Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BV35 (SCMC3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 112. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Calcium-binding mitochondrial carrier protein SCaMC-3
Alternative name(s):
Mitochondrial ATP-Mg/Pi carrier protein 2
Mitochondrial Ca(2+)-dependent solute carrier protein 2
Small calcium-binding mitochondrial carrier protein 3
Solute carrier family 25 member 23
Gene names
Name:SLC25A23
Synonyms:APC2, MCSC2, SCAMC3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length468 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Calcium-dependent mitochondrial solute carrier. Mitochondrial solute carriers shuttle metabolites, nucleotides, and cofactors through the mitochondrial inner membrane. May act as a ATP-Mg/Pi exchanger that mediates the transport of Mg-ATP in exchange for phosphate, catalyzing the net uptake or efflux of adenine nucleotides into or from the mitochondria. Ref.2

Subcellular location

Mitochondrion inner membrane; Multi-pass membrane protein Ref.1 Ref.2 Ref.3.

Tissue specificity

Present in various cell lines (at protein level). Expressed at low levels in most tissues examined, with highest expression in brain, skeletal muscle and pancreas. Ref.1 Ref.2 Ref.3

Sequence similarities

Belongs to the mitochondrial carrier (TC 2.A.29) family. [View classification]

Contains 3 EF-hand domains.

Contains 3 Solcar repeats.

Biophysicochemical properties

Kinetic parameters:

KM=1.3 mM for AMP Ref.2

KM=0.54 mM for ADP

KM=0.31 mM for ATP

KM=0.22 mM for ATP-Mg

KM=1.4 mM for Pi

Vmax=68 µmol/min/g enzyme with AMP as substrate

Vmax=73 µmol/min/g enzyme with ADP as substrate

Vmax=65 µmol/min/g enzyme with ATP as substrate

Vmax=79 µmol/min/g enzyme with ATP-Mg as substrate

Vmax=70 µmol/min/g enzyme with Pi as substrate

Sequence caution

The sequence BAB70825.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.

The sequence BAC11071.1 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.

Ontologies

Keywords
   Biological processTransport
   Cellular componentMembrane
Mitochondrion
Mitochondrion inner membrane
   Coding sequence diversityAlternative splicing
   DomainRepeat
Transmembrane
Transmembrane helix
   LigandCalcium
Metal-binding
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processtransmembrane transport

Inferred from electronic annotation. Source: InterPro

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

mitochondrial inner membrane

Inferred from electronic annotation. Source: UniProtKB-SubCell

   Molecular_functioncalcium ion binding

Inferred from electronic annotation. Source: InterPro

Complete GO annotation...

Alternative products

This entry describes 4 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BV35-1)

Also known as: SCaMC-3a;

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9BV35-2)

Also known as: SCaMC-3b;

The sequence of this isoform differs from the canonical sequence as follows:
     408-468: ASIEGGPQLS...MKQALGVTSR → DVSVYKTDTVPTLIELTGRRGRKMLNKSFWN
Isoform 3 (identifier: Q9BV35-3)

Also known as: SCaMC-3c;

The sequence of this isoform differs from the canonical sequence as follows:
     161-161: T → TLSSAGFSAWIKDSTAEQNRSKTTVLARRSGSHLKSQHFGRPKWADHE
     408-468: ASIEGGPQLS...MKQALGVTSR → GWSTVARFQITATSAFQVQAILLPQPPE
Note: May be produced at very low levels due to a premature stop codon in the mRNA, leading to nonsense-mediated mRNA decay.
Isoform 4 (identifier: Q9BV35-4)

Also known as: SCaMC-3d;

The sequence of this isoform differs from the canonical sequence as follows:
     408-468: ASIEGGPQLS...MKQALGVTSR → GWSTVARFQITATSAFQVQAILLPQPPE
Note: No experimental confirmation available.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 468468Calcium-binding mitochondrial carrier protein SCaMC-3
PRO_0000317609

Regions

Topological domain1 – 188188Mitochondrial intermembrane Potential
Transmembrane189 – 20618Helical; Name=1; Potential
Topological domain207 – 24337Mitochondrial matrix Potential
Transmembrane244 – 26320Helical; Name=2; Potential
Topological domain264 – 28623Mitochondrial intermembrane Potential
Transmembrane287 – 30014Helical; Name=3; Potential
Topological domain301 – 33636Mitochondrial matrix Potential
Transmembrane337 – 35620Helical; Name=4; Potential
Topological domain357 – 37923Mitochondrial intermembrane Potential
Transmembrane380 – 39718Helical; Name=5; Potential
Topological domain398 – 43639Mitochondrial matrix Potential
Transmembrane437 – 45620Helical; Name=6; Potential
Topological domain457 – 46812Mitochondrial intermembrane Potential
Domain9 – 4436EF-hand 1
Domain77 – 11236EF-hand 2
Domain113 – 14836EF-hand 3
Repeat183 – 26987Solcar 1
Repeat277 – 36286Solcar 2
Repeat374 – 46289Solcar 3
Calcium binding22 – 33121 Potential
Calcium binding90 – 101122 Potential

Natural variations

Alternative sequence1611T → TLSSAGFSAWIKDSTAEQNR SKTTVLARRSGSHLKSQHFG RPKWADHE in isoform 3.
VSP_031074
Alternative sequence408 – 46861ASIEG…GVTSR → DVSVYKTDTVPTLIELTGRR GRKMLNKSFWN in isoform 2.
VSP_031075
Alternative sequence408 – 46861ASIEG…GVTSR → GWSTVARFQITATSAFQVQA ILLPQPPE in isoform 3 and isoform 4.
VSP_031076

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 (SCaMC-3a) [UniParc].

Last modified February 5, 2008. Version 2.
Checksum: B2D66A4665C27174

FASTA46852,378
        10         20         30         40         50         60 
MRGSPGDAER RQRWGRLFEE LDSNKDGRVD VHELRQGLAR LGGGNPDPGA QQGISSEGDA 

        70         80         90        100        110        120 
DPDGGLDLEE FSRYLQEREQ RLLLMFHSLD RNQDGHIDVS EIQQSFRALG ISISLEQAEK 

       130        140        150        160        170        180 
ILHSMDRDGT MTIDWQEWRD HFLLHSLENV EDVLYFWKHS TVLDIGECLT VPDEFSKQEK 

       190        200        210        220        230        240 
LTGMWWKQLV AGAVAGAVSR TGTAPLDRLK VFMQVHASKT NRLNILGGLR SMVLEGGIRS 

       250        260        270        280        290        300 
LWRGNGINVL KIAPESAIKF MAYEQIKRAI LGQQETLHVQ ERFVAGSLAG ATAQTIIYPM 

       310        320        330        340        350        360 
EVLKTRLTLR RTGQYKGLLD CARRILEREG PRAFYRGYLP NVLGIIPYAG IDLAVYETLK 

       370        380        390        400        410        420 
NWWLQQYSHD SADPGILVLL ACGTISSTCG QIASYPLALV RTRMQAQASI EGGPQLSMLG 

       430        440        450        460 
LLRHILSQEG MRGLYRGIAP NFMKVIPAVS ISYVVYENMK QALGVTSR 

« Hide

Isoform 2 (SCaMC-3b) [UniParc].

Checksum: 290DB81E953C5D3F
Show »

FASTA43849,354
Isoform 3 (SCaMC-3c) [UniParc].

Checksum: 8917BEA2BC2FE42B
Show »

FASTA48254,035
Isoform 4 (SCaMC-3d) [UniParc].

Checksum: DEE44DC4C31B7E9F
Show »

