Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BUR5

- APOO_HUMAN

UniProt

Q9BUR5 - APOO_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Apolipoprotein O

Gene

APOO

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

Promotes cholesterol efflux from macrophage cells. Detected in HDL, LDL and VLDL. Secreted by a microsomal triglyceride transfer protein (MTTP)-dependent mechanism, probably as a VLDL-associated protein that is subsequently transferred to HDL. May be involved in myocardium-protective mechanisms against lipid accumulation.1 Publication

GO - Biological processi

  1. lipid transport Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

Lipid transport, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Apolipoprotein O
Alternative name(s):
Protein FAM121B
Gene namesi
Name:APOO
Synonyms:FAM121B
ORF Names:My025, UNQ1866/PRO4302
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome X

Organism-specific databases

HGNCiHGNC:28727. APOO.

Subcellular locationi

Membrane Curated; Single-pass membrane protein Curated. Secreted 1 Publication

GO - Cellular componenti

  1. extracellular space Source: BHF-UCL
  2. high-density lipoprotein particle Source: UniProtKB-KW
  3. integral component of membrane Source: UniProtKB-KW
  4. low-density lipoprotein particle Source: UniProtKB-KW
  5. mitochondrion Source: UniProt
  6. very-low-density lipoprotein particle Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

HDL, LDL, Membrane, Secreted, VLDL

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA162376709.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Signal peptidei1 – 2525Sequence AnalysisAdd
BLAST
Chaini26 – 198173Apolipoprotein OPRO_0000254646Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Glycosylationi162 – 1621O-linked (Xyl...) (chondroitin sulfate)Sequence Analysis

Post-translational modificationi

O-glycosylation; glycosaminoglycan of chondroitin-sulfate type.

Keywords - PTMi

Glycoprotein, Proteoglycan

Proteomic databases

MaxQBiQ9BUR5.
PaxDbiQ9BUR5.
PeptideAtlasiQ9BUR5.
PRIDEiQ9BUR5.

PTM databases

PhosphoSiteiQ9BUR5.

Expressioni

Tissue specificityi

Expressed in all tissues examined. Up-regulated in diabetic heart.1 Publication

Gene expression databases

BgeeiQ9BUR5.
CleanExiHS_APOO.
ExpressionAtlasiQ9BUR5. baseline and differential.
GenevestigatoriQ9BUR5.

Organism-specific databases

HPAiHPA003187.

Interactioni

Protein-protein interaction databases

BioGridi122556. 1 interaction.
STRINGi9606.ENSP00000368528.

Structurei

3D structure databases

ProteinModelPortaliQ9BUR5.
ModBaseiSearch...
MobiDBiSearch...

Transmembrane

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Transmembranei108 – 12821HelicalSequence AnalysisAdd
BLAST

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Signal, Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG250883.
GeneTreeiENSGT00530000063666.
HOGENOMiHOG000034011.
HOVERGENiHBG059567.
InParanoidiQ9BUR5.
OMAiCEPYTNW.
OrthoDBiEOG7CG70V.
PhylomeDBiQ9BUR5.
TreeFamiTF315313.

Family and domain databases

InterProiIPR019166. Apolipoprotein_O.
[Graphical view]
PfamiPF09769. ApoO. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

Sequence processingi: The displayed sequence is further processed into a mature form.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BUR5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFKVIQRSVG PASLSLLTFK VYAAPKKDSP PKNSVKVDEL SLYSVPEGQS
60 70 80 90 100
KYVEEARSQL EESISQLRHY CEPYTTWCQE TYSQTKPKMQ SLVQWGLDSY
110 120 130 140 150
DYLQNAPPGF FPRLGVIGFA GLIGLLLARG SKIKKLVYPP GFMGLAASLY
160 170 180 190
YPQQAIVFAQ VSGERLYDWG LRGYIVIEDL WKENFQKPGN VKNSPGTK
Length:198
Mass (Da):22,285
Last modified:June 1, 2001 - v1
Checksum:iBEC99607F54E98E2
GO
Isoform 2 (identifier: Q9BUR5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     80-109: ETYSQTKPKMQSLVQWGLDSYDYLQNAPPG → TAMTISKMHLLD

Show »
Length:180
Mass (Da):20,199
Checksum:i0612F903AB6390E1
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei80 – 10930ETYSQ…NAPPG → TAMTISKMHLLD in isoform 2. 1 PublicationVSP_023333Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF061264 mRNA. Translation: AAG43139.1.
AY359114 mRNA. Translation: AAQ89472.1.
AK311865 mRNA. Translation: BAG34806.1.
CH471074 Genomic DNA. Translation: EAW99002.1.
BC002333 mRNA. Translation: AAH02333.1.
BC010102 mRNA. Translation: AAH10102.1.
BC016814 mRNA. Translation: AAH16814.1.
CCDSiCCDS14208.1. [Q9BUR5-1]
RefSeqiNP_077027.1. NM_024122.4. [Q9BUR5-1]
XP_006724579.1. XM_006724516.1. [Q9BUR5-1]
XP_006724580.1. XM_006724517.1. [Q9BUR5-1]
UniGeneiHs.495851.

Genome annotation databases

EnsembliENST00000379226; ENSP00000368528; ENSG00000184831. [Q9BUR5-1]
GeneIDi79135.
KEGGihsa:79135.
UCSCiuc004dax.3. human. [Q9BUR5-1]

Polymorphism databases

DMDMi74733244.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AF061264 mRNA. Translation: AAG43139.1 .
AY359114 mRNA. Translation: AAQ89472.1 .
AK311865 mRNA. Translation: BAG34806.1 .
CH471074 Genomic DNA. Translation: EAW99002.1 .
BC002333 mRNA. Translation: AAH02333.1 .
BC010102 mRNA. Translation: AAH10102.1 .
BC016814 mRNA. Translation: AAH16814.1 .
CCDSi CCDS14208.1. [Q9BUR5-1 ]
RefSeqi NP_077027.1. NM_024122.4. [Q9BUR5-1 ]
XP_006724579.1. XM_006724516.1. [Q9BUR5-1 ]
XP_006724580.1. XM_006724517.1. [Q9BUR5-1 ]
UniGenei Hs.495851.

3D structure databases

ProteinModelPortali Q9BUR5.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122556. 1 interaction.
STRINGi 9606.ENSP00000368528.

PTM databases

PhosphoSitei Q9BUR5.

Polymorphism databases

DMDMi 74733244.

Proteomic databases

MaxQBi Q9BUR5.
PaxDbi Q9BUR5.
PeptideAtlasi Q9BUR5.
PRIDEi Q9BUR5.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000379226 ; ENSP00000368528 ; ENSG00000184831 . [Q9BUR5-1 ]
GeneIDi 79135.
KEGGi hsa:79135.
UCSCi uc004dax.3. human. [Q9BUR5-1 ]

Organism-specific databases

CTDi 79135.
GeneCardsi GC0XM023851.
HGNCi HGNC:28727. APOO.
HPAi HPA003187.
MIMi 300753. gene.
neXtProti NX_Q9BUR5.
PharmGKBi PA162376709.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG250883.
GeneTreei ENSGT00530000063666.
HOGENOMi HOG000034011.
HOVERGENi HBG059567.
InParanoidi Q9BUR5.
OMAi CEPYTNW.
OrthoDBi EOG7CG70V.
PhylomeDBi Q9BUR5.
TreeFami TF315313.

Miscellaneous databases

GeneWikii Apolipoprotein_O.
GenomeRNAii 79135.
NextBioi 68006.
PROi Q9BUR5.
SOURCEi Search...

Gene expression databases

Bgeei Q9BUR5.
CleanExi HS_APOO.
ExpressionAtlasi Q9BUR5. baseline and differential.
Genevestigatori Q9BUR5.

Family and domain databases

InterProi IPR019166. Apolipoprotein_O.
[Graphical view ]
Pfami PF09769. ApoO. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. Mao Y.M., Xie Y., Zheng Z.H.
    Submitted (APR-1998) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Fetal brain.
  2. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
  3. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Brain.
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Lung, Skin and Urinary bladder.
  6. "ApoO, a novel apolipoprotein, is an original glycoprotein up-regulated by diabetes in human heart."
    Lamant M., Smih F., Harmancey R., Philip-Couderc P., Pathak A., Roncalli J., Galinier M., Collet X., Massabuau P., Senard J.-M., Rouet P.
    J. Biol. Chem. 281:36289-36302(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TISSUE SPECIFICITY, COVALENT LINKAGE WITH CHONDROITIN SULFATE.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].

Entry informationi

Entry nameiAPOO_HUMAN
AccessioniPrimary (citable) accession number: Q9BUR5
Secondary accession number(s): B2R4K9, Q9H3J9
Entry historyi
Integrated into UniProtKB/Swiss-Prot: October 31, 2006
Last sequence update: June 1, 2001
Last modified: October 29, 2014
This is version 90 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome X
    Human chromosome X: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3