Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BUR5

- APOO_HUMAN

UniProt

Q9BUR5 - APOO_HUMAN

Protein

Apolipoprotein O

Gene

APOO

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 89 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Promotes cholesterol efflux from macrophage cells. Detected in HDL, LDL and VLDL. Secreted by a microsomal triglyceride transfer protein (MTTP)-dependent mechanism, probably as a VLDL-associated protein that is subsequently transferred to HDL. May be involved in myocardium-protective mechanisms against lipid accumulation.1 Publication

    GO - Biological processi

    1. lipid transport Source: UniProtKB-KW

    Keywords - Biological processi

    Lipid transport, Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Apolipoprotein O
    Alternative name(s):
    Protein FAM121B
    Gene namesi
    Name:APOO
    Synonyms:FAM121B
    ORF Names:My025, UNQ1866/PRO4302
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome X

    Organism-specific databases

    HGNCiHGNC:28727. APOO.

    Subcellular locationi

    Membrane Curated; Single-pass membrane protein Curated. Secreted 1 Publication

    GO - Cellular componenti

    1. extracellular space Source: BHF-UCL
    2. high-density lipoprotein particle Source: UniProtKB-KW
    3. integral component of membrane Source: UniProtKB-KW
    4. low-density lipoprotein particle Source: UniProtKB-KW
    5. mitochondrion Source: UniProt
    6. very-low-density lipoprotein particle Source: UniProtKB-KW

    Keywords - Cellular componenti

    HDL, LDL, Membrane, Secreted, VLDL

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA162376709.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Signal peptidei1 – 2525Sequence AnalysisAdd
    BLAST
    Chaini26 – 198173Apolipoprotein OPRO_0000254646Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Glycosylationi162 – 1621O-linked (Xyl...) (chondroitin sulfate)Sequence Analysis

    Post-translational modificationi

    O-glycosylation; glycosaminoglycan of chondroitin-sulfate type.

    Keywords - PTMi

    Glycoprotein, Proteoglycan

    Proteomic databases

    MaxQBiQ9BUR5.
    PaxDbiQ9BUR5.
    PeptideAtlasiQ9BUR5.
    PRIDEiQ9BUR5.

    PTM databases

    PhosphoSiteiQ9BUR5.

    Expressioni

    Tissue specificityi

    Expressed in all tissues examined. Up-regulated in diabetic heart.1 Publication

    Gene expression databases

    ArrayExpressiQ9BUR5.
    BgeeiQ9BUR5.
    CleanExiHS_APOO.
    GenevestigatoriQ9BUR5.

    Organism-specific databases

    HPAiHPA003187.

    Interactioni

    Protein-protein interaction databases

    BioGridi122556. 1 interaction.
    STRINGi9606.ENSP00000368528.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BUR5.
    ModBaseiSearch...
    MobiDBiSearch...

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei108 – 12821HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Signal, Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG250883.
    HOGENOMiHOG000034011.
    HOVERGENiHBG059567.
    InParanoidiQ9BUR5.
    OMAiCEPYTNW.
    OrthoDBiEOG7CG70V.
    PhylomeDBiQ9BUR5.
    TreeFamiTF315313.

    Family and domain databases

    InterProiIPR019166. Apolipoprotein_O.
    [Graphical view]
    PfamiPF09769. ApoO. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    Sequence processingi: The displayed sequence is further processed into a mature form.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BUR5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MFKVIQRSVG PASLSLLTFK VYAAPKKDSP PKNSVKVDEL SLYSVPEGQS    50
    KYVEEARSQL EESISQLRHY CEPYTTWCQE TYSQTKPKMQ SLVQWGLDSY 100
    DYLQNAPPGF FPRLGVIGFA GLIGLLLARG SKIKKLVYPP GFMGLAASLY 150
    YPQQAIVFAQ VSGERLYDWG LRGYIVIEDL WKENFQKPGN VKNSPGTK 198
    Length:198
    Mass (Da):22,285
    Last modified:June 1, 2001 - v1
    Checksum:iBEC99607F54E98E2
    GO
    Isoform 2 (identifier: Q9BUR5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         80-109: ETYSQTKPKMQSLVQWGLDSYDYLQNAPPG → TAMTISKMHLLD

    Show »
    Length:180
    Mass (Da):20,199
    Checksum:i0612F903AB6390E1
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei80 – 10930ETYSQ…NAPPG → TAMTISKMHLLD in isoform 2. 1 PublicationVSP_023333Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF061264 mRNA. Translation: AAG43139.1.
    AY359114 mRNA. Translation: AAQ89472.1.
    AK311865 mRNA. Translation: BAG34806.1.
    CH471074 Genomic DNA. Translation: EAW99002.1.
    BC002333 mRNA. Translation: AAH02333.1.
    BC010102 mRNA. Translation: AAH10102.1.
    BC016814 mRNA. Translation: AAH16814.1.
    CCDSiCCDS14208.1. [Q9BUR5-1]
    RefSeqiNP_077027.1. NM_024122.4. [Q9BUR5-1]
    XP_006724579.1. XM_006724516.1. [Q9BUR5-1]
    XP_006724580.1. XM_006724517.1. [Q9BUR5-1]
    UniGeneiHs.495851.

    Genome annotation databases

    EnsembliENST00000379226; ENSP00000368528; ENSG00000184831. [Q9BUR5-1]
    GeneIDi79135.
    KEGGihsa:79135.
    UCSCiuc004dax.3. human. [Q9BUR5-1]

    Polymorphism databases

    DMDMi74733244.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AF061264 mRNA. Translation: AAG43139.1 .
    AY359114 mRNA. Translation: AAQ89472.1 .
    AK311865 mRNA. Translation: BAG34806.1 .
    CH471074 Genomic DNA. Translation: EAW99002.1 .
    BC002333 mRNA. Translation: AAH02333.1 .
    BC010102 mRNA. Translation: AAH10102.1 .
    BC016814 mRNA. Translation: AAH16814.1 .
    CCDSi CCDS14208.1. [Q9BUR5-1 ]
    RefSeqi NP_077027.1. NM_024122.4. [Q9BUR5-1 ]
    XP_006724579.1. XM_006724516.1. [Q9BUR5-1 ]
    XP_006724580.1. XM_006724517.1. [Q9BUR5-1 ]
    UniGenei Hs.495851.

    3D structure databases

    ProteinModelPortali Q9BUR5.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122556. 1 interaction.
    STRINGi 9606.ENSP00000368528.

    PTM databases

    PhosphoSitei Q9BUR5.

    Polymorphism databases

    DMDMi 74733244.

    Proteomic databases

    MaxQBi Q9BUR5.
    PaxDbi Q9BUR5.
    PeptideAtlasi Q9BUR5.
    PRIDEi Q9BUR5.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000379226 ; ENSP00000368528 ; ENSG00000184831 . [Q9BUR5-1 ]
    GeneIDi 79135.
    KEGGi hsa:79135.
    UCSCi uc004dax.3. human. [Q9BUR5-1 ]

    Organism-specific databases

    CTDi 79135.
    GeneCardsi GC0XM023851.
    HGNCi HGNC:28727. APOO.
    HPAi HPA003187.
    MIMi 300753. gene.
    neXtProti NX_Q9BUR5.
    PharmGKBi PA162376709.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG250883.
    HOGENOMi HOG000034011.
    HOVERGENi HBG059567.
    InParanoidi Q9BUR5.
    OMAi CEPYTNW.
    OrthoDBi EOG7CG70V.
    PhylomeDBi Q9BUR5.
    TreeFami TF315313.

    Miscellaneous databases

    GeneWikii Apolipoprotein_O.
    GenomeRNAii 79135.
    NextBioi 68006.
    PROi Q9BUR5.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BUR5.
    Bgeei Q9BUR5.
    CleanExi HS_APOO.
    Genevestigatori Q9BUR5.

    Family and domain databases

    InterProi IPR019166. Apolipoprotein_O.
    [Graphical view ]
    Pfami PF09769. ApoO. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. Mao Y.M., Xie Y., Zheng Z.H.
      Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Fetal brain.
    2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Brain.
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Lung, Skin and Urinary bladder.
    6. "ApoO, a novel apolipoprotein, is an original glycoprotein up-regulated by diabetes in human heart."
      Lamant M., Smih F., Harmancey R., Philip-Couderc P., Pathak A., Roncalli J., Galinier M., Collet X., Massabuau P., Senard J.-M., Rouet P.
      J. Biol. Chem. 281:36289-36302(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, COVALENT LINKAGE WITH CHONDROITIN SULFATE.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

    Entry informationi

    Entry nameiAPOO_HUMAN
    AccessioniPrimary (citable) accession number: Q9BUR5
    Secondary accession number(s): B2R4K9, Q9H3J9
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: October 31, 2006
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 89 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome X
      Human chromosome X: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3