FASTA43548,786

References

« Hide 'large scale' references
[1]"Identification of a novel human subfamily of mitochondrial carriers with calcium-binding domains."
del Arco A., Satrustegui J.
J. Biol. Chem. 279:24701-24713(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
[2]"Identification of the mitochondrial ATP-Mg/Pi transporter. Bacterial expression, reconstitution, functional characterization, and tissue distribution."
Fiermonte G., De Leonardis F., Todisco S., Palmieri L., Lasorsa F.M., Palmieri F.
J. Biol. Chem. 279:30722-30730(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, BIOPHYSICOCHEMICAL PROPERTIES, SUBCELLULAR LOCATION, TISSUE SPECIFICITY.
Tissue: Brain.
[3]"Cellular expression and alternative splicing of SLC25A23, a member of the mitochondrial Ca2+-dependent solute carrier gene family."
Bassi M.T., Manzoni M., Bresciani R., Pizzo M.T., Della Monica A., Barlati S., Monti E., Borsani G.
Gene 345:173-182(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORMS 1 AND 2), SUBCELLULAR LOCATION, CALCIUM-BINDING, TISSUE SPECIFICITY.
[4]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Amygdala, Cerebellum and Embryo.
[5]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[6]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3).
Tissue: Eye.
[7]"Novel variants of human SCaMC-3, an isoform of the ATP-Mg/P(i) mitochondrial carrier, generated by alternative splicing from 3'-flanking transposable elements."
Del Arco A.
Biochem. J. 389:647-655(2005) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [MRNA] OF 413-468 (ISOFORM 4), ALTERNATIVE SPLICING.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AJ619988 mRNA. Translation: CAF04494.1.
AJ619962 mRNA. Translation: CAF04059.1.
AJ512835 mRNA. Translation: CAD55563.1.
AY750170 mRNA. Translation: AAU95077.1.
AK054901 mRNA. Translation: BAB70825.1. Different initiation.
AK074579 mRNA. Translation: BAC11071.1. Different initiation.
AK294514 mRNA. Translation: BAG57727.1.
CH471139 Genomic DNA. Translation: EAW69087.1.
CH471139 Genomic DNA. Translation: EAW69089.1.
BC001656 mRNA. Translation: AAH01656.1.
AJ879082 mRNA. Translation: CAI51684.1.
AJ879083 mRNA. Translation: CAI51685.1.
CCDSCCDS32882.1. [Q9BV35-1]
RefSeqNP_077008.2. NM_024103.2. [Q9BV35-1]
UniGeneHs.356231.
Hs.732434.

3D structure databases

ProteinModelPortalQ9BV35.
SMRQ9BV35. Positions 13-444.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122533. 4 interactions.
IntActQ9BV35. 1 interaction.
STRING9606.ENSP00000301454.

Protein family/group databases

TCDB2.A.29.23.5. the mitochondrial carrier (mc) family.

PTM databases

PhosphoSiteQ9BV35.

Polymorphism databases

DMDM167016556.

Proteomic databases

MaxQBQ9BV35.
PaxDbQ9BV35.
PRIDEQ9BV35.

Protocols and materials databases

DNASU79085.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000264088; ENSP00000264088; ENSG00000125648. [Q9BV35-3]
ENST00000301454; ENSP00000301454; ENSG00000125648. [Q9BV35-1]
ENST00000334510; ENSP00000334537; ENSG00000125648. [Q9BV35-2]
GeneID79085.
KEGGhsa:79085.
UCSCuc002mex.1. human. [Q9BV35-1]

Organism-specific databases

CTD79085.
GeneCardsGC19M006436.
H-InvDBHIX0014698.
HGNCHGNC:19375. SLC25A23.
HPAHPA050883.
MIM608746. gene.
neXtProtNX_Q9BV35.
PharmGKBPA134932456.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG316894.
HOVERGENHBG108464.
KOK14684.
OMAGISICND.
PhylomeDBQ9BV35.
TreeFamTF313492.

Gene expression databases

ArrayExpressQ9BV35.
BgeeQ9BV35.
CleanExHS_APC2.
HS_SLC25A23.
GenevestigatorQ9BV35.

Family and domain databases

Gene3D1.10.238.10. 1 hit.
1.50.40.10. 1 hit.
InterProIPR011992. EF-hand-dom_pair.
IPR018247. EF_Hand_1_Ca_BS.
IPR002048. EF_hand_dom.
IPR002067. Mit_carrier.
IPR018108. Mitochondrial_sb/sol_carrier.
IPR023395. Mt_carrier_dom.
[Graphical view]
PfamPF13405. EF-hand_6. 1 hit.
PF13499. EF-hand_7. 1 hit.
PF00153. Mito_carr. 3 hits.
[Graphical view]
PRINTSPR00926. MITOCARRIER.
SMARTSM00054. EFh. 3 hits.
[Graphical view]
SUPFAMSSF103506. SSF103506. 1 hit.
PROSITEPS00018. EF_HAND_1. 2 hits.
PS50222. EF_HAND_2. 3 hits.
PS50920. SOLCAR. 3 hits.
[Graphical view]
ProtoNetSearch...

Other

GenomeRNAi79085.
NextBio67901.
PROQ9BV35.
SOURCESearch...

Entry information

Entry nameSCMC3_HUMAN
AccessionPrimary (citable) accession number: Q9BV35
Secondary accession number(s): B4DGB6 expand/collapse secondary AC list , Q4LBC2, Q705K3, Q86Y43, Q8N2N4, Q96NQ4
Entry history
Integrated into UniProtKB/Swiss-Prot: February 5, 2008
Last sequence update: February 5, 2008
Last modified: July 9, 2014
This is version 112 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM