Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BV35

- SCMC3_HUMAN

UniProt

Q9BV35 - SCMC3_HUMAN

Protein

Calcium-binding mitochondrial carrier protein SCaMC-3

Gene

SLC25A23

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 113 (01 Oct 2014)
      Sequence version 2 (05 Feb 2008)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.1 Publication

    Kineticsi

    1. KM=1.3 mM for AMP1 Publication
    2. KM=0.54 mM for ADP1 Publication
    3. KM=0.31 mM for ATP1 Publication
    4. KM=0.22 mM for ATP-Mg1 Publication
    5. KM=1.4 mM for Pi1 Publication

    Vmax=68 µmol/min/g enzyme with AMP as substrate1 Publication

    Vmax=73 µmol/min/g enzyme with ADP as substrate1 Publication

    Vmax=65 µmol/min/g enzyme with ATP as substrate1 Publication

    Vmax=79 µmol/min/g enzyme with ATP-Mg as substrate1 Publication

    Vmax=70 µmol/min/g enzyme with Pi as substrate1 Publication

    Regions

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Calcium bindingi22 – 33121PROSITE-ProRule annotationAdd
    BLAST
    Calcium bindingi90 – 101122PROSITE-ProRule annotationAdd
    BLAST

    GO - Molecular functioni

    1. calcium ion binding Source: InterPro

    GO - Biological processi

    1. transmembrane transport Source: InterPro

    Keywords - Biological processi

    Transport

    Keywords - Ligandi

    Calcium, Metal-binding

    Protein family/group databases

    TCDBi2.A.29.23.5. the mitochondrial carrier (mc) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Calcium-binding mitochondrial carrier protein SCaMC-3
    Alternative name(s):
    Mitochondrial ATP-Mg/Pi carrier protein 2
    Mitochondrial Ca(2+)-dependent solute carrier protein 2
    Small calcium-binding mitochondrial carrier protein 3
    Solute carrier family 25 member 23
    Gene namesi
    Name:SLC25A23
    Synonyms:APC2, MCSC2, SCAMC3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:19375. SLC25A23.

    Subcellular locationi

    Mitochondrion inner membrane 3 Publications; Multi-pass membrane protein 3 Publications

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. mitochondrial inner membrane Source: UniProtKB-SubCell

    Keywords - Cellular componenti

    Membrane, Mitochondrion, Mitochondrion inner membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA134932456.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 468468Calcium-binding mitochondrial carrier protein SCaMC-3PRO_0000317609Add
    BLAST

    Proteomic databases

    MaxQBiQ9BV35.
    PaxDbiQ9BV35.
    PRIDEiQ9BV35.

    PTM databases

    PhosphoSiteiQ9BV35.

    Expressioni

    Tissue specificityi

    Present in various cell lines (at protein level). Expressed at low levels in most tissues examined, with highest expression in brain, skeletal muscle and pancreas.3 Publications

    Gene expression databases

    ArrayExpressiQ9BV35.
    BgeeiQ9BV35.
    CleanExiHS_APC2.
    HS_SLC25A23.
    GenevestigatoriQ9BV35.

    Organism-specific databases

    HPAiHPA050883.

    Interactioni

    Protein-protein interaction databases

    BioGridi122533. 4 interactions.
    IntActiQ9BV35. 1 interaction.
    STRINGi9606.ENSP00000301454.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BV35.
    SMRiQ9BV35. Positions 13-444.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 188188Mitochondrial intermembraneSequence AnalysisAdd
    BLAST
    Topological domaini207 – 24337Mitochondrial matrixSequence AnalysisAdd
    BLAST
    Topological domaini264 – 28623Mitochondrial intermembraneSequence AnalysisAdd
    BLAST
    Topological domaini301 – 33636Mitochondrial matrixSequence AnalysisAdd
    BLAST
    Topological domaini357 – 37923Mitochondrial intermembraneSequence AnalysisAdd
    BLAST
    Topological domaini398 – 43639Mitochondrial matrixSequence AnalysisAdd
    BLAST
    Topological domaini457 – 46812Mitochondrial intermembraneSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei189 – 20618Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei244 – 26320Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei287 – 30014Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei337 – 35620Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei380 – 39718Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei437 – 45620Helical; Name=6Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Domains and Repeats

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Domaini9 – 4436EF-hand 1PROSITE-ProRule annotationAdd
    BLAST
    Domaini77 – 11236EF-hand 2PROSITE-ProRule annotationAdd
    BLAST
    Domaini113 – 14836EF-hand 3PROSITE-ProRule annotationAdd
    BLAST
    Repeati183 – 26987Solcar 1Add
    BLAST
    Repeati277 – 36286Solcar 2Add
    BLAST
    Repeati374 – 46289Solcar 3Add
    BLAST

    Sequence similaritiesi

    Contains 3 EF-hand domains.PROSITE-ProRule annotation
    Contains 3 Solcar repeats.PROSITE-ProRule annotation

    Keywords - Domaini

    Repeat, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG316894.
    HOVERGENiHBG108464.
    KOiK14684.
    OMAiGISICND.
    PhylomeDBiQ9BV35.
    TreeFamiTF313492.

    Family and domain databases

    Gene3Di1.10.238.10. 1 hit.
    1.50.40.10. 1 hit.
    InterProiIPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR002067. Mit_carrier.
    IPR018108. Mitochondrial_sb/sol_carrier.
    IPR023395. Mt_carrier_dom.
    [Graphical view]
    PfamiPF13405. EF-hand_6. 1 hit.
    PF13499. EF-hand_7. 1 hit.
    PF00153. Mito_carr. 3 hits.
    [Graphical view]
    PRINTSiPR00926. MITOCARRIER.
    SMARTiSM00054. EFh. 3 hits.
    [Graphical view]
    SUPFAMiSSF103506. SSF103506. 1 hit.
    PROSITEiPS00018. EF_HAND_1. 2 hits.
    PS50222. EF_HAND_2. 3 hits.
    PS50920. SOLCAR. 3 hits.
    [Graphical view]

    Sequences (4)i

    Sequence statusi: Complete.

    This entry describes 4 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BV35-1) [UniParc]FASTAAdd to Basket

    Also known as: SCaMC-3a

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MRGSPGDAER RQRWGRLFEE LDSNKDGRVD VHELRQGLAR LGGGNPDPGA    50
    QQGISSEGDA DPDGGLDLEE FSRYLQEREQ RLLLMFHSLD RNQDGHIDVS 100
    EIQQSFRALG ISISLEQAEK ILHSMDRDGT MTIDWQEWRD HFLLHSLENV 150
    EDVLYFWKHS TVLDIGECLT VPDEFSKQEK LTGMWWKQLV AGAVAGAVSR 200
    TGTAPLDRLK VFMQVHASKT NRLNILGGLR SMVLEGGIRS LWRGNGINVL 250
    KIAPESAIKF MAYEQIKRAI LGQQETLHVQ ERFVAGSLAG ATAQTIIYPM 300
    EVLKTRLTLR RTGQYKGLLD CARRILEREG PRAFYRGYLP NVLGIIPYAG 350
    IDLAVYETLK NWWLQQYSHD SADPGILVLL ACGTISSTCG QIASYPLALV 400
    RTRMQAQASI EGGPQLSMLG LLRHILSQEG MRGLYRGIAP NFMKVIPAVS 450
    ISYVVYENMK QALGVTSR 468
    Length:468
    Mass (Da):52,378
    Last modified:February 5, 2008 - v2
    Checksum:iB2D66A4665C27174
    GO
    Isoform 2 (identifier: Q9BV35-2) [UniParc]FASTAAdd to Basket

    Also known as: SCaMC-3b

    The sequence of this isoform differs from the canonical sequence as follows:
         408-468: ASIEGGPQLS...MKQALGVTSR → DVSVYKTDTVPTLIELTGRRGRKMLNKSFWN

    Show »
    Length:438
    Mass (Da):49,354
    Checksum:i290DB81E953C5D3F
    GO
    Isoform 3 (identifier: Q9BV35-3) [UniParc]FASTAAdd to Basket

    Also known as: SCaMC-3c

    The sequence of this isoform differs from the canonical sequence as follows:
         161-161: T → TLSSAGFSAWIKDSTAEQNRSKTTVLARRSGSHLKSQHFGRPKWADHE
         408-468: ASIEGGPQLS...MKQALGVTSR → GWSTVARFQITATSAFQVQAILLPQPPE

    Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

    Show »
    Length:482
    Mass (Da):54,035
    Checksum:i8917BEA2BC2FE42B
    GO
    Isoform 4 (identifier: Q9BV35-4) [UniParc]FASTAAdd to Basket

    Also known as: SCaMC-3d

    The sequence of this isoform differs from the canonical sequence as follows:
         408-468: ASIEGGPQLS...MKQALGVTSR → GWSTVARFQITATSAFQVQAILLPQPPE

    Note: No experimental confirmation available.

    Show »
    Length:435
    Mass (Da):48,786
    Checksum:iDEE44DC4C31B7E9F
    GO

    Sequence cautioni

    The sequence BAB70825.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
    The sequence BAC11071.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei161 – 1611T → TLSSAGFSAWIKDSTAEQNR SKTTVLARRSGSHLKSQHFG RPKWADHE in isoform 3. 1 PublicationVSP_031074
    Alternative sequencei408 – 46861ASIEG…GVTSR → DVSVYKTDTVPTLIELTGRR GRKMLNKSFWN in isoform 2. 1 PublicationVSP_031075Add
    BLAST
    Alternative sequencei408 – 46861ASIEG…GVTSR → GWSTVARFQITATSAFQVQA ILLPQPPE in isoform 3 and isoform 4. 2 PublicationsVSP_031076Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ619988 mRNA. Translation: CAF04494.1.
    AJ619962 mRNA. Translation: CAF04059.1.
    AJ512835 mRNA. Translation: CAD55563.1.
    AY750170 mRNA. Translation: AAU95077.1.
    AK054901 mRNA. Translation: BAB70825.1. Different initiation.
    AK074579 mRNA. Translation: BAC11071.1. Different initiation.
    AK294514 mRNA. Translation: BAG57727.1.
    CH471139 Genomic DNA. Translation: EAW69087.1.
    CH471139 Genomic DNA. Translation: EAW69089.1.
    BC001656 mRNA. Translation: AAH01656.1.
    AJ879082 mRNA. Translation: CAI51684.1.
    AJ879083 mRNA. Translation: CAI51685.1.
    CCDSiCCDS32882.1. [Q9BV35-1]
    RefSeqiNP_077008.2. NM_024103.2. [Q9BV35-1]
    UniGeneiHs.356231.
    Hs.732434.

    Genome annotation databases

    EnsembliENST00000264088; ENSP00000264088; ENSG00000125648. [Q9BV35-3]
    ENST00000301454; ENSP00000301454; ENSG00000125648. [Q9BV35-1]
    ENST00000334510; ENSP00000334537; ENSG00000125648. [Q9BV35-2]
    GeneIDi79085.
    KEGGihsa:79085.
    UCSCiuc002mex.1. human. [Q9BV35-1]

    Polymorphism databases

    DMDMi167016556.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AJ619988 mRNA. Translation: CAF04494.1 .
    AJ619962 mRNA. Translation: CAF04059.1 .
    AJ512835 mRNA. Translation: CAD55563.1 .
    AY750170 mRNA. Translation: AAU95077.1 .
    AK054901 mRNA. Translation: BAB70825.1 . Different initiation.
    AK074579 mRNA. Translation: BAC11071.1 . Different initiation.
    AK294514 mRNA. Translation: BAG57727.1 .
    CH471139 Genomic DNA. Translation: EAW69087.1 .
    CH471139 Genomic DNA. Translation: EAW69089.1 .
    BC001656 mRNA. Translation: AAH01656.1 .
    AJ879082 mRNA. Translation: CAI51684.1 .
    AJ879083 mRNA. Translation: CAI51685.1 .
    CCDSi CCDS32882.1. [Q9BV35-1 ]
    RefSeqi NP_077008.2. NM_024103.2. [Q9BV35-1 ]
    UniGenei Hs.356231.
    Hs.732434.

    3D structure databases

    ProteinModelPortali Q9BV35.
    SMRi Q9BV35. Positions 13-444.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122533. 4 interactions.
    IntActi Q9BV35. 1 interaction.
    STRINGi 9606.ENSP00000301454.

    Protein family/group databases

    TCDBi 2.A.29.23.5. the mitochondrial carrier (mc) family.

    PTM databases

    PhosphoSitei Q9BV35.

    Polymorphism databases

    DMDMi 167016556.

    Proteomic databases

    MaxQBi Q9BV35.
    PaxDbi Q9BV35.
    PRIDEi Q9BV35.

    Protocols and materials databases

    DNASUi 79085.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000264088 ; ENSP00000264088 ; ENSG00000125648 . [Q9BV35-3 ]
    ENST00000301454 ; ENSP00000301454 ; ENSG00000125648 . [Q9BV35-1 ]
    ENST00000334510 ; ENSP00000334537 ; ENSG00000125648 . [Q9BV35-2 ]
    GeneIDi 79085.
    KEGGi hsa:79085.
    UCSCi uc002mex.1. human. [Q9BV35-1 ]

    Organism-specific databases

    CTDi 79085.
    GeneCardsi GC19M006436.
    H-InvDB HIX0014698.
    HGNCi HGNC:19375. SLC25A23.
    HPAi HPA050883.
    MIMi 608746. gene.
    neXtProti NX_Q9BV35.
    PharmGKBi PA134932456.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG316894.
    HOVERGENi HBG108464.
    KOi K14684.
    OMAi GISICND.
    PhylomeDBi Q9BV35.
    TreeFami TF313492.

    Miscellaneous databases

    GenomeRNAii 79085.
    NextBioi 67901.
    PROi Q9BV35.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BV35.
    Bgeei Q9BV35.
    CleanExi HS_APC2.
    HS_SLC25A23.
    Genevestigatori Q9BV35.

    Family and domain databases

    Gene3Di 1.10.238.10. 1 hit.
    1.50.40.10. 1 hit.
    InterProi IPR011992. EF-hand-dom_pair.
    IPR018247. EF_Hand_1_Ca_BS.
    IPR002048. EF_hand_dom.
    IPR002067. Mit_carrier.
    IPR018108. Mitochondrial_sb/sol_carrier.
    IPR023395. Mt_carrier_dom.
    [Graphical view ]
    Pfami PF13405. EF-hand_6. 1 hit.
    PF13499. EF-hand_7. 1 hit.
    PF00153. Mito_carr. 3 hits.
    [Graphical view ]
    PRINTSi PR00926. MITOCARRIER.
    SMARTi SM00054. EFh. 3 hits.
    [Graphical view ]
    SUPFAMi SSF103506. SSF103506. 1 hit.
    PROSITEi PS00018. EF_HAND_1. 2 hits.
    PS50222. EF_HAND_2. 3 hits.
    PS50920. SOLCAR. 3 hits.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Identification of a novel human subfamily of mitochondrial carriers with calcium-binding domains."
      del Arco A., Satrustegui J.
      J. Biol. Chem. 279:24701-24713(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    2. "Identification of the mitochondrial ATP-Mg/Pi transporter. Bacterial expression, reconstitution, functional characterization, and tissue distribution."
      Fiermonte G., De Leonardis F., Todisco S., Palmieri L., Lasorsa F.M., Palmieri F.
      J. Biol. Chem. 279:30722-30730(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
      Tissue: Brain.
    3. "Cellular expression and alternative splicing of SLC25A23, a member of the mitochondrial Ca2+-dependent solute carrier gene family."
      Bassi M.T., Manzoni M., Bresciani R., Pizzo M.T., Della Monica A., Barlati S., Monti E., Borsani G.
      Gene 345:173-182(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, CALCIUM-BINDING, TISSUE SPECIFICITY.
    4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Amygdala, Cerebellum and Embryo.
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
      Tissue: Eye.
    7. "Novel variants of human SCaMC-3, an isoform of the ATP-Mg/P(i) mitochondrial carrier, generated by alternative splicing from 3'-flanking transposable elements."
      Del Arco A.
      Biochem. J. 389:647-655(2005) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 413-468 (ISOFORM 4), ALTERNATIVE SPLICING.

    Entry informationi

    Entry nameiSCMC3_HUMAN
    AccessioniPrimary (citable) accession number: Q9BV35
    Secondary accession number(s): B4DGB6
    , Q4LBC2, Q705K3, Q86Y43, Q8N2N4, Q96NQ4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: February 5, 2008
    Last sequence update: February 5, 2008
    Last modified: October 1, 2014
    This is version 113 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3