagenesisi100C → S: Abolishes homodimerization. 1 Publication1
Mutagenesisi103Y → A: Abolishes interaction with methylated p53. 1 Publication1

Organism-specific databases

DisGeNETi51230
OpenTargetsiENSG00000025293
PharmGKBiPA25644

Polymorphism and mutation databases

BioMutaiPHF20
DMDMi32699605

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00000593101 – 1012PHD finger protein 20Add BLAST1012

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Disulfide bondi96Interchain (with C-100)1 Publication
Disulfide bondi100Interchain (with C-96)1 Publication
Modified residuei159PhosphoserineCombined sources1
Modified residuei488PhosphoserineCombined sources1
Modified residuei843N6-acetyllysineCombined sources1
Modified residuei878PhosphoserineCombined sources1
Modified residuei880PhosphoserineCombined sources1

Keywords - PTMi

Acetylation, Disulfide bond, Phosphoprotein

Proteomic databases

EPDiQ9BVI0
MaxQBiQ9BVI0
PaxDbiQ9BVI0
PeptideAtlasiQ9BVI0
PRIDEiQ9BVI0

PTM databases

iPTMnetiQ9BVI0
PhosphoSitePlusiQ9BVI0

Expressioni

Tissue specificityi

Expressed in heart, kidney, liver, lung, pancreas, placenta, spleen and testis. Not expressed in brain, skeletal muscle, colon, ovary, prostate, small intestine and thymus. Expressed in colon and ovary cancer cell lines while it is not expressed in the respective normal tissues.1 Publication

Gene expression databases

BgeeiENSG00000025293
CleanExiHS_PHF20
ExpressionAtlasiQ9BVI0 baseline and differential
GenevisibleiQ9BVI0 HS

Organism-specific databases

HPAiHPA029619
HPA029620
HPA029621

Interactioni

Subunit structurei

Homodimer; disulfide-linked. Component of some MLL1/MLL complex, at least composed of the core components KMT2A/MLL1, ASH2L, HCFC1, WDR5 and RBBP5, as well as the facultative components BAP18, CHD8, E2F6, HSP70, INO80C, KANSL1, LAS1L, MAX, MCRS1, MGA, KAT8/MOF, PELP1, PHF20, PRP31, RING2, RUVB1/TIP49A, RUVB2/TIP49B, SENP3, TAF1, TAF4, TAF6, TAF7, TAF9 and TEX10. Component of the NSL complex at least composed of MOF/KAT8, KANSL1, KANSL2, KANSL3, MCRS1, PHF20, OGT1/OGT, WDR5 and HCFC1.3 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi11939318 interactors.
CORUMiQ9BVI0
IntActiQ9BVI0 9 interactors.
MINTiQ9BVI0
STRINGi9606.ENSP00000363124

Structurei

Secondary structure

11012
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi18 – 22Combined sources5
Beta strandi28 – 37Combined sources10
Turni38 – 41Combined sources4
Beta strandi42 – 47Combined sources6
Helixi52 – 54Combined sources3
Beta strandi56 – 59Combined sources4
Beta strandi92 – 96Combined sources5
Beta strandi102 – 110Combined sources9
Beta strandi114 – 120Combined sources7
Beta strandi125 – 129Combined sources5
Helixi130 – 132Combined sources3
Beta strandi133 – 135Combined sources3
Beta strandi666 – 668Combined sources3
Turni670 – 672Combined sources3
Beta strandi675 – 677Combined sources3
Turni678 – 682Combined sources5
Turni685 – 687Combined sources3
Turni695 – 697Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2LDMNMR-A84-147[»]
3P8DX-ray2.00A/B84-147[»]
3Q1JX-ray2.35A4-69[»]
3QIIX-ray2.30A83-150[»]
3SD4X-ray1.93A/B4-69[»]
5TABX-ray1.25A651-698[»]
5TBNNMR-A646-699[»]
ProteinModelPortaliQ9BVI0
SMRiQ9BVI0
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9BVI0

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini4 – 69Tudor 1Add BLAST66
Domaini83 – 147Tudor 2Add BLAST65

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi162 – 221Lys-richAdd BLAST60
Compositional biasi523 – 552Lys-richAdd BLAST30

Domaini

The Tudor domain 2 mediates reading of dimethyl-lysine residues.
The Tudor domain 1 doesn't bind dimethyl-lysine residues, due to an atypical and occluded aromatic cage.

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri452 – 477C2H2-typePROSITE-ProRule annotationAdd BLAST26
Zinc fingeri654 – 700PHD-typeAdd BLAST47

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiENOG410IMXB Eukaryota
ENOG410XX7Z LUCA
GeneTreeiENSGT00390000006451
HOVERGENiHBG053586
InParanoidiQ9BVI0
KOiK18402
OMAiDFSIHRR
OrthoDBiEOG091G01T4
PhylomeDBiQ9BVI0
TreeFamiTF106475

Family and domain databases

Gene3Di3.30.40.101 hit
InterProiView protein in InterPro
IPR022255 DUF3776
IPR037915 PHF20
IPR002999 Tudor
IPR019786 Zinc_finger_PHD-type_CS
IPR013087 Znf_C2H2_type
IPR011011 Znf_FYVE_PHD
IPR001965 Znf_PHD
IPR013083 Znf_RING/FYVE/PHD
PANTHERiPTHR15856:SF27 PTHR15856:SF27, 1 hit
PfamiView protein in Pfam
PF12618 DUF3776, 1 hit
SMARTiView protein in SMART
SM00249 PHD, 1 hit
SM00333 TUDOR, 2 hits
SUPFAMiSSF57903 SSF57903, 1 hit
PROSITEiView protein in PROSITE
PS01359 ZF_PHD_1, 1 hit
PS00028 ZINC_FINGER_C2H2_1, 1 hit
PS50157 ZINC_FINGER_C2H2_2, 1 hit

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BVI0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MTKHPPNRRG ISFEVGAQLE ARDRLKNWYP AHIEDIDYEE GKVLIHFKRW
60 70 80 90 100
NHRYDEWFCW DSPYLRPLEK IQLRKEGLHE EDGSSEFQIN EQVLACWSDC
110 120 130 140 150
RFYPAKVTAV NKDGTYTVKF YDGVVQTVKH IHVKAFSKDQ NIVGNARPKE
160 170 180 190 200
TDHKSLSSSP DKREKFKEQR KATVNVKKDK EDKPLKTEKR PKQPDKEGKL
210 220 230 240 250
ICSEKGKVSE KSLPKNEKED KENISENDRE YSGDAQVDKK PENDIVKSPQ
260 270 280 290 300
ENLREPKRKR GRPPSIAPTA VDSNSQTLQP ITLELRRRKI SKGCEVPLKR
310 320 330 340 350
PRLDKNSSQE KSKNYSENTD KDLSRRRSSR LSTNGTHEIL DPDLVVSDLV
360 370 380 390 400
DTDPLQDTLS STKESEEGQL KSALEAGQVS SALTCHSFGD GSGAAGLELN
410 420 430 440 450
CPSMGENTMK TEPTSPLVEL QEISTVEVTN TFKKTDDFGS SNAPAVDLDH
460 470 480 490 500
KFRCKVVDCL KFFRKAKLLH YHMKYFHGME KSLEPEESPG KRHVQTRGPS
510 520 530 540 550
ASDKPSQETL TRKRVSASSP TTKDKEKNKE KKFKEFVRVK PKKKKKKKKK
560 570 580 590 600
TKPECPCSEE ISDTSQEPSP PKAFAVTRCG SSHKPGVHMS PQLHGPESGH
610 620 630 640 650
HKGKVKALEE DNLSESSSES FLWSDDEYGQ DVDVTTNPDE ELDGDDRYDF
660 670 680 690 700
EVVRCICEVQ EENDFMIQCE ECQCWQHGVC MGLLEENVPE KYTCYVCQDP
710 720 730 740 750
PGQRPGFKYW YDKEWLSRGH MHGLAFLEEN YSHQNAKKIV ATHQLLGDVQ
760 770 780 790 800
RVIEVLHGLQ LKMSILQSRE HPDLPLWCQP WKQHSGEGRS HFRNIPVTDT
810 820 830 840 850
RSKEEAPSYR TLNGAVEKPR PLALPLPRSV EESYITSEHC YQKPRAYYPA
860 870 880 890 900
VEQKLVVETR GSALDDAVNP LHENGDDSLS PRLGWPLDQD RSKGDSDPKP
910 920 930 940 950
GSPKVKEYVS KKALPEEAPA RKLLDRGGEG LLSSQHQWQF NLLTHVESLQ
960 970 980 990 1000
DEVTHRMDSI EKELDVLESW LDYTGELEPP EPLARLPQLK HCIKQLLMDL
1010
GKVQQIALCC ST
Length:1,012
Mass (Da):115,386
Last modified:July 11, 2003 - v2
Checksum:i1CDBADC23D007503
GO
Isoform 2 (identifier: Q9BVI0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     237-273: VDKKPENDIVKSPQENLREPKRKRGRPPSIAPTAVDS → KTRQTPFHSSYCCGFKLSNFATNNIGTEKKENIKRM
     274-1012: Missing.

Show »
Length:272
Mass (Da):31,856
Checksum:i11C579B3C0050A12
GO

Sequence cautioni

The sequence AAF34184 differs from that shown. Reason: Frameshift at position 260.Curated
The sequence AAK19748 differs from that shown. Reason: Frameshift at positions 635, 653 and 655.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti221 – 222KE → QG in AAG49888 (PubMed:11703362).Curated2
Sequence conflicti226E → G in AAG49888 (PubMed:11703362).Curated1
Sequence conflicti372S → F in AAH80598 (PubMed:15489334).Curated1
Sequence conflicti516S → F in AAG49888 (PubMed:11703362).Curated1
Sequence conflicti532K → E in BAG37103 (PubMed:14702039).Curated1
Sequence conflicti671E → G in BAG37103 (PubMed:14702039).Curated1
Isoform 2 (identifier: Q9BVI0-2)
Sequence conflicti237 – 239KTR → KKTS in AAF34184 (PubMed:12097419).Curated3

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_051600605V → M1 PublicationCorresponds to variant dbSNP:rs17431878Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_007760237 – 273VDKKP…TAVDS → KTRQTPFHSSYCCGFKLSNF ATNNIGTEKKENIKRM in isoform 2. 1 PublicationAdd BLAST37
Alternative sequenceiVSP_007761274 – 1012Missing in isoform 2. 1 PublicationAdd BLAST739

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF220416 mRNA Translation: AAF34184.1 Frameshift.
AF348207 mRNA Translation: AAK19748.1 Frameshift.
AY027523 mRNA Translation: AAK13046.1
AK314503 mRNA Translation: BAG37103.1
AL109965, AL078461 Genomic DNA Translation: CAI19247.1
AL078461, AL109965 Genomic DNA Translation: CAI43145.1
CH471077 Genomic DNA Translation: EAW76153.1
CH471077 Genomic DNA Translation: EAW76155.1
CH471077 Genomic DNA Translation: EAW76156.1
CH471077 Genomic DNA Translation: EAW76157.1
BC048210 mRNA Translation: AAH48210.1
BC080598 mRNA Translation: AAH80598.1
BC093405 mRNA Translation: AAH93405.1
BC150178 mRNA Translation: AAI50179.1
AF258787 mRNA Translation: AAG49888.1
CCDSiCCDS13268.1 [Q9BVI0-1]
RefSeqiNP_057520.2, NM_016436.4 [Q9BVI0-1]
XP_016883353.1, XM_017027864.1 [Q9BVI0-1]
XP_016883354.1, XM_017027865.1 [Q9BVI0-1]
XP_016883355.1, XM_017027866.1 [Q9BVI0-1]
XP_016883356.1, XM_017027867.1 [Q9BVI0-1]
UniGeneiHs.517044

Genome annotation databases

EnsembliENST00000374012; ENSP00000363124; ENSG00000025293 [Q9BVI0-1]
GeneIDi51230
KEGGihsa:51230
UCSCiuc002xek.2 human [Q9BVI0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiPHF20_HUMAN
AccessioniPrimary (citable) accession number: Q9BVI0
Secondary accession number(s): A7E235
, B2RB56, E1P5S3, Q566Q2, Q5JWY9, Q66K49, Q9BWV4, Q9BXA3, Q9BZW3, Q9H421, Q9H4J6, Q9NZ22
Entry historyiIntegrated into UniProtKB/Swiss-Prot: July 11, 2003
Last sequence update: July 11, 2003
Last modified: March 28, 2018
This is version 165 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome