SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BV35

- SCMC3_HUMAN

UniProt

Q9BV35 - SCMC3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Calcium-binding mitochondrial carrier protein SCaMC-3

Gene
SLC25A23, APC2, MCSC2, SCAMC3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5 - Experimental evidence at protein leveli

Functioni

Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria.1 Publication

Kineticsi

  1. KM=1.3 mM for AMP1 Publication
  2. KM=0.54 mM for ADP
  3. KM=0.31 mM for ATP
  4. KM=0.22 mM for ATP-Mg
  5. KM=1.4 mM for Pi

Vmax=68 µmol/min/g enzyme with AMP as substrate

Vmax=73 µmol/min/g enzyme with ADP as substrate

Vmax=65 µmol/min/g enzyme with ATP as substrate

Vmax=79 µmol/min/g enzyme with ATP-Mg as substrate

Vmax=70 µmol/min/g enzyme with Pi as substrate

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Calcium bindingi22 – 33121 Reviewed predictionAdd
BLAST
Calcium bindingi90 – 101122 Reviewed predictionAdd
BLAST

GO - Molecular functioni

  1. calcium ion binding Source: InterPro

GO - Biological processi

  1. transmembrane transport Source: InterPro
Complete GO annotation...

Keywords - Biological processi

Transport

Keywords - Ligandi

Calcium, Metal-binding

Protein family/group databases

TCDBi2.A.29.23.5. the mitochondrial carrier (mc) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-binding mitochondrial carrier protein SCaMC-3
Alternative name(s):
Mitochondrial ATP-Mg/Pi carrier protein 2
Mitochondrial Ca(2+)-dependent solute carrier protein 2
Small calcium-binding mitochondrial carrier protein 3
Solute carrier family 25 member 23
Gene namesi
Synonyms:APC2, MCSC2, SCAMC3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:19375. SLC25A23.

Subcellular locationi

Mitochondrion inner membrane; Multi-pass membrane protein 3 Publications

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 188188Mitochondrial intermembrane Reviewed predictionAdd
BLAST
Transmembranei189 – 20618Helical; Name=1; Reviewed predictionAdd
BLAST
Topological domaini207 – 24337Mitochondrial matrix Reviewed predictionAdd
BLAST
Transmembranei244 – 26320Helical; Name=2; Reviewed predictionAdd
BLAST
Topological domaini264 – 28623Mitochondrial intermembrane Reviewed predictionAdd
BLAST
Transmembranei287 – 30014Helical; Name=3; Reviewed predictionAdd
BLAST
Topological domaini301 – 33636Mitochondrial matrix Reviewed predictionAdd
BLAST
Transmembranei337 – 35620Helical; Name=4; Reviewed predictionAdd
BLAST
Topological domaini357 – 37923Mitochondrial intermembrane Reviewed predictionAdd
BLAST
Transmembranei380 – 39718Helical; Name=5; Reviewed predictionAdd
BLAST
Topological domaini398 – 43639Mitochondrial matrix Reviewed predictionAdd
BLAST
Transmembranei437 – 45620Helical; Name=6; Reviewed predictionAdd
BLAST
Topological domaini457 – 46812Mitochondrial intermembrane Reviewed predictionAdd
BLAST

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. mitochondrial inner membrane Source: UniProtKB-SubCell
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134932456.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 468468Calcium-binding mitochondrial carrier protein SCaMC-3PRO_0000317609Add
BLAST

Proteomic databases

MaxQBiQ9BV35.
PaxDbiQ9BV35.
PRIDEiQ9BV35.

PTM databases

PhosphoSiteiQ9BV35.

Expressioni

Tissue specificityi

Present in various cell lines (at protein level). Expressed at low levels in most tissues examined, with highest expression in brain, skeletal muscle and pancreas.3 Publications

Gene expression databases

ArrayExpressiQ9BV35.
BgeeiQ9BV35.
CleanExiHS_APC2.
HS_SLC25A23.
GenevestigatoriQ9BV35.

Organism-specific databases

HPAiHPA050883.

Interactioni

Protein-protein interaction databases

BioGridi122533. 4 interactions.
IntActiQ9BV35. 1 interaction.
STRINGi9606.ENSP00000301454.

Structurei

3D structure databases

ProteinModelPortaliQ9BV35.
SMRiQ9BV35. Positions 13-444.

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Domaini9 – 4436EF-hand 1Add
BLAST
Domaini77 – 11236EF-hand 2Add
BLAST
Domaini113 – 14836EF-hand 3Add
BLAST
Repeati183 – 26987Solcar 1Add
BLAST
Repeati277 – 36286Solcar 2Add
BLAST
Repeati374 – 46289Solcar 3Add
BLAST

Sequence similaritiesi

Contains 3 EF-hand domains.
Contains 3 Solcar repeats.

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG316894.
HOVERGENiHBG108464.
KOiK14684.
OMAiGISICND.
PhylomeDBiQ9BV35.
TreeFamiTF313492.

Family and domain databases

Gene3Di1.10.238.10. 1 hit.
1.50.40.10. 1 hit.
InterProiIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR002067. Mit_carrier.
IPR018108. Mitochondrial_sb/sol_carrier.
IPR023395. Mt_carrier_dom.
[Graphical view]
PfamiPF13405. EF-hand_6. 1 hit.
PF13499. EF-hand_7. 1 hit.
PF00153. Mito_carr. 3 hits.
[Graphical view]
PRINTSiPR00926. MITOCARRIER.
SMARTiSM00054. EFh. 3 hits.
[Graphical view]
SUPFAMiSSF103506. SSF103506. 1 hit.
PROSITEiPS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 3 hits.
PS50920. SOLCAR. 3 hits.
[Graphical view]

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BV35-1) [UniParc]FASTAAdd to Basket

Also known as: SCaMC-3a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MRGSPGDAER RQRWGRLFEE LDSNKDGRVD VHELRQGLAR LGGGNPDPGA    50
QQGISSEGDA DPDGGLDLEE FSRYLQEREQ RLLLMFHSLD RNQDGHIDVS 100
EIQQSFRALG ISISLEQAEK ILHSMDRDGT MTIDWQEWRD HFLLHSLENV 150
EDVLYFWKHS TVLDIGECLT VPDEFSKQEK LTGMWWKQLV AGAVAGAVSR 200
TGTAPLDRLK VFMQVHASKT NRLNILGGLR SMVLEGGIRS LWRGNGINVL 250
KIAPESAIKF MAYEQIKRAI LGQQETLHVQ ERFVAGSLAG ATAQTIIYPM 300
EVLKTRLTLR RTGQYKGLLD CARRILEREG PRAFYRGYLP NVLGIIPYAG 350
IDLAVYETLK NWWLQQYSHD SADPGILVLL ACGTISSTCG QIASYPLALV 400
RTRMQAQASI EGGPQLSMLG LLRHILSQEG MRGLYRGIAP NFMKVIPAVS 450
ISYVVYENMK QALGVTSR 468
Length:468
Mass (Da):52,378
Last modified:February 5, 2008 - v2
Checksum:iB2D66A4665C27174
GO
Isoform 2 (identifier: Q9BV35-2) [UniParc]FASTAAdd to Basket

Also known as: SCaMC-3b

The sequence of this isoform differs from the canonical sequence as follows:
     408-468: ASIEGGPQLS...MKQALGVTSR → DVSVYKTDTVPTLIELTGRRGRKMLNKSFWN

Show »
Length:438
Mass (Da):49,354
Checksum:i290DB81E953C5D3F
GO
Isoform 3 (identifier: Q9BV35-3) [UniParc]FASTAAdd to Basket

Also known as: SCaMC-3c

The sequence of this isoform differs from the canonical sequence as follows:
     161-161: T → TLSSAGFSAWIKDSTAEQNRSKTTVLARRSGSHLKSQHFGRPKWADHE
     408-468: ASIEGGPQLS...MKQALGVTSR → GWSTVARFQITATSAFQVQAILLPQPPE

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.

Show »
Length:482
Mass (Da):54,035
Checksum:i8917BEA2BC2FE42B
GO
Isoform 4 (identifier: Q9BV35-4) [UniParc]FASTAAdd to Basket

Also known as: SCaMC-3d

The sequence of this isoform differs from the canonical sequence as follows:
     408-468: ASIEGGPQLS...MKQALGVTSR → GWSTVARFQITATSAFQVQAILLPQPPE

Note: No experimental confirmation available.

Show »
Length:435
Mass (Da):48,786
Checksum:iDEE44DC4C31B7E9F
GO

Sequence cautioni

The sequence BAB70825.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.
The sequence BAC11071.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei161 – 1611T → TLSSAGFSAWIKDSTAEQNR SKTTVLARRSGSHLKSQHFG RPKWADHE in isoform 3. VSP_031074
Alternative sequencei408 – 46861ASIEG…GVTSR → DVSVYKTDTVPTLIELTGRR GRKMLNKSFWN in isoform 2. VSP_031075Add
BLAST
Alternative sequencei408 – 46861ASIEG…GVTSR → GWSTVARFQITATSAFQVQA ILLPQPPE in isoform 3 and isoform 4. VSP_031076Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ619988 mRNA. Translation: CAF04494.1.
AJ619962 mRNA. Translation: CAF04059.1.
AJ512835 mRNA. Translation: CAD55563.1.
AY750170 mRNA. Translation: AAU95077.1.
AK054901 mRNA. Translation: BAB70825.1. Different initiation.
AK074579 mRNA. Translation: BAC11071.1. Different initiation.
AK294514 mRNA. Translation: BAG57727.1.
CH471139 Genomic DNA. Translation: EAW69087.1.
CH471139 Genomic DNA. Translation: EAW69089.1.
BC001656 mRNA. Translation: AAH01656.1.
AJ879082 mRNA. Translation: CAI51684.1.
AJ879083 mRNA. Translation: CAI51685.1.
CCDSiCCDS32882.1. [Q9BV35-1]
RefSeqiNP_077008.2. NM_024103.2. [Q9BV35-1]
UniGeneiHs.356231.
Hs.732434.

Genome annotation databases

EnsembliENST00000264088; ENSP00000264088; ENSG00000125648. [Q9BV35-3]
ENST00000301454; ENSP00000301454; ENSG00000125648. [Q9BV35-1]
ENST00000334510; ENSP00000334537; ENSG00000125648. [Q9BV35-2]
GeneIDi79085.
KEGGihsa:79085.
UCSCiuc002mex.1. human. [Q9BV35-1]

Polymorphism databases

DMDMi167016556.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AJ619988 mRNA. Translation: CAF04494.1 .
AJ619962 mRNA. Translation: CAF04059.1 .
AJ512835 mRNA. Translation: CAD55563.1 .
AY750170 mRNA. Translation: AAU95077.1 .
AK054901 mRNA. Translation: BAB70825.1 . Different initiation.
AK074579 mRNA. Translation: BAC11071.1 . Different initiation.
AK294514 mRNA. Translation: BAG57727.1 .
CH471139 Genomic DNA. Translation: EAW69087.1 .
CH471139 Genomic DNA. Translation: EAW69089.1 .
BC001656 mRNA. Translation: AAH01656.1 .
AJ879082 mRNA. Translation: CAI51684.1 .
AJ879083 mRNA. Translation: CAI51685.1 .
CCDSi CCDS32882.1. [Q9BV35-1 ]
RefSeqi NP_077008.2. NM_024103.2. [Q9BV35-1 ]
UniGenei Hs.356231.
Hs.732434.

3D structure databases

ProteinModelPortali Q9BV35.
SMRi Q9BV35. Positions 13-444.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122533. 4 interactions.
IntActi Q9BV35. 1 interaction.
STRINGi 9606.ENSP00000301454.

Protein family/group databases

TCDBi 2.A.29.23.5. the mitochondrial carrier (mc) family.

PTM databases

PhosphoSitei Q9BV35.

Polymorphism databases

DMDMi 167016556.

Proteomic databases

MaxQBi Q9BV35.
PaxDbi Q9BV35.
PRIDEi Q9BV35.

Protocols and materials databases

DNASUi 79085.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000264088 ; ENSP00000264088 ; ENSG00000125648 . [Q9BV35-3 ]
ENST00000301454 ; ENSP00000301454 ; ENSG00000125648 . [Q9BV35-1 ]
ENST00000334510 ; ENSP00000334537 ; ENSG00000125648 . [Q9BV35-2 ]
GeneIDi 79085.
KEGGi hsa:79085.
UCSCi uc002mex.1. human. [Q9BV35-1 ]

Organism-specific databases

CTDi 79085.
GeneCardsi GC19M006436.
H-InvDB HIX0014698.
HGNCi HGNC:19375. SLC25A23.
HPAi HPA050883.
MIMi 608746. gene.
neXtProti NX_Q9BV35.
PharmGKBi PA134932456.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG316894.
HOVERGENi HBG108464.
KOi K14684.
OMAi GISICND.
PhylomeDBi Q9BV35.
TreeFami TF313492.

Miscellaneous databases

GenomeRNAii 79085.
NextBioi 67901.
PROi Q9BV35.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9BV35.
Bgeei Q9BV35.
CleanExi HS_APC2.
HS_SLC25A23.
Genevestigatori Q9BV35.

Family and domain databases

Gene3Di 1.10.238.10. 1 hit.
1.50.40.10. 1 hit.
InterProi IPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR002067. Mit_carrier.
IPR018108. Mitochondrial_sb/sol_carrier.
IPR023395. Mt_carrier_dom.
[Graphical view ]
Pfami PF13405. EF-hand_6. 1 hit.
PF13499. EF-hand_7. 1 hit.
PF00153. Mito_carr. 3 hits.
[Graphical view ]
PRINTSi PR00926. MITOCARRIER.
SMARTi SM00054. EFh. 3 hits.
[Graphical view ]
SUPFAMi SSF103506. SSF103506. 1 hit.
PROSITEi PS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 3 hits.
PS50920. SOLCAR. 3 hits.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Identification of a novel human subfamily of mitochondrial carriers with calcium-binding domains."
    del Arco A., Satrustegui J.
    J. Biol. Chem. 279:24701-24713(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
  2. "Identification of the mitochondrial ATP-Mg/Pi transporter. Bacterial expression, reconstitution, functional characterization, and tissue distribution."
    Fiermonte G., De Leonardis F., Todisco S., Palmieri L., Lasorsa F.M., Palmieri F.
    J. Biol. Chem. 279:30722-30730(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
    Tissue: Brain.
  3. "Cellular expression and alternative splicing of SLC25A23, a member of the mitochondrial Ca2+-dependent solute carrier gene family."
    Bassi M.T., Manzoni M., Bresciani R., Pizzo M.T., Della Monica A., Barlati S., Monti E., Borsani G.
    Gene 345:173-182(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, CALCIUM-BINDING, TISSUE SPECIFICITY.
  4. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Amygdala, Cerebellum and Embryo.
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
    Tissue: Eye.
  7. "Novel variants of human SCaMC-3, an isoform of the ATP-Mg/P(i) mitochondrial carrier, generated by alternative splicing from 3'-flanking transposable elements."
    Del Arco A.
    Biochem. J. 389:647-655(2005) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 413-468 (ISOFORM 4), ALTERNATIVE SPLICING.

Entry informationi

Entry nameiSCMC3_HUMAN
AccessioniPrimary (citable) accession number: Q9BV35
Secondary accession number(s): B4DGB6
, Q4LBC2, Q705K3, Q86Y43, Q8N2N4, Q96NQ4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: February 5, 2008
Last modified: July 9, 2014
This is version 112 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi