Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase

Gene

ADI1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene). Also down-regulates cell migration mediated by MMP14. Necessary for hepatitis C virus replication in an otherwise non-permissive cell line.UniRule annotation2 Publications

Catalytic activityi

1,2-dihydroxy-5-(methylthio)pent-1-en-3-one + O2 = 4-(methylthio)-2-oxobutanoate + formate.UniRule annotation1 Publication

Cofactori

Fe cationUniRule annotationNote: Binds 1 Fe cation per monomer. Can also use other divalent metal cations.UniRule annotation

Pathway: L-methionine biosynthesis via salvage pathway

This protein is involved in step 5 of the subpathway that synthesizes L-methionine from S-methyl-5-thio-alpha-D-ribose 1-phosphate.UniRule annotation
Proteins known to be involved in the 6 steps of the subpathway in this organism are:
  1. Methylthioribose-1-phosphate isomerase (MRI1)
  2. Methylthioribulose-1-phosphate dehydratase (APIP), Methylthioribulose-1-phosphate dehydratase (APIP)
  3. Enolase-phosphatase E1 (ENOPH1)
  4. Enolase-phosphatase E1 (ENOPH1)
  5. 1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (ADI1)
  6. no protein annotated in this organism
This subpathway is part of the pathway L-methionine biosynthesis via salvage pathway, which is itself part of Amino-acid biosynthesis.
View all proteins of this organism that are known to be involved in the subpathway that synthesizes L-methionine from S-methyl-5-thio-alpha-D-ribose 1-phosphate, the pathway L-methionine biosynthesis via salvage pathway and in Amino-acid biosynthesis.

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi88 – 881Iron or nickelUniRule annotation
Metal bindingi90 – 901Iron or nickelUniRule annotation
Metal bindingi94 – 941Iron or nickelUniRule annotation
Metal bindingi133 – 1331Iron or nickelUniRule annotation

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Dioxygenase, Oxidoreductase

Keywords - Biological processi

Amino-acid biosynthesis, Methionine biosynthesis

Keywords - Ligandi

Iron, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_75881. Methionine salvage pathway.
UniPathwayiUPA00904; UER00878.

Names & Taxonomyi

Protein namesi
Recommended name:
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenaseUniRule annotation (EC:1.13.11.54UniRule annotation)
Alternative name(s):
Acireductone dioxygenase (Fe(2+)-requiring)UniRule annotation
Short name:
ARDUniRule annotation
Short name:
Fe-ARDUniRule annotation
Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1UniRule annotation
Short name:
MTCBP-1UniRule annotation
Submergence-induced protein-like factor
Short name:
Sip-L
Gene namesi
Name:ADI1UniRule annotation
Synonyms:MTCBP1UniRule annotation
ORF Names:HMFT1638
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 2

Organism-specific databases

HGNCiHGNC:30576. ADI1.

Subcellular locationi

GO - Cellular componenti

  • cytoplasm Source: UniProtKB
  • cytosol Source: Reactome
  • Golgi apparatus Source: HPA
  • nucleoplasm Source: HPA
  • nucleus Source: UniProtKB
  • plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi94 – 941E → A: Loss of aci-reductone dioxygenase activity. 1 Publication

Organism-specific databases

PharmGKBiPA143485291.

Polymorphism and mutation databases

BioMutaiADI1.
DMDMi74733289.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 1791791,2-dihydroxy-3-keto-5-methylthiopentene dioxygenasePRO_0000162942Add
BLAST

Proteomic databases

MaxQBiQ9BV57.
PaxDbiQ9BV57.
PRIDEiQ9BV57.

PTM databases

PhosphoSiteiQ9BV57.

Expressioni

Tissue specificityi

Detected in heart, colon, lung, stomach, brain, spleen, liver, skeletal muscle and kidney.2 Publications

Gene expression databases

BgeeiQ9BV57.
CleanExiHS_ADI1.
ExpressionAtlasiQ9BV57. baseline and differential.
GenevisibleiQ9BV57. HS.

Organism-specific databases

HPAiHPA035403.
HPA035404.

Interactioni

Subunit structurei

Monomer (By similarity). Interacts with MMP14.UniRule annotation1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
MMP14P502814EBI-992807,EBI-992788

Protein-protein interaction databases

BioGridi120547. 5 interactions.
IntActiQ9BV57. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9BV57.
SMRiQ9BV57. Positions 1-179.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the acireductone dioxygenase (ARD) family.UniRule annotation

Phylogenomic databases

eggNOGiCOG1791.
GeneTreeiENSGT00390000008195.
HOVERGENiHBG081992.
InParanoidiQ9BV57.
KOiK08967.
OMAiFMINASA.
OrthoDBiEOG73FQP0.
PhylomeDBiQ9BV57.
TreeFamiTF300231.

Family and domain databases

Gene3Di2.60.120.10. 1 hit.
HAMAPiMF_03154. Salvage_MtnD_euk.
InterProiIPR004313. Acireductn_dOase_family.
IPR027496. MTCBP-1_eukaryotes.
IPR014710. RmlC-like_jellyroll.
IPR011051. RmlC_Cupin.
[Graphical view]
PANTHERiPTHR23418. PTHR23418. 1 hit.
PfamiPF03079. ARD. 1 hit.
[Graphical view]
SUPFAMiSSF51182. SSF51182. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BV57-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQAWYMDDA PGDPRQPHRP DPGRPVGLEQ LRRLGVLYWK LDADKYENDP
60 70 80 90 100
ELEKIRRERN YSWMDIITIC KDKLPNYEEK IKMFYEEHLH LDDEIRYILD
110 120 130 140 150
GSGYFDVRDK EDQWIRIFME KGDMVTLPAG IYHRFTVDEK NYTKAMRLFV
160 170
GEPVWTAYNR PADHFEARGQ YVKFLAQTA
Length:179
Mass (Da):21,498
Last modified:June 1, 2001 - v1
Checksum:i92E13B9718D44C27
GO
Isoform 2 (identifier: Q9BV57-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWK → MSVKSSKLMFLCHGSSRSLHSGSLTSCNTGVCCS

Note: No experimental confirmation available.
Show »
Length:173
Mass (Da):20,332
Checksum:i5AE5570210391A36
GO

Sequence cautioni

The sequence AAL25800.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAD38646.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAD96187.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti3 – 31Q → L in BAA91901 (PubMed:14702039).Curated
Sequence conflicti108 – 1081R → G in BAD96187 (Ref. 5) Curated
Sequence conflicti170 – 1701Q → K in AAP97173 (Ref. 2) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4040MVQAW…VLYWK → MSVKSSKLMFLCHGSSRSLH SGSLTSCNTGVCCS in isoform 2. 1 PublicationVSP_015822Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB158319 mRNA. Translation: BAD10866.1.
AF087863 mRNA. Translation: AAP97173.1.
AB073609 mRNA. Translation: BAD38646.1. Different initiation.
AK001775 mRNA. Translation: BAA91901.1.
AK127473 mRNA. Translation: BAC86996.1.
AK222467 mRNA. Translation: BAD96187.1. Different initiation.
AC142528 Genomic DNA. Translation: AAX82038.1.
AC114810 Genomic DNA. Translation: AAY24022.1.
CH471053 Genomic DNA. Translation: EAX01064.1.
CH471053 Genomic DNA. Translation: EAX01065.1.
BC001467 mRNA. Translation: AAH01467.1.
AF403478 mRNA. Translation: AAL25800.1. Different initiation.
CCDSiCCDS1653.1. [Q9BV57-1]
RefSeqiNP_060739.2. NM_018269.3. [Q9BV57-1]
UniGeneiHs.502773.

Genome annotation databases

EnsembliENST00000327435; ENSP00000333666; ENSG00000182551. [Q9BV57-1]
ENST00000382093; ENSP00000371525; ENSG00000182551. [Q9BV57-2]
GeneIDi55256.
KEGGihsa:55256.
UCSCiuc002qxp.4. human. [Q9BV57-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AB158319 mRNA. Translation: BAD10866.1.
AF087863 mRNA. Translation: AAP97173.1.
AB073609 mRNA. Translation: BAD38646.1. Different initiation.
AK001775 mRNA. Translation: BAA91901.1.
AK127473 mRNA. Translation: BAC86996.1.
AK222467 mRNA. Translation: BAD96187.1. Different initiation.
AC142528 Genomic DNA. Translation: AAX82038.1.
AC114810 Genomic DNA. Translation: AAY24022.1.
CH471053 Genomic DNA. Translation: EAX01064.1.
CH471053 Genomic DNA. Translation: EAX01065.1.
BC001467 mRNA. Translation: AAH01467.1.
AF403478 mRNA. Translation: AAL25800.1. Different initiation.
CCDSiCCDS1653.1. [Q9BV57-1]
RefSeqiNP_060739.2. NM_018269.3. [Q9BV57-1]
UniGeneiHs.502773.

3D structure databases

ProteinModelPortaliQ9BV57.
SMRiQ9BV57. Positions 1-179.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120547. 5 interactions.
IntActiQ9BV57. 2 interactions.

PTM databases

PhosphoSiteiQ9BV57.

Polymorphism and mutation databases

BioMutaiADI1.
DMDMi74733289.

Proteomic databases

MaxQBiQ9BV57.
PaxDbiQ9BV57.
PRIDEiQ9BV57.

Protocols and materials databases

DNASUi55256.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000327435; ENSP00000333666; ENSG00000182551. [Q9BV57-1]
ENST00000382093; ENSP00000371525; ENSG00000182551. [Q9BV57-2]
GeneIDi55256.
KEGGihsa:55256.
UCSCiuc002qxp.4. human. [Q9BV57-1]

Organism-specific databases

CTDi55256.
GeneCardsiGC02M003501.
HGNCiHGNC:30576. ADI1.
HPAiHPA035403.
HPA035404.
MIMi613400. gene.
neXtProtiNX_Q9BV57.
PharmGKBiPA143485291.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG1791.
GeneTreeiENSGT00390000008195.
HOVERGENiHBG081992.
InParanoidiQ9BV57.
KOiK08967.
OMAiFMINASA.
OrthoDBiEOG73FQP0.
PhylomeDBiQ9BV57.
TreeFamiTF300231.

Enzyme and pathway databases

UniPathwayiUPA00904; UER00878.
ReactomeiREACT_75881. Methionine salvage pathway.

Miscellaneous databases

ChiTaRSiADI1. human.
GeneWikiiADI1.
GenomeRNAii55256.
NextBioi59336.
PROiQ9BV57.
SOURCEiSearch...

Gene expression databases

BgeeiQ9BV57.
CleanExiHS_ADI1.
ExpressionAtlasiQ9BV57. baseline and differential.
GenevisibleiQ9BV57. HS.

Family and domain databases

Gene3Di2.60.120.10. 1 hit.
HAMAPiMF_03154. Salvage_MtnD_euk.
InterProiIPR004313. Acireductn_dOase_family.
IPR027496. MTCBP-1_eukaryotes.
IPR014710. RmlC-like_jellyroll.
IPR011051. RmlC_Cupin.
[Graphical view]
PANTHERiPTHR23418. PTHR23418. 1 hit.
PfamiPF03079. ARD. 1 hit.
[Graphical view]
SUPFAMiSSF51182. SSF51182. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein-1 is a new member of the cupin superfamily. A possible multifunctional protein acting as an invasion suppressor down-regulated in tumors."
    Uekita T., Gotoh I., Kinoshita T., Itoh Y., Sato H., Shiomi T., Okada Y., Seiki M.
    J. Biol. Chem. 279:12734-12743(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH MMP14, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Fibroblast.
  2. "Cloning and expression of a new human cDNA homologous to O.sativa submergence induced protein 2 (sip2) mRNA."
    Fan Y.X., Yu L., Ding J.B., Hu P.R., Fu S.N., Zhao S.Y.
    Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas."
    Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A.
    Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Hepatoblastoma.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Ovarian carcinoma and Thalamus.
  5. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Adipose tissue.
  6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.
  9. "Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini."
    Xu G., Shin S.B., Jaffrey S.R.
    Proc. Natl. Acad. Sci. U.S.A. 106:19310-19315(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE [LARGE SCALE ANALYSIS] OF 2-30.
    Tissue: Leukemic T-cell.
  10. "Identification of a hepatic factor capable of supporting hepatitis C virus replication in a nonpermissive cell line."
    Yeh C.-T., Lai H.-Y., Chen T.-C., Chu C.-M., Liaw Y.-F.
    J. Virol. 75:11017-11024(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 50-179, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Liver.
  11. "Membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1 (MTCBP-1) acts as an eukaryotic aci-reductone dioxygenase (ARD) in the methionine salvage pathway."
    Hirano W., Gotoh I., Uekita T., Seiki M.
    Genes Cells 10:565-574(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, CATALYTIC ACTIVITY, MUTAGENESIS OF GLU-94.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  13. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiMTND_HUMAN
AccessioniPrimary (citable) accession number: Q9BV57
Secondary accession number(s): D6W4Y3
, Q53HW3, Q53QD3, Q57YV7, Q68CK2, Q6ZSF7, Q7Z512, Q96P85, Q9NV57
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 11, 2005
Last sequence update: June 1, 2001
Last modified: June 24, 2015
This is version 130 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.