Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Methyltransferase-like protein 22

Gene

METTL22

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Protein N-lysine methyltransferase. In vitro methylates KIN.1 Publication

GO - Molecular functioni

Complete GO annotation...

Keywords - Molecular functioni

Methyltransferase, Transferase

Keywords - Ligandi

S-adenosyl-L-methionine

Names & Taxonomyi

Protein namesi
Recommended name:
Methyltransferase-like protein 22 (EC:2.1.1.-)
Gene namesi
Name:METTL22
Synonyms:C16orf68
ORF Names:LP8272
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:28368. METTL22.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA144596479.

Polymorphism and mutation databases

BioMutaiMETTL22.
DMDMi147639349.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 404404Methyltransferase-like protein 22PRO_0000286591Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei132 – 1321PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9BUU2.
PaxDbiQ9BUU2.
PRIDEiQ9BUU2.

PTM databases

iPTMnetiQ9BUU2.
PhosphoSiteiQ9BUU2.

Expressioni

Gene expression databases

BgeeiQ9BUU2.
CleanExiHS_C16orf68.
ExpressionAtlasiQ9BUU2. baseline and differential.
GenevisibleiQ9BUU2. HS.

Organism-specific databases

HPAiHPA040803.
HPA059882.

Interactioni

Subunit structurei

Interacts with members of the heat shock protein 90 and 70 families; these proteins probably are methylation substrates.1 Publication

Protein-protein interaction databases

BioGridi122539. 19 interactions.
IntActiQ9BUU2. 1 interaction.
STRINGi9606.ENSP00000371345.

Structurei

3D structure databases

ProteinModelPortaliQ9BUU2.
SMRiQ9BUU2. Positions 172-314.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiENOG410ISKA. Eukaryota.
ENOG410Z8JH. LUCA.
GeneTreeiENSGT00510000048539.
HOGENOMiHOG000059652.
HOVERGENiHBG055603.
InParanoidiQ9BUU2.
OMAiHRHLMVR.
PhylomeDBiQ9BUU2.
TreeFamiTF324844.

Family and domain databases

Gene3Di3.40.50.150. 1 hit.
InterProiIPR019410. Methyltransf_16.
IPR029063. SAM-dependent_MTases.
[Graphical view]
PfamiPF10294. Methyltransf_16. 1 hit.
[Graphical view]
SUPFAMiSSF53335. SSF53335. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BUU2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQLAPAAAM DEVTFRSDTV LSDVHLYTPN HRHLMVRLNS VGQPVFLSQF
60 70 80 90 100
KLLWSQDSWT DSGAKGGSHR DVHTKEPPSA ETGSTGSPPG SGHGNEGFSL
110 120 130 140 150
QAGTDTTGQE VAEAQLDEDG DLDVVRRPRA ASDSNPAGPL RDKVHPMILA
160 170 180 190 200
QEEDDVLGEE AQGSPHDIIR IEHTMATPLE DVGKQVWRGA LLLADYILFR
210 220 230 240 250
QDLFRGCTAL ELGAGTGLAS IIAATMARTV YCTDVGADLL SMCQRNIALN
260 270 280 290 300
SHLAATGGGI VRVKELDWLK DDLCTDPKVP FSWSQEEISD LYDHTTILFA
310 320 330 340 350
AEVFYDDDLT DAVFKTLSRL AHRLKNACTA ILSVEKRLNF TLRHLDVTCE
360 370 380 390 400
AYDHFRSCLH ALEQLADGKL RFVVEPVEAS FPQLLVYERL QQLELWKIIA

EPVT
Length:404
Mass (Da):44,486
Last modified:May 15, 2007 - v2
Checksum:i049135469B80D6F9
GO
Isoform 2 (identifier: Q9BUU2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     172-205: EHTMATPLEDVGKQVWRGALLLADYILFRQDLFR → GVAGRPAPGRLHPVPTGPLPRMYSAGARGRHGAR
     206-404: Missing.

Show »
Length:205
Mass (Da):21,813
Checksum:i549514E9F88AA252
GO
Isoform 3 (identifier: Q9BUU2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-225: Missing.

Show »
Length:179
Mass (Da):20,389
Checksum:i286526061CCA0EEE
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti59 – 591W → S.
Corresponds to variant rs2270286 [ dbSNP | Ensembl ].
VAR_032134
Natural varianti219 – 2191A → T.
Corresponds to variant rs2302607 [ dbSNP | Ensembl ].
VAR_032135
Natural varianti366 – 3661A → T.1 Publication
Corresponds to variant rs1731000 [ dbSNP | Ensembl ].
VAR_059623
Natural varianti375 – 3751E → K.
Corresponds to variant rs55747257 [ dbSNP | Ensembl ].
VAR_061617

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 225225Missing in isoform 3. 1 PublicationVSP_025106Add
BLAST
Alternative sequencei172 – 20534EHTMA…QDLFR → GVAGRPAPGRLHPVPTGPLP RMYSAGARGRHGAR in isoform 2. 2 PublicationsVSP_025107Add
BLAST
Alternative sequencei206 – 404199Missing in isoform 2. 2 PublicationsVSP_025108Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022495 mRNA. Translation: BAB14058.1.
AK315383 mRNA. Translation: BAG37776.1.
AC007224 Genomic DNA. No translation available.
AC138420 Genomic DNA. No translation available.
AY203956 mRNA. Translation: AAP34479.1.
CH471112 Genomic DNA. Translation: EAW85210.1.
CH471112 Genomic DNA. Translation: EAW85211.1.
BC001908 mRNA. Translation: AAH01908.1.
CCDSiCCDS10533.2. [Q9BUU2-1]
RefSeqiNP_077014.3. NM_024109.3.
UniGeneiHs.306380.

Genome annotation databases

EnsembliENST00000163678; ENSP00000163678; ENSG00000067365. [Q9BUU2-2]
ENST00000381920; ENSP00000371345; ENSG00000067365. [Q9BUU2-1]
GeneIDi79091.
KEGGihsa:79091.
UCSCiuc002czb.4. human. [Q9BUU2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022495 mRNA. Translation: BAB14058.1.
AK315383 mRNA. Translation: BAG37776.1.
AC007224 Genomic DNA. No translation available.
AC138420 Genomic DNA. No translation available.
AY203956 mRNA. Translation: AAP34479.1.
CH471112 Genomic DNA. Translation: EAW85210.1.
CH471112 Genomic DNA. Translation: EAW85211.1.
BC001908 mRNA. Translation: AAH01908.1.
CCDSiCCDS10533.2. [Q9BUU2-1]
RefSeqiNP_077014.3. NM_024109.3.
UniGeneiHs.306380.

3D structure databases

ProteinModelPortaliQ9BUU2.
SMRiQ9BUU2. Positions 172-314.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122539. 19 interactions.
IntActiQ9BUU2. 1 interaction.
STRINGi9606.ENSP00000371345.

PTM databases

iPTMnetiQ9BUU2.
PhosphoSiteiQ9BUU2.

Polymorphism and mutation databases

BioMutaiMETTL22.
DMDMi147639349.

Proteomic databases

MaxQBiQ9BUU2.
PaxDbiQ9BUU2.
PRIDEiQ9BUU2.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000163678; ENSP00000163678; ENSG00000067365. [Q9BUU2-2]
ENST00000381920; ENSP00000371345; ENSG00000067365. [Q9BUU2-1]
GeneIDi79091.
KEGGihsa:79091.
UCSCiuc002czb.4. human. [Q9BUU2-1]

Organism-specific databases

CTDi79091.
GeneCardsiMETTL22.
H-InvDBHIX0012804.
HGNCiHGNC:28368. METTL22.
HPAiHPA040803.
HPA059882.
MIMi615261. gene.
neXtProtiNX_Q9BUU2.
PharmGKBiPA144596479.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410ISKA. Eukaryota.
ENOG410Z8JH. LUCA.
GeneTreeiENSGT00510000048539.
HOGENOMiHOG000059652.
HOVERGENiHBG055603.
InParanoidiQ9BUU2.
OMAiHRHLMVR.
PhylomeDBiQ9BUU2.
TreeFamiTF324844.

Miscellaneous databases

GenomeRNAii79091.
NextBioi67929.
PROiQ9BUU2.
SOURCEiSearch...

Gene expression databases

BgeeiQ9BUU2.
CleanExiHS_C16orf68.
ExpressionAtlasiQ9BUU2. baseline and differential.
GenevisibleiQ9BUU2. HS.

Family and domain databases

Gene3Di3.40.50.150. 1 hit.
InterProiIPR019410. Methyltransf_16.
IPR029063. SAM-dependent_MTases.
[Graphical view]
PfamiPF10294. Methyltransf_16. 1 hit.
[Graphical view]
SUPFAMiSSF53335. SSF53335. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Brain.
  2. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. "Large-scale cDNA transfection screening for genes related to cancer development and progression."
    Wan D., Gong Y., Qin W., Zhang P., Li J., Wei L., Zhou X., Li H., Qiu X., Zhong F., He L., Yu J., Yao G., Jiang H., Qian L., Yu Y., Shu H., Chen X.
    , Xu H., Guo M., Pan Z., Chen Y., Ge C., Yang S., Gu J.
    Proc. Natl. Acad. Sci. U.S.A. 101:15724-15729(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 3), VARIANT THR-366.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Lung.
  6. "A newly uncovered group of distantly related lysine methyltransferases preferentially interact with molecular chaperones to regulate their activity."
    Cloutier P., Lavallee-Adam M., Faubert D., Blanchette M., Coulombe B.
    PLoS Genet. 9:E1003210-E1003210(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, INTERACTION WITH HSP70 AND HSP90 FAMILY MEMBERS, SUBCELLULAR LOCATION.
  7. "An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome."
    Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.
    J. Proteomics 96:253-262(2014) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-132, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Liver.

Entry informationi

Entry nameiMET22_HUMAN
AccessioniPrimary (citable) accession number: Q9BUU2
Secondary accession number(s): B2RD29
, D3DUF2, Q6XYB4, Q9HA03
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: April 13, 2016
This is version 94 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.