Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium-binding mitochondrial carrier protein SCaMC-3

Gene

SLC25A23

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane (PubMed:15123600). May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria (PubMed:15123600). Acts as a regulator of mitochondrial calcium uptake via interaction with MCU and MICU1 (PubMed:24430870).2 Publications

Kineticsi

  1. KM=1.3 mM for AMP1 Publication
  2. KM=0.54 mM for ADP1 Publication
  3. KM=0.31 mM for ATP1 Publication
  4. KM=0.22 mM for ATP-Mg1 Publication
  5. KM=1.4 mM for Pi1 Publication
  1. Vmax=68 µmol/min/g enzyme with AMP as substrate1 Publication
  2. Vmax=73 µmol/min/g enzyme with ADP as substrate1 Publication
  3. Vmax=65 µmol/min/g enzyme with ATP as substrate1 Publication
  4. Vmax=79 µmol/min/g enzyme with ATP-Mg as substrate1 Publication
  5. Vmax=70 µmol/min/g enzyme with Pi as substrate1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi22 – 331PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi90 – 1012PROSITE-ProRule annotationAdd BLAST12

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transport

Keywords - Ligandi

Calcium, Metal-binding

Protein family/group databases

TCDBi2.A.29.23.5. the mitochondrial carrier (mc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-binding mitochondrial carrier protein SCaMC-3
Alternative name(s):
Mitochondrial ATP-Mg/Pi carrier protein 2
Mitochondrial Ca(2+)-dependent solute carrier protein 2
Small calcium-binding mitochondrial carrier protein 3
Solute carrier family 25 member 23
Gene namesi
Name:SLC25A23
Synonyms:APC2, MCSC2, SCAMC3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:19375. SLC25A23.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 188Mitochondrial intermembraneSequence analysisAdd BLAST188
Transmembranei189 – 206Helical; Name=1Sequence analysisAdd BLAST18
Topological domaini207 – 243Mitochondrial matrixSequence analysisAdd BLAST37
Transmembranei244 – 263Helical; Name=2Sequence analysisAdd BLAST20
Topological domaini264 – 286Mitochondrial intermembraneSequence analysisAdd BLAST23
Transmembranei287 – 300Helical; Name=3Sequence analysisAdd BLAST14
Topological domaini301 – 336Mitochondrial matrixSequence analysisAdd BLAST36
Transmembranei337 – 356Helical; Name=4Sequence analysisAdd BLAST20
Topological domaini357 – 379Mitochondrial intermembraneSequence analysisAdd BLAST23
Transmembranei380 – 397Helical; Name=5Sequence analysisAdd BLAST18
Topological domaini398 – 436Mitochondrial matrixSequence analysisAdd BLAST39
Transmembranei437 – 456Helical; Name=6Sequence analysisAdd BLAST20
Topological domaini457 – 468Mitochondrial intermembraneSequence analysisAdd BLAST12

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi22D → A: Abolishes the ability to regulate mitochondrial calcium uptake; when associated with K-33; A-90 and K-101. 1 Publication1
Mutagenesisi33E → K: Abolishes the ability to regulate mitochondrial calcium uptake; when associated with A-22; A-90 and K-101. 1 Publication1
Mutagenesisi90D → A: Abolishes the ability to regulate mitochondrial calcium uptake; when associated with A-22; K-33 and K-101. 1 Publication1
Mutagenesisi101E → K: Abolishes the ability to regulate mitochondrial calcium uptake; when associated with A-22; K-33 and A-90. 1 Publication1

Organism-specific databases

DisGeNETi79085.
OpenTargetsiENSG00000125648.
PharmGKBiPA134932456.

Polymorphism and mutation databases

BioMutaiSLC25A23.
DMDMi167016556.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003176091 – 468Calcium-binding mitochondrial carrier protein SCaMC-3Add BLAST468

Proteomic databases

MaxQBiQ9BV35.
PaxDbiQ9BV35.
PeptideAtlasiQ9BV35.
PRIDEiQ9BV35.

