Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BUR5 (APOO_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 86. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Apolipoprotein O
Alternative name(s):
Protein FAM121B
Gene names
Name:APOO
Synonyms:FAM121B
ORF Names:My025, UNQ1866/PRO4302
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length198 AA.
Sequence statusComplete.
Sequence processingThe displayed sequence is further processed into a mature form.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Promotes cholesterol efflux from macrophage cells. Detected in HDL, LDL and VLDL. Secreted by a microsomal triglyceride transfer protein (MTTP)-dependent mechanism, probably as a VLDL-associated protein that is subsequently transferred to HDL. May be involved in myocardium-protective mechanisms against lipid accumulation. Ref.6

Subcellular location

Membrane; Single-pass membrane protein Potential. Secreted Ref.6.

Tissue specificity

Expressed in all tissues examined. Up-regulated in diabetic heart. Ref.6

Post-translational modification

O-glycosylation; glycosaminoglycan of chondroitin-sulfate type.

Sequence similarities

Belongs to the apolipoprotein O family.

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BUR5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9BUR5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     80-109: ETYSQTKPKMQSLVQWGLDSYDYLQNAPPG → TAMTISKMHLLD

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Signal peptide1 – 2525 Potential
Chain26 – 198173Apolipoprotein O
PRO_0000254646

Regions

Transmembrane108 – 12821Helical; Potential

Amino acid modifications

Glycosylation1621O-linked (Xyl...) (chondroitin sulfate) Potential

Natural variations

Alternative sequence80 – 10930ETYSQ…NAPPG → TAMTISKMHLLD in isoform 2.
VSP_023333

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2001. Version 1.
Checksum: BEC99607F54E98E2

FASTA19822,285
        10         20         30         40         50         60 
MFKVIQRSVG PASLSLLTFK VYAAPKKDSP PKNSVKVDEL SLYSVPEGQS KYVEEARSQL 

        70         80         90        100        110        120 
EESISQLRHY CEPYTTWCQE TYSQTKPKMQ SLVQWGLDSY DYLQNAPPGF FPRLGVIGFA 

       130        140        150        160        170        180 
GLIGLLLARG SKIKKLVYPP GFMGLAASLY YPQQAIVFAQ VSGERLYDWG LRGYIVIEDL 

       190 
WKENFQKPGN VKNSPGTK 

« Hide

Isoform 2 [UniParc].

Checksum: 0612F903AB6390E1
Show »

FASTA18020,199

References

« Hide 'large scale' references
[1]Mao Y.M., Xie Y., Zheng Z.H.
Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Fetal brain.
[2]"The secreted protein discovery initiative (SPDI), a large-scale effort to identify novel human secreted and transmembrane proteins: a bioinformatics assessment."
Clark H.F., Gurney A.L., Abaya E., Baker K., Baldwin D.T., Brush J., Chen J., Chow B., Chui C., Crowley C., Currell B., Deuel B., Dowd P., Eaton D., Foster J.S., Grimaldi C., Gu Q., Hass P.E. expand/collapse author list , Heldens S., Huang A., Kim H.S., Klimowski L., Jin Y., Johnson S., Lee J., Lewis L., Liao D., Mark M.R., Robbie E., Sanchez C., Schoenfeld J., Seshagiri S., Simmons L., Singh J., Smith V., Stinson J., Vagts A., Vandlen R.L., Watanabe C., Wieand D., Woods K., Xie M.-H., Yansura D.G., Yi S., Yu G., Yuan J., Zhang M., Zhang Z., Goddard A.D., Wood W.I., Godowski P.J., Gray A.M.
Genome Res. 13:2265-2270(2003) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
[3]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Brain.
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Lung, Skin and Urinary bladder.
[6]"ApoO, a novel apolipoprotein, is an original glycoprotein up-regulated by diabetes in human heart."
Lamant M., Smih F., Harmancey R., Philip-Couderc P., Pathak A., Roncalli J., Galinier M., Collet X., Massabuau P., Senard J.-M., Rouet P.
J. Biol. Chem. 281:36289-36302(2006) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, COVALENT LINKAGE WITH CHONDROITIN SULFATE.
[7]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AF061264 mRNA. Translation: AAG43139.1.
AY359114 mRNA. Translation: AAQ89472.1.
AK311865 mRNA. Translation: BAG34806.1.
CH471074 Genomic DNA. Translation: EAW99002.1.
BC002333 mRNA. Translation: AAH02333.1.
BC010102 mRNA. Translation: AAH10102.1.
BC016814 mRNA. Translation: AAH16814.1.
RefSeqNP_077027.1. NM_024122.4.
UniGeneHs.495851.

3D structure databases

ProteinModelPortalQ9BUR5.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122556. 1 interaction.
STRING9606.ENSP00000368528.

PTM databases

PhosphoSiteQ9BUR5.

Polymorphism databases

DMDM74733244.

Proteomic databases

PaxDbQ9BUR5.
PeptideAtlasQ9BUR5.
PRIDEQ9BUR5.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000379226; ENSP00000368528; ENSG00000184831. [Q9BUR5-1]
GeneID79135.
KEGGhsa:79135.
UCSCuc004dax.3. human. [Q9BUR5-1]

Organism-specific databases

CTD79135.
GeneCardsGC0XM023851.
HGNCHGNC:28727. APOO.
HPAHPA003187.
MIM300753. gene.
neXtProtNX_Q9BUR5.
PharmGKBPA162376709.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG250883.
HOGENOMHOG000034011.
HOVERGENHBG059567.
InParanoidQ9BUR5.
OMACEPYTNW.
OrthoDBEOG7CG70V.
PhylomeDBQ9BUR5.
TreeFamTF315313.

Gene expression databases

ArrayExpressQ9BUR5.
BgeeQ9BUR5.
CleanExHS_APOO.
GenevestigatorQ9BUR5.

Family and domain databases

InterProIPR019166. Apolipoprotein_O.
[Graphical view]
PfamPF09769. ApoO. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiApolipoprotein_O.
GenomeRNAi79135.
NextBio68006.
PROQ9BUR5.
SOURCESearch...

Entry information

Entry nameAPOO_HUMAN
AccessionPrimary (citable) accession number: Q9BUR5
Secondary accession number(s): B2R4K9, Q9H3J9
Entry history
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: June 1, 2001
Last modified: April 16, 2014
This is version 86 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome X

Human chromosome X: entries, gene names and cross-references to MIM