Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BV57 (MTND_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 117. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase

EC=1.13.11.54
Alternative name(s):
Acireductone dioxygenase (Fe(2+)-requiring)
Short name=ARD
Short name=Fe-ARD
Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1
Short name=MTCBP-1
Submergence-induced protein-like factor
Short name=Sip-L
Gene names
Name:ADI1
Synonyms:MTCBP1
ORF Names:HMFT1638
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length179 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene). Also down-regulates cell migration mediated by MMP14. Necessary for hepatitis C virus replication in an otherwise non-permissive cell line. Ref.10 Ref.11

Catalytic activity

1,2-dihydroxy-5-(methylthio)pent-1-en-3-one + O2 = 4-(methylthio)-2-oxobutanoate + formate. Ref.11

Cofactor

Binds 1 iron ion per monomer. Can also use other divalent metal cations By similarity.

Pathway

Amino-acid biosynthesis; L-methionine biosynthesis via salvage pathway; L-methionine from S-methyl-5-thio-alpha-D-ribose 1-phosphate: step 5/6. HAMAP-Rule MF_03154

Subunit structure

Monomer By similarity. Interacts with MMP14. Ref.1

Subcellular location

Cytoplasm. Nucleus. Cell membrane; Peripheral membrane protein; Cytoplasmic side. Note: Localizes to the plasma membrane when complexed to MMP14. Ref.1 Ref.10

Tissue specificity

Detected in heart, colon, lung, stomach, brain, spleen, liver, skeletal muscle and kidney. Ref.1 Ref.10

Sequence similarities

Belongs to the acireductone dioxygenase (ARD) family.

Sequence caution

The sequence AAL25800.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

The sequence BAD38646.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence BAD96187.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Binary interactions

With

Entry

#Exp.

IntAct

Notes

MMP14P502814EBI-992807,EBI-992788

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BV57-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9BV57-2)

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWK → MSVKSSKLMFLCHGSSRSLHSGSLTSCNTGVCCS
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 1791791,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase HAMAP-Rule MF_03154
PRO_0000162942

Sites

Metal binding881Iron or nickel By similarity
Metal binding901Iron or nickel By similarity
Metal binding941Iron or nickel By similarity
Metal binding1331Iron or nickel By similarity

Natural variations

Alternative sequence1 – 4040MVQAW…VLYWK → MSVKSSKLMFLCHGSSRSLH SGSLTSCNTGVCCS in isoform 2.
VSP_015822

Experimental info

Mutagenesis941E → A: Loss of aci-reductone dioxygenase activity. Ref.11
Sequence conflict31Q → L in BAA91901. Ref.4
Sequence conflict1081R → G in BAD96187. Ref.5
Sequence conflict1701Q → K in AAP97173. Ref.2

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2001. Version 1.
Checksum: 92E13B9718D44C27

FASTA17921,498
        10         20         30         40         50         60 
MVQAWYMDDA PGDPRQPHRP DPGRPVGLEQ LRRLGVLYWK LDADKYENDP ELEKIRRERN 

        70         80         90        100        110        120 
YSWMDIITIC KDKLPNYEEK IKMFYEEHLH LDDEIRYILD GSGYFDVRDK EDQWIRIFME 

       130        140        150        160        170 
KGDMVTLPAG IYHRFTVDEK NYTKAMRLFV GEPVWTAYNR PADHFEARGQ YVKFLAQTA 

« Hide

Isoform 2 [UniParc].

Checksum: 5AE5570210391A36
Show »

FASTA17320,332

References

« Hide 'large scale' references
[1]"Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein-1 is a new member of the cupin superfamily. A possible multifunctional protein acting as an invasion suppressor down-regulated in tumors."
Uekita T., Gotoh I., Kinoshita T., Itoh Y., Sato H., Shiomi T., Okada Y., Seiki M.
J. Biol. Chem. 279:12734-12743(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH MMP14, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
Tissue: Fibroblast.
[2]"Cloning and expression of a new human cDNA homologous to O.sativa submergence induced protein 2 (sip2) mRNA."
Fan Y.X., Yu L., Ding J.B., Hu P.R., Fu S.N., Zhao S.Y.
Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
[3]"Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas."
Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A.
Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Hepatoblastoma.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Ovarian carcinoma and Thalamus.
[5]Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Adipose tissue.
[6]"Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H. expand/collapse author list , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[7]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[8]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Placenta.
[9]"Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini."
Xu G., Shin S.B., Jaffrey S.R.
Proc. Natl. Acad. Sci. U.S.A. 106:19310-19315(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: PROTEIN SEQUENCE [LARGE SCALE ANALYSIS] OF 2-30.
Tissue: Leukemic T-cell.
[10]"Identification of a hepatic factor capable of supporting hepatitis C virus replication in a nonpermissive cell line."
Yeh C.-T., Lai H.-Y., Chen T.-C., Chu C.-M., Liaw Y.-F.
J. Virol. 75:11017-11024(2001) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 50-179, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
Tissue: Liver.
[11]"Membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1 (MTCBP-1) acts as an eukaryotic aci-reductone dioxygenase (ARD) in the methionine salvage pathway."
Hirano W., Gotoh I., Uekita T., Seiki M.
Genes Cells 10:565-574(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, CATALYTIC ACTIVITY, MUTAGENESIS OF GLU-94.
[12]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AB158319 mRNA. Translation: BAD10866.1.
AF087863 mRNA. Translation: AAP97173.1.
AB073609 mRNA. Translation: BAD38646.1. Different initiation.
AK001775 mRNA. Translation: BAA91901.1.
AK127473 mRNA. Translation: BAC86996.1.
AK222467 mRNA. Translation: BAD96187.1. Different initiation.
AC142528 Genomic DNA. Translation: AAX82038.1.
AC114810 Genomic DNA. Translation: AAY24022.1.
CH471053 Genomic DNA. Translation: EAX01064.1.
CH471053 Genomic DNA. Translation: EAX01065.1.
BC001467 mRNA. Translation: AAH01467.1.
AF403478 mRNA. Translation: AAL25800.1. Different initiation.
RefSeqNP_060739.2. NM_018269.3.
XP_005264753.1. XM_005264696.1.
UniGeneHs.502773.

3D structure databases

ProteinModelPortalQ9BV57.
SMRQ9BV57. Positions 1-179.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid120547. 6 interactions.
IntActQ9BV57. 2 interactions.

PTM databases

PhosphoSiteQ9BV57.

Polymorphism databases

DMDM74733289.

Proteomic databases

PaxDbQ9BV57.
PRIDEQ9BV57.

Protocols and materials databases

DNASU55256.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000327435; ENSP00000333666; ENSG00000182551. [Q9BV57-1]
ENST00000382093; ENSP00000371525; ENSG00000182551. [Q9BV57-2]
GeneID55256.
KEGGhsa:55256.
UCSCuc002qxp.4. human. [Q9BV57-1]

Organism-specific databases

CTD55256.
GeneCardsGC02M003501.
HGNCHGNC:30576. ADI1.
HPAHPA035403.
MIM613400. gene.
neXtProtNX_Q9BV57.
PharmGKBPA143485291.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG1791.
HOVERGENHBG081992.
InParanoidQ9BV57.
KOK08967.
OMAGFFDVRE.
OrthoDBEOG73FQP0.
PhylomeDBQ9BV57.
TreeFamTF300231.

Enzyme and pathway databases

ReactomeREACT_111217. Metabolism.
UniPathwayUPA00904; UER00878.

Gene expression databases

BgeeQ9BV57.
CleanExHS_ADI1.
GenevestigatorQ9BV57.

Family and domain databases

Gene3D2.60.120.10. 1 hit.
HAMAPMF_03154. Salvage_MtnD_euk.
InterProIPR004313. Acireductn_dOase_family.
IPR027496. MTCBP-1_eukaryotes.
IPR014710. RmlC-like_jellyroll.
IPR011051. RmlC_Cupin.
[Graphical view]
PANTHERPTHR23418. PTHR23418. 1 hit.
PfamPF03079. ARD. 1 hit.
[Graphical view]
SUPFAMSSF51182. SSF51182. 1 hit.
ProtoNetSearch...

Other

ChiTaRSADI1. human.
GeneWikiADI1.
GenomeRNAi55256.
NextBio59336.
PROQ9BV57.
SOURCESearch...

Entry information

Entry nameMTND_HUMAN
AccessionPrimary (citable) accession number: Q9BV57
Secondary accession number(s): D6W4Y3 expand/collapse secondary AC list , Q53HW3, Q53QD3, Q57YV7, Q68CK2, Q6ZSF7, Q7Z512, Q96P85, Q9NV57
Entry history
Integrated into UniProtKB/Swiss-Prot: October 11, 2005
Last sequence update: June 1, 2001
Last modified: April 16, 2014
This is version 117 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PATHWAY comments

Index of metabolic and biosynthesis pathways

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 2

Human chromosome 2: entries, gene names and cross-references to MIM