Q9BV35 (SCMC3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 99.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Calcium-binding mitochondrial carrier protein SCaMC-3 Alternative name(s): Mitochondrial ATP-Mg/Pi carrier protein 2 Mitochondrial Ca(2+)-dependent solute carrier protein 2 Small calcium-binding mitochondrial carrier protein 3 Solute carrier family 25 member 23 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 468 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria. Ref.2 |
| Subcellular location | Mitochondrion inner membrane; Multi-pass membrane protein Ref.1 Ref.2 Ref.3. |
| Tissue specificity | Present in various cell lines (at protein level). Expressed at low levels in most tissues examined, with highest expression in brain, skeletal muscle and pancreas. Ref.1 Ref.2 Ref.3 |
| Sequence similarities | Belongs to the mitochondrial carrier (TC 2.A.29) family. [View classification] Contains 3 EF-hand domains. Contains 3 Solcar repeats. |
| Biophysicochemical properties | Kinetic parameters: KM=1.3 mM for AMP Ref.2 KM=0.54 mM for ADP KM=0.31 mM for ATP KM=0.22 mM for ATP-Mg KM=1.4 mM for Pi Vmax=68 µmol/min/g enzyme with AMP as substrate Vmax=73 µmol/min/g enzyme with ADP as substrate Vmax=65 µmol/min/g enzyme with ATP as substrate Vmax=79 µmol/min/g enzyme with ATP-Mg as substrate Vmax=70 µmol/min/g enzyme with Pi as substrate |
| Sequence caution | The sequence BAB70825.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened. The sequence BAC11071.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Transport |
| Cellular component | Membrane Mitochondrion Mitochondrion inner membrane |
| Coding sequence diversity | Alternative splicing |
| Domain | Repeat Transmembrane Transmembrane helix |
| Ligand | Calcium Metal-binding |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | transmembrane transport Inferred from electronic annotation. Source: InterPro |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW mitochondrial inner membraneInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | calcium ion binding Inferred from electronic annotation. Source: InterPro |
| Complete GO annotation... | |
Alternative products
| This entry describes 4 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BV35-1) Also known as: SCaMC-3a; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BV35-2) Also known as: SCaMC-3b; The sequence of this isoform differs from the canonical sequence as follows: 408-468: ASIEGGPQLS...MKQALGVTSR → DVSVYKTDTVPTLIELTGRRGRKMLNKSFWN | ||||||
| Isoform 3 (identifier: Q9BV35-3) Also known as: SCaMC-3c; The sequence of this isoform differs from the canonical sequence as follows: 161-161: T → TLSSAGFSAWIKDSTAEQNRSKTTVLARRSGSHLKSQHFGRPKWADHE 408-468: ASIEGGPQLS...MKQALGVTSR → GWSTVARFQITATSAFQVQAILLPQPPE | ||||||
| Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay. | ||||||
| Isoform 4 (identifier: Q9BV35-4) Also known as: SCaMC-3d; The sequence of this isoform differs from the canonical sequence as follows: 408-468: ASIEGGPQLS...MKQALGVTSR → GWSTVARFQITATSAFQVQAILLPQPPE | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 468 | 468 | Calcium-binding mitochondrial carrier protein SCaMC-3 | PRO_0000317609 | |||||
Regions | |||||||||
| Topological domain | 1 – 188 | 188 | Mitochondrial intermembrane Potential | ||||||
| Transmembrane | 189 – 206 | 18 | Helical; Name=1; Potential | ||||||
| Topological domain | 207 – 243 | 37 | Mitochondrial matrix Potential | ||||||
| Transmembrane | 244 – 263 | 20 | Helical; Name=2; Potential | ||||||
| Topological domain | 264 – 286 | 23 | Mitochondrial intermembrane Potential | ||||||
| Transmembrane | 287 – 300 | 14 | Helical; Name=3; Potential | ||||||
| Topological domain | 301 – 336 | 36 | Mitochondrial matrix Potential | ||||||
| Transmembrane | 337 – 356 | 20 | Helical; Name=4; Potential | ||||||
| Topological domain | 357 – 379 | 23 | Mitochondrial intermembrane Potential | ||||||
| Transmembrane | 380 – 397 | 18 | Helical; Name=5; Potential | ||||||
| Topological domain | 398 – 436 | 39 | Mitochondrial matrix Potential | ||||||
| Transmembrane | 437 – 456 | 20 | Helical; Name=6; Potential | ||||||
| Topological domain | 457 – 468 | 12 | Mitochondrial intermembrane Potential | ||||||
| Domain | 9 – 44 | 36 | EF-hand 1 | ||||||
| Domain | 77 – 112 | 36 | EF-hand 2 | ||||||
| Domain | 113 – 148 | 36 | EF-hand 3 | ||||||
| Repeat | 183 – 269 | 87 | Solcar 1 | ||||||
| Repeat | 277 – 362 | 86 | Solcar 2 | ||||||
| Repeat | 374 – 462 | 89 | Solcar 3 | ||||||
| Calcium binding | 22 – 33 | 12 | 1 Potential | ||||||
| Calcium binding | 90 – 101 | 12 | 2 Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 161 | 1 | T → TLSSAGFSAWIKDSTAEQNR SKTTVLARRSGSHLKSQHFG RPKWADHE in isoform 3. | VSP_031074 | |||||
| Alternative sequence | 408 – 468 | 61 | ASIEG…GVTSR → DVSVYKTDTVPTLIELTGRR GRKMLNKSFWN in isoform 2. | VSP_031075 | |||||
| Alternative sequence | 408 – 468 | 61 | ASIEG…GVTSR → GWSTVARFQITATSAFQVQA ILLPQPPE in isoform 3 and isoform 4. | VSP_031076 | |||||
Sequences
| ||||||||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Identification of a novel human subfamily of mitochondrial carriers with calcium-binding domains." del Arco A., Satrustegui J. J. Biol. Chem. 279:24701-24713(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY. |
| [2] | "Identification of the mitochondrial ATP-Mg/Pi transporter. Bacterial expression, reconstitution, functional characterization, and tissue distribution." Fiermonte G., De Leonardis F., Todisco S., Palmieri L., Lasorsa F.M., Palmieri F. J. Biol. Chem. 279:30722-30730(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, TISSUE SPECIFICITY. Tissue: Brain. |
| [3] | "Cellular expression and alternative splicing of SLC25A23, a member of the mitochondrial Ca2+-dependent solute carrier gene family." Bassi M.T., Manzoni M., Bresciani R., Pizzo M.T., Della Monica A., Barlati S., Monti E., Borsani G. Gene 345:173-182(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, CALCIUM-BINDING, TISSUE SPECIFICITY. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Amygdala, Cerebellum and Embryo. |
| [5] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [6] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3). Tissue: Eye. |
| [7] | "Novel variants of human SCaMC-3, an isoform of the ATP-Mg/P(i) mitochondrial carrier, generated by alternative splicing from 3'-flanking transposable elements." Del Arco A. Biochem. J. 389:647-655(2005) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 413-468 (ISOFORM 4), ALTERNATIVE SPLICING. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AJ619988 mRNA. Translation: CAF04494.1. AJ619962 mRNA. Translation: CAF04059.1. AJ512835 mRNA. Translation: CAD55563.1. AY750170 mRNA. Translation: AAU95077.1. AK054901 mRNA. Translation: BAB70825.1. Different initiation. AK074579 mRNA. Translation: BAC11071.1. Different initiation. AK294514 mRNA. Translation: BAG57727.1. CH471139 Genomic DNA. Translation: EAW69087.1. CH471139 Genomic DNA. Translation: EAW69089.1. BC001656 mRNA. Translation: AAH01656.1. AJ879082 mRNA. Translation: CAI51684.1. AJ879083 mRNA. Translation: CAI51685.1. |
| IPI | IPI00419997. IPI00479721. IPI00884969. IPI00885199. |
| RefSeq | NP_077008.2. NM_024103.2. |
| UniGene | Hs.356231. Hs.732434. |
3D structure databases | |
| HSSP | HSSP built from PDB template 1K9U based on UniProtKB O82040. |
| ProteinModelPortal | Q9BV35. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9BV35. 1 interaction. |
| STRING | 9606.ENSP00000301454. |
PTM databases | |
| PhosphoSite | Q9BV35. |
Polymorphism databases | |
| DMDM | 167016556. |
Proteomic databases | |
| PaxDb | Q9BV35. |
| PRIDE | Q9BV35. |
Protocols and materials databases | |
| DNASU | 79085. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000264088; ENSP00000264088; ENSG00000125648. ENST00000301454; ENSP00000301454; ENSG00000125648. ENST00000334510; ENSP00000334537; ENSG00000125648. |
| GeneID | 79085. |
| KEGG | hsa:79085. |
| UCSC | uc002mex.1. human. |
Organism-specific databases | |
| CTD | 79085. |
| GeneCards | GC19M006436. |
| H-InvDB | HIX0014698. |
| HGNC | HGNC:19375. SLC25A23. |
| HPA | HPA050883. |
| MIM | 608746. gene. |
| neXtProt | NX_Q9BV35. |
| PharmGKB | PA134932456. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG316894. |
| HOVERGEN | HBG108464. |
| KO | K14684. |
| OMA | QIKWAIR. |
Gene expression databases | |
| ArrayExpress | Q9BV35. |
| Bgee | Q9BV35. |
| CleanEx | HS_APC2. HS_SLC25A23. |
| Genevestigator | Q9BV35. |
Family and domain databases | |
| Gene3D | 1.10.238.10. 1 hit. 1.50.40.10. 1 hit. |
| InterPro | IPR011992. EF-hand-like_dom. IPR018247. EF_Hand_1_Ca_BS. IPR002048. EF_hand_dom. IPR002067. Mit_carrier. IPR018108. Mitochondrial_sb/sol_carrier. IPR023395. Mt_carrier_dom. [Graphical view] |
| Pfam | PF13499. EF_hand_5. 2 hits. PF00153. Mito_carr. 3 hits. [Graphical view] |
| PRINTS | PR00926. MITOCARRIER. |
| SMART | SM00054. EFh. 3 hits. [Graphical view] |
| SUPFAM | SSF103506. Mitoch_carrier. 1 hit. |
| PROSITE | PS00018. EF_HAND_1. 2 hits. PS50222. EF_HAND_2. 3 hits. PS50920. SOLCAR. 3 hits. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 79085. |
| NextBio | 67901. |
| SOURCE | Search... |
Entry information
| Entry name | SCMC3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BV35 Secondary accession number(s): B4DGB6 Q96NQ4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
