Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Calcium-binding mitochondrial carrier protein SCaMC-3

Gene

SLC25A23

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane (PubMed:15123600). May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria (PubMed:15123600). Acts as a regulator of mitochondrial calcium uptake via interaction with MCU and MICU1 (PubMed:24430870).2 Publications

Kineticsi

  1. KM=1.3 mM for AMP1 Publication
  2. KM=0.54 mM for ADP1 Publication
  3. KM=0.31 mM for ATP1 Publication
  4. KM=0.22 mM for ATP-Mg1 Publication
  5. KM=1.4 mM for Pi1 Publication
  1. Vmax=68 µmol/min/g enzyme with AMP as substrate1 Publication
  2. Vmax=73 µmol/min/g enzyme with ADP as substrate1 Publication
  3. Vmax=65 µmol/min/g enzyme with ATP as substrate1 Publication
  4. Vmax=79 µmol/min/g enzyme with ATP-Mg as substrate1 Publication
  5. Vmax=70 µmol/min/g enzyme with Pi as substrate1 Publication

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Calcium bindingi22 – 331PROSITE-ProRule annotationAdd BLAST12
Calcium bindingi90 – 1012PROSITE-ProRule annotationAdd BLAST12

GO - Molecular functioni

GO - Biological processi

Keywordsi

Biological processTransport
LigandCalcium, Metal-binding

Protein family/group databases

TCDBi2.A.29.23.5 the mitochondrial carrier (mc) family

Names & Taxonomyi

Protein namesi
Recommended name:
Calcium-binding mitochondrial carrier protein SCaMC-3
Alternative name(s):
Mitochondrial ATP-Mg/Pi carrier protein 2
Mitochondrial Ca(2+)-dependent solute carrier protein 2
Small calcium-binding mitochondrial carrier protein 3
Solute carrier family 25 member 23
Gene namesi
Name:SLC25A23
Synonyms:APC2, MCSC2, SCAMC3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

EuPathDBiHostDB:ENSG00000125648.14
HGNCiHGNC:19375 SLC25A23
MIMi608746 gene
neXtProtiNX_Q9BV35

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 188Mitochondrial intermembraneSequence analysisAdd BLAST188
Transmembranei189 – 206Helical; Name=1Sequence analysisAdd BLAST18
Topological domaini207 – 243Mitochondrial matrixSequence analysisAdd BLAST37
Transmembranei244 – 263Helical; Name=2Sequence analysisAdd BLAST20
Topological domaini264 – 286Mitochondrial intermembraneSequence analysisAdd BLAST23
Transmembranei287 – 300Helical; Name=3Sequence analysisAdd BLAST14
Topological domaini301 – 336Mitochondrial matrixSequence analysisAdd BLAST36
Transmembranei337 – 356Helical; Name=4Sequence analysisAdd BLAST20
Topological domaini357 – 379Mitochondrial intermembraneSequence analysisAdd BLAST23
Transmembranei380 – 397Helical; Name=5Sequence analysisAdd BLAST18
Topological domaini398 – 436Mitochondrial matrixSequence analysisAdd BLAST39
Transmembranei437 – 456Helical; Name=6Sequence analysisAdd BLAST20
Topological domaini457 – 468Mitochondrial intermembraneSequence analysisAdd BLAST12

Keywords - Cellular componenti

Membrane, Mitochondrion, Mitochondrion inner membrane

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi22D → A: Abolishes the ability to regulate mitochondrial calcium uptake; when associated with K-33; A-90 and K-101. 1 Publication1
Mutagenesisi33E → K: Abolishes the ability to regulate mitochondrial calcium uptake; when associated with A-22; A-90 and K-101. 1 Publication1
Mutagenesisi90D → A: Abolishes the ability to regulate mitochondrial calcium uptake; when associated with A-22; K-33 and K-101. 1 Publication1
Mutagenesisi101E → K: Abolishes the ability to regulate mitochondrial calcium uptake; when associated with A-22; K-33 and A-90. 1 Publication1

Organism-specific databases

OpenTargetsiENSG00000125648
PharmGKBiPA134932456

Polymorphism and mutation databases

BioMutaiSLC25A23
DMDMi167016556

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003176091 – 468Calcium-binding mitochondrial carrier protein SCaMC-3Add BLAST468

Proteomic databases

EPDiQ9BV35
MaxQBiQ9BV35
PaxDbiQ9BV35
PeptideAtlasiQ9BV35
PRIDEiQ9BV35
ProteomicsDBi79158
79159 [Q9BV35-2]
79160 [Q9BV35-3]
79161 [Q9BV35-4]

PTM databases

iPTMnetiQ9BV35
PhosphoSitePlusiQ9BV35

Expressioni

Tissue specificityi

Present in various cell lines (at protein level). Expressed at low levels in most tissues examined, with highest expression in brain, skeletal muscle and pancreas.3 Publications

Gene expression databases

BgeeiENSG00000125648
CleanExiHS_APC2
HS_SLC25A23
ExpressionAtlasiQ9BV35 baseline and differential
GenevisibleiQ9BV35 HS

Organism-specific databases

HPAiHPA009675
HPA050883

Interactioni

Subunit structurei

Interacts with MCU (PubMed:24430870). Interacts with MICU1 (PubMed:24430870).1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
APPBP2Q926243EBI-2933255,EBI-743771

Protein-protein interaction databases

BioGridi122533, 21 interactors
IntActiQ9BV35, 2 interactors

Structurei

3D structure databases

ProteinModelPortaliQ9BV35
SMRiQ9BV35
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini9 – 44EF-hand 1PROSITE-ProRule annotationAdd BLAST36
Domaini77 – 112EF-hand 2PROSITE-ProRule annotationAdd BLAST36
Domaini113 – 148EF-hand 3PROSITE-ProRule annotationAdd BLAST36
Repeati183 – 269Solcar 1Add BLAST87
Repeati277 – 362Solcar 2Add BLAST86
Repeati374 – 462Solcar 3Add BLAST89

Sequence similaritiesi

Keywords - Domaini

Repeat, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG0036 Eukaryota
ENOG410XQ4P LUCA
GeneTreeiENSGT00880000137904
HOVERGENiHBG108464
InParanoidiQ9BV35
KOiK14684
OrthoDBiEOG091G0C8S
PhylomeDBiQ9BV35
TreeFamiTF313492

Family and domain databases

CDDicd00051 EFh, 1 hit
Gene3Di1.50.40.10, 1 hit
InterProiView protein in InterPro
IPR011992 EF-hand-dom_pair
IPR018247 EF_Hand_1_Ca_BS
IPR002048 EF_hand_dom
IPR002067 Mit_carrier
IPR018108 Mitochondrial_sb/sol_carrier
IPR023395 Mt_carrier_dom_sf
PfamiView protein in Pfam
PF13202 EF-hand_5, 1 hit
PF13499 EF-hand_7, 1 hit
PF00153 Mito_carr, 3 hits
PRINTSiPR00926 MITOCARRIER
SMARTiView protein in SMART
SM00054 EFh, 3 hits
SUPFAMiSSF103506 SSF103506, 1 hit
SSF47473 SSF47473, 1 hit
PROSITEiView protein in PROSITE
PS00018 EF_HAND_1, 2 hits
PS50222 EF_HAND_2, 3 hits
PS50920 SOLCAR, 3 hits

Sequences (4)i

Sequence statusi: Complete.

This entry describes 4 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BV35-1) [UniParc]FASTAAdd to basket
Also known as: SCaMC-3a

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MRGSPGDAER RQRWGRLFEE LDSNKDGRVD VHELRQGLAR LGGGNPDPGA
60 70 80 90 100
QQGISSEGDA DPDGGLDLEE FSRYLQEREQ RLLLMFHSLD RNQDGHIDVS
110 120 130 140 150
EIQQSFRALG ISISLEQAEK ILHSMDRDGT MTIDWQEWRD HFLLHSLENV
160 170 180 190 200
EDVLYFWKHS TVLDIGECLT VPDEFSKQEK LTGMWWKQLV AGAVAGAVSR
210 220 230 240 250
TGTAPLDRLK VFMQVHASKT NRLNILGGLR SMVLEGGIRS LWRGNGINVL
260 270 280 290 300
KIAPESAIKF MAYEQIKRAI LGQQETLHVQ ERFVAGSLAG ATAQTIIYPM
310 320 330 340 350
EVLKTRLTLR RTGQYKGLLD CARRILEREG PRAFYRGYLP NVLGIIPYAG
360 370 380 390 400
IDLAVYETLK NWWLQQYSHD SADPGILVLL ACGTISSTCG QIASYPLALV
410 420 430 440 450
RTRMQAQASI EGGPQLSMLG LLRHILSQEG MRGLYRGIAP NFMKVIPAVS
460
ISYVVYENMK QALGVTSR
Length:468
Mass (Da):52,378
Last modified:February 5, 2008 - v2
Checksum:iB2D66A4665C27174
GO
Isoform 2 (identifier: Q9BV35-2) [UniParc]FASTAAdd to basket
Also known as: SCaMC-3b

The sequence of this isoform differs from the canonical sequence as follows:
     408-468: ASIEGGPQLS...MKQALGVTSR → DVSVYKTDTVPTLIELTGRRGRKMLNKSFWN

Show »
Length:438
Mass (Da):49,354
Checksum:i290DB81E953C5D3F
GO
Isoform 3 (identifier: Q9BV35-3) [UniParc]FASTAAdd to basket
Also known as: SCaMC-3c

The sequence of this isoform differs from the canonical sequence as follows:
     161-161: T → TLSSAGFSAWIKDSTAEQNRSKTTVLARRSGSHLKSQHFGRPKWADHE
     408-468: ASIEGGPQLS...MKQALGVTSR → GWSTVARFQITATSAFQVQAILLPQPPE

Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Show »
Length:482
Mass (Da):54,035
Checksum:i8917BEA2BC2FE42B
GO
Isoform 4 (identifier: Q9BV35-4) [UniParc]FASTAAdd to basket
Also known as: SCaMC-3d

The sequence of this isoform differs from the canonical sequence as follows:
     408-468: ASIEGGPQLS...MKQALGVTSR → GWSTVARFQITATSAFQVQAILLPQPPE

Note: No experimental confirmation available.
Show »
Length:435
Mass (Da):48,786
Checksum:iDEE44DC4C31B7E9F
GO

Sequence cautioni

The sequence BAB70825 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAC11071 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_031074161T → TLSSAGFSAWIKDSTAEQNR SKTTVLARRSGSHLKSQHFG RPKWADHE in isoform 3. 1 Publication1
Alternative sequenceiVSP_031075408 – 468ASIEG…GVTSR → DVSVYKTDTVPTLIELTGRR GRKMLNKSFWN in isoform 2. 1 PublicationAdd BLAST61
Alternative sequenceiVSP_031076408 – 468ASIEG…GVTSR → GWSTVARFQITATSAFQVQA ILLPQPPE in isoform 3 and isoform 4. 2 PublicationsAdd BLAST61

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ619988 mRNA Translation: CAF04494.1
AJ619962 mRNA Translation: CAF04059.1
AJ512835 mRNA Translation: CAD55563.1
AY750170 mRNA Translation: AAU95077.1
AK054901 mRNA Translation: BAB70825.1 Different initiation.
AK074579 mRNA Translation: BAC11071.1 Different initiation.
AK294514 mRNA Translation: BAG57727.1
CH471139 Genomic DNA Translation: EAW69087.1
CH471139 Genomic DNA Translation: EAW69089.1
BC001656 mRNA Translation: AAH01656.1
AJ879082 mRNA Translation: CAI51684.1
AJ879083 mRNA Translation: CAI51685.1
CCDSiCCDS32882.1 [Q9BV35-1]
RefSeqiNP_077008.2, NM_024103.2 [Q9BV35-1]
UniGeneiHs.356231
Hs.732434

Genome annotation databases

EnsembliENST00000264088; ENSP00000264088; ENSG00000125648 [Q9BV35-3]
ENST00000301454; ENSP00000301454; ENSG00000125648 [Q9BV35-1]
ENST00000334510; ENSP00000334537; ENSG00000125648 [Q9BV35-2]
GeneIDi79085
KEGGihsa:79085
UCSCiuc002mex.2 human [Q9BV35-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiSCMC3_HUMAN
AccessioniPrimary (citable) accession number: Q9BV35
Secondary accession number(s): B4DGB6
, Q4LBC2, Q705K3, Q86Y43, Q8N2N4, Q96NQ4
Entry historyiIntegrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: February 5, 2008
Last modified: June 20, 2018
This is version 144 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health