PTM databases

iPTMnetiQ9BV35.
PhosphoSitePlusiQ9BV35.

Expressioni

Tissue specificityi

Present in various cell lines (at protein level). Expressed at low levels in most tissues examined, with highest expression in brain, skeletal muscle and pancreas.3 Publications

Gene expression databases

BgeeiENSG00000125648.
CleanExiHS_APC2.
HS_SLC25A23.
ExpressionAtlasiQ9BV35. baseline and differential.
GenevisibleiQ9BV35. HS.

Organism-specific databases

HPAiHPA050883.

Interactioni

Subunit structurei

Interacts with MCU (PubMed:24430870). Interacts with MICU1 (PubMed:24430870).1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
APPBP2Q926243EBI-2933255,EBI-743771

Protein-protein interaction databases

BioGridi122533. 18 interactors.
IntActiQ9BV35. 2 interactors.
STRINGi9606.ENSP00000301454.

Structurei

3D structure databases

ProteinModelPortaliQ9BV35.
SMRiQ9BV35.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini9 – 44EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini77 – 112EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini113 – 148EF-hand 3PROSITE-ProRule annotationAdd BLAST36
Repeati183 – 269Solcar 1Add BLAST87
Repeati277 – 362Solcar 2Add BLAST86
Repeati374 – 462Solcar 3Add BLAST89

Sequence similaritiesi

Contains 3 EF-hand domains.PROSITE-ProRule annotation
Contains 3 Solcar repeats.PROSITE-ProRule annotation

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0036. Eukaryota.
ENOG410XQ4P. LUCA.
GeneTreeiENSGT00760000119245.
HOVERGENiHBG108464.
InParanoidiQ9BV35.
KOiK14684.
OrthoDBiEOG091G0C8S.
PhylomeDBiQ9BV35.
TreeFamiTF313492.

Family and domain databases

CDDicd00051. EFh. 2 hits.
Gene3Di1.10.238.10. 1 hit.
1.50.40.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR002067. Mit_carrier.
IPR018108. Mitochondrial_sb/sol_carrier.
IPR023395. Mt_carrier_dom.
[Graphical view]
PfamiPF13202. EF-hand_5. 1 hit.
PF13499. EF-hand_7. 1 hit.
PF00153. Mito_carr. 3 hits.
[Graphical view]
PRINTSiPR00926. MITOCARRIER.
SMARTiSM00054. EFh. 3 hits.
[Graphical view]
SUPFAMiSSF103506. SSF103506. 1 hit.
SSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 3 hits.
PS50920. SOLCAR. 3 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BV35-1) [UniParc]FASTAAdd to basket
Also known as: SCaMC-3a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRGSPGDAER RQRWGRLFEE LDSNKDGRVD VHELRQGLAR LGGGNPDPGA
60 70 80 90 100
QQGISSEGDA DPDGGLDLEE FSRYLQEREQ RLLLMFHSLD RNQDGHIDVS
110 120 130 140 150
EIQQSFRALG ISISLEQAEK ILHSMDRDGT MTIDWQEWRD HFLLHSLENV
160 170 180 190 200
EDVLYFWKHS TVLDIGECLT VPDEFSKQEK LTGMWWKQLV AGAVAGAVSR
210 220 230 240 250
TGTAPLDRLK VFMQVHASKT NRLNILGGLR SMVLEGGIRS LWRGNGINVL
260 270 280 290 300
KIAPESAIKF MAYEQIKRAI LGQQETLHVQ ERFVAGSLAG ATAQTIIYPM
310 320 330 340 350
EVLKTRLTLR RTGQYKGLLD CARRILEREG PRAFYRGYLP NVLGIIPYAG
360 370 380 390 400
IDLAVYETLK NWWLQQYSHD SADPGILVLL ACGTISSTCG QIASYPLALV
410 420 430 440 450
RTRMQAQASI EGGPQLSMLG LLRHILSQEG MRGLYRGIAP NFMKVIPAVS
460
ISYVVYENMK QALGVTSR
Length:468
Mass (Da):52,378
Last modified:February 5, 2008 - v2
Checksum:iB2D66A4665C27174
GO
Isoform 2 (identifier: Q9BV35-2) [UniParc]FASTAAdd to basket
Also known as: SCaMC-3b

The sequence of this isoform differs from the canonical sequence as follows:
     408-468: ASIEGGPQLS...MKQALGVTSR → DVSVYKTDTVPTLIELTGRRGRKMLNKSFWN

Show »
Length:438
Mass (Da):49,354
Checksum:i290DB81E953C5D3F
GO
Isoform 3 (identifier: Q9BV35-3) [UniParc]FASTAAdd to basket
Also known as: SCaMC-3c

The sequence of this isoform differs from the canonical sequence as follows:
     161-161: T → TLSSAGFSAWIKDSTAEQNRSKTTVLARRSGSHLKSQHFGRPKWADHE
     408-468: ASIEGGPQLS...MKQALGVTSR → GWSTVARFQITATSAFQVQAILLPQPPE

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:482
Mass (Da):54,035
Checksum:i8917BEA2BC2FE42B
GO
Isoform 4 (identifier: Q9BV35-4) [UniParc]FASTAAdd to basket
Also known as: SCaMC-3d

The sequence of this isoform differs from the canonical sequence as follows:
     408-468: ASIEGGPQLS...MKQALGVTSR → GWSTVARFQITATSAFQVQAILLPQPPE

Note: No experimental confirmation available.
Show »
Length:435
Mass (Da):48,786
Checksum:iDEE44DC4C31B7E9F
GO

Sequence cautioni

The sequence BAB70825 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAC11071 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_031074161T → TLSSAGFSAWIKDSTAEQNR SKTTVLARRSGSHLKSQHFG RPKWADHE in isoform 3. 1 Publication1
Alternative sequenceiVSP_031075408 – 468ASIEG…GVTSR → DVSVYKTDTVPTLIELTGRR GRKMLNKSFWN in isoform 2. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_031076408 – 468ASIEG…GVTSR → GWSTVARFQITATSAFQVQA ILLPQPPE in isoform 3 and isoform 4. 2 PublicationsAdd BLAST61

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ619988 mRNA. Translation: CAF04494.1.
AJ619962 mRNA. Translation: CAF04059.1.
AJ512835 mRNA. Translation: CAD55563.1.
AY750170 mRNA. Translation: AAU95077.1.
AK054901 mRNA. Translation: BAB70825.1. Different initiation.
AK074579 mRNA. Translation: BAC11071.1. Different initiation.
AK294514 mRNA. Translation: BAG57727.1.
CH471139 Genomic DNA. Translation: EAW69087.1.
CH471139 Genomic DNA. Translation: EAW69089.1.
BC001656 mRNA. Translation: AAH01656.1.
AJ879082 mRNA. Translation: CAI51684.1.
AJ879083 mRNA. Translation: CAI51685.1.
CCDSiCCDS32882.1. [Q9BV35-1]
RefSeqiNP_077008.2. NM_024103.2. [Q9BV35-1]
UniGeneiHs.356231.
Hs.732434.

Genome annotation databases

EnsembliENST00000264088; ENSP00000264088; ENSG00000125648. [Q9BV35-3]
ENST00000301454; ENSP00000301454; ENSG00000125648. [Q9BV35-1]
ENST00000334510; ENSP00000334537; ENSG00000125648. [Q9BV35-2]
GeneIDi79085.
KEGGihsa:79085.
UCSCiuc002mex.2. human. [Q9BV35-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ619988 mRNA. Translation: CAF04494.1.
AJ619962 mRNA. Translation: CAF04059.1.
AJ512835 mRNA. Translation: CAD55563.1.
AY750170 mRNA. Translation: AAU95077.1.
AK054901 mRNA. Translation: BAB70825.1. Different initiation.
AK074579 mRNA. Translation: BAC11071.1. Different initiation.
AK294514 mRNA. Translation: BAG57727.1.
CH471139 Genomic DNA. Translation: EAW69087.1.
CH471139 Genomic DNA. Translation: EAW69089.1.
BC001656 mRNA. Translation: AAH01656.1.
AJ879082 mRNA. Translation: CAI51684.1.
AJ879083 mRNA. Translation: CAI51685.1.
CCDSiCCDS32882.1. [Q9BV35-1]
RefSeqiNP_077008.2. NM_024103.2. [Q9BV35-1]
UniGeneiHs.356231.
Hs.732434.

3D structure databases

ProteinModelPortaliQ9BV35.
SMRiQ9BV35.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122533. 18 interactors.
IntActiQ9BV35. 2 interactors.
STRINGi9606.ENSP00000301454.

Protein family/group databases

TCDBi2.A.29.23.5. the mitochondrial carrier (mc) family.

PTM databases

iPTMnetiQ9BV35.
PhosphoSitePlusiQ9BV35.

Polymorphism and mutation databases

BioMutaiSLC25A23.
DMDMi167016556.

Proteomic databases

MaxQBiQ9BV35.
PaxDbiQ9BV35.
PeptideAtlasiQ9BV35.
PRIDEiQ9BV35.

Protocols and materials databases

DNASUi79085.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000264088; ENSP00000264088; ENSG00000125648. [Q9BV35-3]
ENST00000301454; ENSP00000301454; ENSG00000125648. [Q9BV35-1]
ENST00000334510; ENSP00000334537; ENSG00000125648. [Q9BV35-2]
GeneIDi79085.
KEGGihsa:79085.
UCSCiuc002mex.2. human. [Q9BV35-1]

Organism-specific databases

CTDi79085.
DisGeNETi79085.
GeneCardsiSLC25A23.
H-InvDBHIX0014698.
HGNCiHGNC:19375. SLC25A23.
HPAiHPA050883.
MIMi608746. gene.
neXtProtiNX_Q9BV35.
OpenTargetsiENSG00000125648.
PharmGKBiPA134932456.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG0036. Eukaryota.
ENOG410XQ4P. LUCA.
GeneTreeiENSGT00760000119245.
HOVERGENiHBG108464.
InParanoidiQ9BV35.
KOiK14684.
OrthoDBiEOG091G0C8S.
PhylomeDBiQ9BV35.
TreeFamiTF313492.

Miscellaneous databases

GenomeRNAii79085.
PROiQ9BV35.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000125648.
CleanExiHS_APC2.
HS_SLC25A23.
ExpressionAtlasiQ9BV35. baseline and differential.
GenevisibleiQ9BV35. HS.

Family and domain databases

CDDicd00051. EFh. 2 hits.
Gene3Di1.10.238.10. 1 hit.
1.50.40.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR002067. Mit_carrier.
IPR018108. Mitochondrial_sb/sol_carrier.
IPR023395. Mt_carrier_dom.
[Graphical view]
PfamiPF13202. EF-hand_5. 1 hit.
PF13499. EF-hand_7. 1 hit.
PF00153. Mito_carr. 3 hits.
[Graphical view]
PRINTSiPR00926. MITOCARRIER.
SMARTiSM00054. EFh. 3 hits.
[Graphical view]
SUPFAMiSSF103506. SSF103506. 1 hit.
SSF47473. SSF47473. 1 hit.
PROSITEiPS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 3 hits.
PS50920. SOLCAR. 3 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiSCMC3_HUMAN
AccessioniPrimary (citable) accession number: Q9BV35
Secondary accession number(s): B4DGB6
, Q4LBC2, Q705K3, Q86Y43, Q8N2N4, Q96NQ4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: February 5, 2008
Last modified: November 30, 2016
This is version 132 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.