Q9BUR5 (APOO_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 79.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Apolipoprotein O Alternative name(s): Protein FAM121B | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 198 AA. |
| Sequence status | Complete. |
| Sequence processing | The displayed sequence is further processed into a mature form. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Promotes cholesterol efflux from macrophage cells. Detected in HDL, LDL and VLDL. Secreted by a microsomal triglyceride transfer protein (MTTP)-dependent mechanism, probably as a VLDL-associated protein that is subsequently transferred to HDL. May be involved in myocardium-protective mechanisms against lipid accumulation. Ref.6 |
| Subcellular location | Membrane; Single-pass membrane protein Potential. Secreted Ref.6. |
| Tissue specificity | Expressed in all tissues examined. Up-regulated in diabetic heart. Ref.6 |
| Post-translational modification | O-glycosylation; glycosaminoglycan of chondroitin-sulfate type. |
| Sequence similarities | Belongs to the apolipoprotein O family. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Lipid transport Transport |
| Cellular component | HDL LDL Membrane Secreted VLDL |
| Coding sequence diversity | Alternative splicing |
| Domain | Signal Transmembrane Transmembrane helix |
| PTM | Glycoprotein Proteoglycan |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | lipid transport Inferred from electronic annotation. Source: UniProtKB-KW |
| Cellular_component | extracellular space Inferred from sequence or structural similarity PubMed 22261194. Source: BHF-UCL high-density lipoprotein particleInferred from electronic annotation. Source: UniProtKB-KW integral to membraneInferred from electronic annotation. Source: UniProtKB-KW low-density lipoprotein particleInferred from electronic annotation. Source: UniProtKB-KW very-low-density lipoprotein particleInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BUR5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BUR5-2) The sequence of this isoform differs from the canonical sequence as follows: 80-109: ETYSQTKPKMQSLVQWGLDSYDYLQNAPPG → TAMTISKMHLLD |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Signal peptide | 1 – 25 | 25 | Potential | ||||||
| Chain | 26 – 198 | 173 | Apolipoprotein O | PRO_0000254646 | |||||
Regions | |||||||||
| Transmembrane | 108 – 128 | 21 | Helical; Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 162 | 1 | O-linked (Xyl...) (chondroitin sulfate) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 80 – 109 | 30 | ETYSQ…NAPPG → TAMTISKMHLLD in isoform 2. | VSP_023333 | |||||
Sequences
| ||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | Mao Y.M., Xie Y., Zheng Z.H. Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Fetal brain. |
| [2] | "The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment." Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. Gray A.M.Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). |
| [3] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Brain. |
| [4] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [5] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Lung, Skin and Urinary bladder. |
| [6] | "ApoO, a novel apolipoprotein, is an original glycoprotein up-regulated by diabetes in human heart." Lamant M., Smih F., Harmancey R., Philip-Couderc P., Pathak A., Roncalli J., Galinier M., Collet X., Massabuau P., Senard J.-M., Rouet P. J. Biol. Chem. 281:36289-36302(2006) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, COVALENT LINKAGE WITH CHONDROITIN SULFATE. |
| [7] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF061264 mRNA. Translation: AAG43139.1. AY359114 mRNA. Translation: AAQ89472.1. AK311865 mRNA. Translation: BAG34806.1. CH471074 Genomic DNA. Translation: EAW99002.1. BC002333 mRNA. Translation: AAH02333.1. BC010102 mRNA. Translation: AAH10102.1. BC016814 mRNA. Translation: AAH16814.1. |
| IPI | IPI00042580. IPI00797546. |
| RefSeq | NP_077027.1. NM_024122.4. |
| UniGene | Hs.495851. |
3D structure databases | |
| ProteinModelPortal | Q9BUR5. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000368528. |
PTM databases | |
| PhosphoSite | Q9BUR5. |
Polymorphism databases | |
| DMDM | 74733244. |
Proteomic databases | |
| PaxDb | Q9BUR5. |
| PeptideAtlas | Q9BUR5. |
| PRIDE | Q9BUR5. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000379226; ENSP00000368528; ENSG00000184831. |
| GeneID | 79135. |
| KEGG | hsa:79135. |
| UCSC | uc004dax.3. human. |
Organism-specific databases | |
| CTD | 79135. |
| GeneCards | GC0XM023851. |
| HGNC | HGNC:28727. APOO. |
| HPA | HPA003187. |
| MIM | 300753. gene. |
| neXtProt | NX_Q9BUR5. |
| PharmGKB | PA162376709. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG250883. |
| HOGENOM | HOG000034011. |
| HOVERGEN | HBG059567. |
| InParanoid | Q9BUR5. |
| OMA | LRHHCEP. |
| OrthoDB | EOG479F84. |
| PhylomeDB | Q9BUR5. |
Gene expression databases | |
| ArrayExpress | Q9BUR5. |
| Bgee | Q9BUR5. |
| CleanEx | HS_APOO. |
| Genevestigator | Q9BUR5. |
| GermOnline | ENSG00000184831. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR019166. Apolipoprotein_O. [Graphical view] |
| Pfam | PF09769. ApoO. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 79135. |
| NextBio | 68006. |
| SOURCE | Search... |
Entry information
| Entry name | APOO_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BUR5 Secondary accession number(s): B2R4K9, Q9H3J9 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome X Human chromosome X: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
