Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Methyltransferase-like protein 22

Gene

METTL22

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Protein N-lysine methyltransferase. In vitro methylates KIN.1 Publication

GO - Molecular functioni

  • heat shock protein binding Source: UniProtKB
  • protein-lysine N-methyltransferase activity Source: Reactome
  • protein methyltransferase activity Source: UniProtKB

GO - Biological processi

  • protein methylation Source: UniProtKB

Keywordsi

Molecular functionMethyltransferase, Transferase
LigandS-adenosyl-L-methionine

Enzyme and pathway databases

ReactomeiR-HSA-8876725. Protein methylation.

Names & Taxonomyi

Protein namesi
Recommended name:
Methyltransferase-like protein 22 (EC:2.1.1.-)
Gene namesi
Name:METTL22
Synonyms:C16orf68
ORF Names:LP8272
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000067365.14.
HGNCiHGNC:28368. METTL22.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000067365.
PharmGKBiPA144596479.

Polymorphism and mutation databases

BioMutaiMETTL22.
DMDMi147639349.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002865911 – 404Methyltransferase-like protein 22Add BLAST404

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei132PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9BUU2.
MaxQBiQ9BUU2.
PaxDbiQ9BUU2.
PeptideAtlasiQ9BUU2.
PRIDEiQ9BUU2.

PTM databases

iPTMnetiQ9BUU2.
PhosphoSitePlusiQ9BUU2.

Expressioni

Gene expression databases

BgeeiENSG00000067365.
CleanExiHS_C16orf68.
ExpressionAtlasiQ9BUU2. baseline and differential.
GenevisibleiQ9BUU2. HS.

Organism-specific databases

HPAiHPA040803.
HPA059882.
HPA074173.

Interactioni

Subunit structurei

Interacts with members of the heat shock protein 90 and 70 families; these proteins probably are methylation substrates.1 Publication

GO - Molecular functioni

  • heat shock protein binding Source: UniProtKB

Protein-protein interaction databases

BioGridi122539. 19 interactors.
IntActiQ9BUU2. 1 interactor.
STRINGi9606.ENSP00000371345.

Structurei

3D structure databases

ProteinModelPortaliQ9BUU2.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiENOG410ISKA. Eukaryota.
ENOG410Z8JH. LUCA.
GeneTreeiENSGT00510000048539.
HOGENOMiHOG000059652.
HOVERGENiHBG055603.
InParanoidiQ9BUU2.
OMAiHRHLMVR.
OrthoDBiEOG091G0JC7.
PhylomeDBiQ9BUU2.
TreeFamiTF324844.

Family and domain databases

InterProiView protein in InterPro
IPR019410. Methyltransf_16.
IPR029063. SAM-dependent_MTases.
PfamiView protein in Pfam
PF10294. Methyltransf_16. 1 hit.
SUPFAMiSSF53335. SSF53335. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BUU2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVQLAPAAAM DEVTFRSDTV LSDVHLYTPN HRHLMVRLNS VGQPVFLSQF
60 70 80 90 100
KLLWSQDSWT DSGAKGGSHR DVHTKEPPSA ETGSTGSPPG SGHGNEGFSL
110 120 130 140 150
QAGTDTTGQE VAEAQLDEDG DLDVVRRPRA ASDSNPAGPL RDKVHPMILA
160 170 180 190 200
QEEDDVLGEE AQGSPHDIIR IEHTMATPLE DVGKQVWRGA LLLADYILFR
210 220 230 240 250
QDLFRGCTAL ELGAGTGLAS IIAATMARTV YCTDVGADLL SMCQRNIALN
260 270 280 290 300
SHLAATGGGI VRVKELDWLK DDLCTDPKVP FSWSQEEISD LYDHTTILFA
310 320 330 340 350
AEVFYDDDLT DAVFKTLSRL AHRLKNACTA ILSVEKRLNF TLRHLDVTCE
360 370 380 390 400
AYDHFRSCLH ALEQLADGKL RFVVEPVEAS FPQLLVYERL QQLELWKIIA

EPVT
Length:404
Mass (Da):44,486
Last modified:May 15, 2007 - v2
Checksum:i049135469B80D6F9
GO
Isoform 2 (identifier: Q9BUU2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     172-205: EHTMATPLEDVGKQVWRGALLLADYILFRQDLFR → GVAGRPAPGRLHPVPTGPLPRMYSAGARGRHGAR
     206-404: Missing.

Show »
Length:205
Mass (Da):21,813
Checksum:i549514E9F88AA252
GO
Isoform 3 (identifier: Q9BUU2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-225: Missing.

Show »
Length:179
Mass (Da):20,389
Checksum:i286526061CCA0EEE
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03213459W → S. Corresponds to variant dbSNP:rs2270286Ensembl.1
Natural variantiVAR_032135219A → T. Corresponds to variant dbSNP:rs2302607Ensembl.1
Natural variantiVAR_059623366A → T1 PublicationCorresponds to variant dbSNP:rs1731000Ensembl.1
Natural variantiVAR_061617375E → K. Corresponds to variant dbSNP:rs55747257Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0251061 – 225Missing in isoform 3. 1 PublicationAdd BLAST225
Alternative sequenceiVSP_025107172 – 205EHTMA…QDLFR → GVAGRPAPGRLHPVPTGPLP RMYSAGARGRHGAR in isoform 2. 2 PublicationsAdd BLAST34
Alternative sequenceiVSP_025108206 – 404Missing in isoform 2. 2 PublicationsAdd BLAST199

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK022495 mRNA. Translation: BAB14058.1.
AK315383 mRNA. Translation: BAG37776.1.
AC007224 Genomic DNA. No translation available.
AC138420 Genomic DNA. No translation available.
AY203956 mRNA. Translation: AAP34479.1.
CH471112 Genomic DNA. Translation: EAW85210.1.
CH471112 Genomic DNA. Translation: EAW85211.1.
BC001908 mRNA. Translation: AAH01908.1.
CCDSiCCDS10533.2. [Q9BUU2-1]
RefSeqiNP_077014.3. NM_024109.3.
UniGeneiHs.306380.
Hs.593666.

Genome annotation databases

EnsembliENST00000163678; ENSP00000163678; ENSG00000067365. [Q9BUU2-2]
ENST00000381920; ENSP00000371345; ENSG00000067365. [Q9BUU2-1]
GeneIDi79091.
KEGGihsa:79091.
UCSCiuc002czb.4. human. [Q9BUU2-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiMET22_HUMAN
AccessioniPrimary (citable) accession number: Q9BUU2
Secondary accession number(s): B2RD29
, D3DUF2, Q6XYB4, Q9HA03
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 15, 2007
Last sequence update: May 15, 2007
Last modified: September 27, 2017
This is version 104 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families