SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BV57

- MTND_HUMAN

UniProt

Q9BV57 - MTND_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase
Gene
ADI1, MTCBP1, HMFT1638
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Catalyzes the formation of formate and 2-keto-4-methylthiobutyrate (KMTB) from 1,2-dihydroxy-3-keto-5-methylthiopentene (DHK-MTPene). Also down-regulates cell migration mediated by MMP14. Necessary for hepatitis C virus replication in an otherwise non-permissive cell line.2 Publications

Catalytic activityi

1,2-dihydroxy-5-(methylthio)pent-1-en-3-one + O2 = 4-(methylthio)-2-oxobutanoate + formate.1 Publication

Cofactori

Binds 1 iron ion per monomer. Can also use other divalent metal cations By similarity.

Pathwayi

Sites

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Metal bindingi88 – 881Iron or nickel By similarity
Metal bindingi90 – 901Iron or nickel By similarity
Metal bindingi94 – 941Iron or nickel By similarity
Metal bindingi133 – 1331Iron or nickel By similarity

GO - Molecular functioni

  1. acireductone dioxygenase [iron(II)-requiring] activity Source: Reactome
  2. iron ion binding Source: UniProtKB-HAMAP
  3. oxidoreductase activity Source: UniProtKB
  4. protein binding Source: UniProtKB

GO - Biological processi

  1. L-methionine salvage from methylthioadenosine Source: UniProtKB
  2. cellular nitrogen compound metabolic process Source: Reactome
  3. polyamine metabolic process Source: Reactome
  4. small molecule metabolic process Source: Reactome
  5. sulfur amino acid metabolic process Source: Reactome
Complete GO annotation...

Keywords - Molecular functioni

Dioxygenase, Oxidoreductase

Keywords - Biological processi

Amino-acid biosynthesis, Methionine biosynthesis

Keywords - Ligandi

Iron, Metal-binding

Enzyme and pathway databases

ReactomeiREACT_75881. Methionine salvage pathway.
UniPathwayiUPA00904; UER00878.

Names & Taxonomyi

Protein namesi
Recommended name:
1,2-dihydroxy-3-keto-5-methylthiopentene dioxygenase (EC:1.13.11.54)
Alternative name(s):
Acireductone dioxygenase (Fe(2+)-requiring)
Short name:
ARD
Short name:
Fe-ARD
Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein 1
Short name:
MTCBP-1
Submergence-induced protein-like factor
Short name:
Sip-L
Gene namesi
Name:ADI1
Synonyms:MTCBP1
ORF Names:HMFT1638
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 2

Organism-specific databases

HGNCiHGNC:30576. ADI1.

Subcellular locationi

Cytoplasm. Nucleus. Cell membrane; Peripheral membrane protein; Cytoplasmic side
Note: Localizes to the plasma membrane when complexed to MMP14.2 Publications

GO - Cellular componenti

  1. Golgi apparatus Source: HPA
  2. cytoplasm Source: UniProtKB
  3. cytosol Source: Reactome
  4. nucleus Source: UniProtKB
  5. plasma membrane Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Cell membrane, Cytoplasm, Membrane, Nucleus

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Mutagenesisi94 – 941E → A: Loss of aci-reductone dioxygenase activity. 1 Publication

Organism-specific databases

PharmGKBiPA143485291.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 1791791,2-dihydroxy-3-keto-5-methylthiopentene dioxygenaseUniRule annotation
PRO_0000162942Add
BLAST

Proteomic databases

MaxQBiQ9BV57.
PaxDbiQ9BV57.
PRIDEiQ9BV57.

PTM databases

PhosphoSiteiQ9BV57.

Expressioni

Tissue specificityi

Detected in heart, colon, lung, stomach, brain, spleen, liver, skeletal muscle and kidney.2 Publications

Gene expression databases

BgeeiQ9BV57.
CleanExiHS_ADI1.
GenevestigatoriQ9BV57.

Organism-specific databases

HPAiHPA035403.

Interactioni

Subunit structurei

Monomer By similarity. Interacts with MMP14.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
MMP14P502814EBI-992807,EBI-992788

Protein-protein interaction databases

BioGridi120547. 6 interactions.
IntActiQ9BV57. 2 interactions.

Structurei

3D structure databases

ProteinModelPortaliQ9BV57.
SMRiQ9BV57. Positions 1-179.

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiCOG1791.
HOVERGENiHBG081992.
InParanoidiQ9BV57.
KOiK08967.
OMAiTTDESNY.
OrthoDBiEOG73FQP0.
PhylomeDBiQ9BV57.
TreeFamiTF300231.

Family and domain databases

Gene3Di2.60.120.10. 1 hit.
HAMAPiMF_03154. Salvage_MtnD_euk.
InterProiIPR004313. Acireductn_dOase_family.
IPR027496. MTCBP-1_eukaryotes.
IPR014710. RmlC-like_jellyroll.
IPR011051. RmlC_Cupin.
[Graphical view]
PANTHERiPTHR23418. PTHR23418. 1 hit.
PfamiPF03079. ARD. 1 hit.
[Graphical view]
SUPFAMiSSF51182. SSF51182. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BV57-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVQAWYMDDA PGDPRQPHRP DPGRPVGLEQ LRRLGVLYWK LDADKYENDP    50
ELEKIRRERN YSWMDIITIC KDKLPNYEEK IKMFYEEHLH LDDEIRYILD 100
GSGYFDVRDK EDQWIRIFME KGDMVTLPAG IYHRFTVDEK NYTKAMRLFV 150
GEPVWTAYNR PADHFEARGQ YVKFLAQTA 179
Length:179
Mass (Da):21,498
Last modified:June 1, 2001 - v1
Checksum:i92E13B9718D44C27
GO
Isoform 2 (identifier: Q9BV57-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-40: MVQAWYMDDAPGDPRQPHRPDPGRPVGLEQLRRLGVLYWK → MSVKSSKLMFLCHGSSRSLHSGSLTSCNTGVCCS

Note: No experimental confirmation available.

Show »
Length:173
Mass (Da):20,332
Checksum:i5AE5570210391A36
GO

Sequence cautioni

The sequence AAL25800.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.
The sequence BAD38646.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAD96187.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 4040MVQAW…VLYWK → MSVKSSKLMFLCHGSSRSLH SGSLTSCNTGVCCS in isoform 2.
VSP_015822Add
BLAST

Sequence conflict

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti3 – 31Q → L in BAA91901. 1 Publication
Sequence conflicti108 – 1081R → G in BAD96187. 1 Publication
Sequence conflicti170 – 1701Q → K in AAP97173. 1 Publication

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB158319 mRNA. Translation: BAD10866.1.
AF087863 mRNA. Translation: AAP97173.1.
AB073609 mRNA. Translation: BAD38646.1. Different initiation.
AK001775 mRNA. Translation: BAA91901.1.
AK127473 mRNA. Translation: BAC86996.1.
AK222467 mRNA. Translation: BAD96187.1. Different initiation.
AC142528 Genomic DNA. Translation: AAX82038.1.
AC114810 Genomic DNA. Translation: AAY24022.1.
CH471053 Genomic DNA. Translation: EAX01064.1.
CH471053 Genomic DNA. Translation: EAX01065.1.
BC001467 mRNA. Translation: AAH01467.1.
AF403478 mRNA. Translation: AAL25800.1. Different initiation.
CCDSiCCDS1653.1. [Q9BV57-1]
RefSeqiNP_060739.2. NM_018269.3. [Q9BV57-1]
XP_005264753.1. XM_005264696.1. [Q9BV57-2]
UniGeneiHs.502773.

Genome annotation databases

EnsembliENST00000327435; ENSP00000333666; ENSG00000182551. [Q9BV57-1]
ENST00000382093; ENSP00000371525; ENSG00000182551. [Q9BV57-2]
GeneIDi55256.
KEGGihsa:55256.
UCSCiuc002qxp.4. human. [Q9BV57-1]

Polymorphism databases

DMDMi74733289.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AB158319 mRNA. Translation: BAD10866.1 .
AF087863 mRNA. Translation: AAP97173.1 .
AB073609 mRNA. Translation: BAD38646.1 . Different initiation.
AK001775 mRNA. Translation: BAA91901.1 .
AK127473 mRNA. Translation: BAC86996.1 .
AK222467 mRNA. Translation: BAD96187.1 . Different initiation.
AC142528 Genomic DNA. Translation: AAX82038.1 .
AC114810 Genomic DNA. Translation: AAY24022.1 .
CH471053 Genomic DNA. Translation: EAX01064.1 .
CH471053 Genomic DNA. Translation: EAX01065.1 .
BC001467 mRNA. Translation: AAH01467.1 .
AF403478 mRNA. Translation: AAL25800.1 . Different initiation.
CCDSi CCDS1653.1. [Q9BV57-1 ]
RefSeqi NP_060739.2. NM_018269.3. [Q9BV57-1 ]
XP_005264753.1. XM_005264696.1. [Q9BV57-2 ]
UniGenei Hs.502773.

3D structure databases

ProteinModelPortali Q9BV57.
SMRi Q9BV57. Positions 1-179.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120547. 6 interactions.
IntActi Q9BV57. 2 interactions.

PTM databases

PhosphoSitei Q9BV57.

Polymorphism databases

DMDMi 74733289.

Proteomic databases

MaxQBi Q9BV57.
PaxDbi Q9BV57.
PRIDEi Q9BV57.

Protocols and materials databases

DNASUi 55256.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000327435 ; ENSP00000333666 ; ENSG00000182551 . [Q9BV57-1 ]
ENST00000382093 ; ENSP00000371525 ; ENSG00000182551 . [Q9BV57-2 ]
GeneIDi 55256.
KEGGi hsa:55256.
UCSCi uc002qxp.4. human. [Q9BV57-1 ]

Organism-specific databases

CTDi 55256.
GeneCardsi GC02M003501.
HGNCi HGNC:30576. ADI1.
HPAi HPA035403.
MIMi 613400. gene.
neXtProti NX_Q9BV57.
PharmGKBi PA143485291.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG1791.
HOVERGENi HBG081992.
InParanoidi Q9BV57.
KOi K08967.
OMAi TTDESNY.
OrthoDBi EOG73FQP0.
PhylomeDBi Q9BV57.
TreeFami TF300231.

Enzyme and pathway databases

UniPathwayi UPA00904 ; UER00878 .
Reactomei REACT_75881. Methionine salvage pathway.

Miscellaneous databases

ChiTaRSi ADI1. human.
GeneWikii ADI1.
GenomeRNAii 55256.
NextBioi 59336.
PROi Q9BV57.
SOURCEi Search...

Gene expression databases

Bgeei Q9BV57.
CleanExi HS_ADI1.
Genevestigatori Q9BV57.

Family and domain databases

Gene3Di 2.60.120.10. 1 hit.
HAMAPi MF_03154. Salvage_MtnD_euk.
InterProi IPR004313. Acireductn_dOase_family.
IPR027496. MTCBP-1_eukaryotes.
IPR014710. RmlC-like_jellyroll.
IPR011051. RmlC_Cupin.
[Graphical view ]
PANTHERi PTHR23418. PTHR23418. 1 hit.
Pfami PF03079. ARD. 1 hit.
[Graphical view ]
SUPFAMi SSF51182. SSF51182. 1 hit.
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Membrane-type 1 matrix metalloproteinase cytoplasmic tail-binding protein-1 is a new member of the cupin superfamily. A possible multifunctional protein acting as an invasion suppressor down-regulated in tumors."
    Uekita T., Gotoh I., Kinoshita T., Itoh Y., Sato H., Shiomi T., Okada Y., Seiki M.
    J. Biol. Chem. 279:12734-12743(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH MMP14, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Fibroblast.
  2. "Cloning and expression of a new human cDNA homologous to O.sativa submergence induced protein 2 (sip2) mRNA."
    Fan Y.X., Yu L., Ding J.B., Hu P.R., Fu S.N., Zhao S.Y.
    Submitted (JUL-2003) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1).
  3. "Expression profiling and differential screening between hepatoblastomas and the corresponding normal livers: identification of high expression of the PLK1 oncogene as a poor-prognostic indicator of hepatoblastomas."
    Yamada S., Ohira M., Horie H., Ando K., Takayasu H., Suzuki Y., Sugano S., Hirata T., Goto T., Matsunaga T., Hiyama E., Hayashi Y., Ando H., Suita S., Kaneko M., Sasaki F., Hashizume K., Ohnuma N., Nakagawara A.
    Oncogene 23:5901-5911(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Hepatoblastoma.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Ovarian carcinoma and Thalamus.
  5. Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S.
    Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Adipose tissue.
  6. "Generation and annotation of the DNA sequences of human chromosomes 2 and 4."
    Hillier L.W., Graves T.A., Fulton R.S., Fulton L.A., Pepin K.H., Minx P., Wagner-McPherson C., Layman D., Wylie K., Sekhon M., Becker M.C., Fewell G.A., Delehaunty K.D., Miner T.L., Nash W.E., Kremitzki C., Oddy L., Du H.
    , Sun H., Bradshaw-Cordum H., Ali J., Carter J., Cordes M., Harris A., Isak A., van Brunt A., Nguyen C., Du F., Courtney L., Kalicki J., Ozersky P., Abbott S., Armstrong J., Belter E.A., Caruso L., Cedroni M., Cotton M., Davidson T., Desai A., Elliott G., Erb T., Fronick C., Gaige T., Haakenson W., Haglund K., Holmes A., Harkins R., Kim K., Kruchowski S.S., Strong C.M., Grewal N., Goyea E., Hou S., Levy A., Martinka S., Mead K., McLellan M.D., Meyer R., Randall-Maher J., Tomlinson C., Dauphin-Kohlberg S., Kozlowicz-Reilly A., Shah N., Swearengen-Shahid S., Snider J., Strong J.T., Thompson J., Yoakum M., Leonard S., Pearman C., Trani L., Radionenko M., Waligorski J.E., Wang C., Rock S.M., Tin-Wollam A.-M., Maupin R., Latreille P., Wendl M.C., Yang S.-P., Pohl C., Wallis J.W., Spieth J., Bieri T.A., Berkowicz N., Nelson J.O., Osborne J., Ding L., Meyer R., Sabo A., Shotland Y., Sinha P., Wohldmann P.E., Cook L.L., Hickenbotham M.T., Eldred J., Williams D., Jones T.A., She X., Ciccarelli F.D., Izaurralde E., Taylor J., Schmutz J., Myers R.M., Cox D.R., Huang X., McPherson J.D., Mardis E.R., Clifton S.W., Warren W.C., Chinwalla A.T., Eddy S.R., Marra M.A., Ovcharenko I., Furey T.S., Miller W., Eichler E.E., Bork P., Suyama M., Torrents D., Waterston R.H., Wilson R.K.
    Nature 434:724-731(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  7. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  8. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Placenta.
  9. "Global profiling of protease cleavage sites by chemoselective labeling of protein N-termini."
    Xu G., Shin S.B., Jaffrey S.R.
    Proc. Natl. Acad. Sci. U.S.A. 106:19310-19315(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: PROTEIN SEQUENCE [LARGE SCALE ANALYSIS] OF 2-30.
    Tissue: Leukemic T-cell.
  10. "Identification of a hepatic factor capable of supporting hepatitis C virus replication in a nonpermissive cell line."
    Yeh C.-T., Lai H.-Y., Chen T.-C., Chu C.-M., Liaw Y.-F.
    J. Virol. 75:11017-11024(2001) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 50-179, FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Liver.
  11. "Membrane-type 1 matrix metalloproteinase cytoplasmic tail binding protein-1 (MTCBP-1) acts as an eukaryotic aci-reductone dioxygenase (ARD) in the methionine salvage pathway."
    Hirano W., Gotoh I., Uekita T., Seiki M.
    Genes Cells 10:565-574(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, CATALYTIC ACTIVITY, MUTAGENESIS OF GLU-94.
  12. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiMTND_HUMAN
AccessioniPrimary (citable) accession number: Q9BV57
Secondary accession number(s): D6W4Y3
, Q53HW3, Q53QD3, Q57YV7, Q68CK2, Q6ZSF7, Q7Z512, Q96P85, Q9NV57
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 11, 2005
Last sequence update: June 1, 2001
Last modified: September 3, 2014
This is version 121 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Direct protein sequencing, Reference proteome

Documents

  1. Human chromosome 2
    Human chromosome 2: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PATHWAY comments
    Index of metabolic and biosynthesis pathways
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi