Q9BUP3 (HTAI2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 100.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Oxidoreductase HTATIP2 EC=1.1.1.- Alternative name(s): 30 kDa HIV-1 TAT-interacting protein HIV-1 TAT-interactive protein 2 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 242 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Oxidoreductase required for tumor suppression. NAPDH-bound form inhibits nuclear import by competing with nuclear import substrates for binding to a subset of nuclear transport receptors. May act as a redox sensor linked to transcription through regulation of nuclear import. Isoform 1 is a metastasis suppressor with proapoptotic as well as antiangiogenic properties. Isoform 2 has an antiapoptotic effect. Ref.1 Ref.3 Ref.11 Ref.14 |
| Subunit structure | Monomer. Binds nuclear transport receptors XPO4, IPO5/RANBP5, IPO7, IPO9 and KPNB1 as well as GCN1L1/GCN1 and LRPPRC probably through their HEAT repeats. Binds NCOA5/CIA. Isoform 2 binds the proteasome subunit PSMD4/s5a through its N-terminus. Binds the activation domain of HIV-1 Tat. Ref.2 Ref.3 Ref.13 Ref.14 Ref.15 |
| Subcellular location | |
| Tissue specificity | Ubiquitous. Highest level in liver. High levels in lung, skeletal muscle, pancreas and placenta. Moderate levels in heart and kidney. Low levels in brain. Not expressed or low levels in variant small cell lung carcinomas, 33% of hepatocellular carcinomas and neuroblastomas. Ref.1 Ref.12 |
| Domain | Unique C-terminus confers high proteasome-dependent instability to isoform 2. Ref.3 |
| Caution | Was originally (Ref.2 and Ref.10) thought to be a transcriptional coregulator with protein kinase activity. However, crystal structure reveals a short chain dehydrogenase/reductase fold binding NADPH rather than ATP. |
Ontologies
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.1 (identifier: Q9BUP3-1) Also known as: CC3; This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.3 (identifier: Q9BUP3-2) Also known as: TC3; The sequence of this isoform differs from the canonical sequence as follows: 102-133: EGFVRVDRDYVLKSAELAKAGGCKHFNLLSSK → VRKAYALFPFCWPVISRILFLLTLFLCACCNA 134-242: Missing. | ||||||
| Note: Mutagenesis of Leu-154 and Leu-157 or Cys-158, Cys-160 and Cys-161 abolishes antiapoptotic effect. | ||||||
| Isoform 3 (identifier: Q9BUP3-3) The sequence of this isoform differs from the canonical sequence as follows: 1-1: M → MAGPAALSAAAAAALAAALLLLRREDPGPGAGPSM |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||||||||||||||||||||||||||||||||||||||||||
Molecule processing | |||||||||||||||||||||||||||||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 242 | 242 | Oxidoreductase HTATIP2 | PRO_0000072544 | |||||||||||||||||||||||||||||||||||||||||||||
Regions | |||||||||||||||||||||||||||||||||||||||||||||||||
| Nucleotide binding | 19 – 52 | 34 | NADP Ref.15 | ||||||||||||||||||||||||||||||||||||||||||||||
Sites | |||||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 143 | 1 | Proton acceptor Probable Ref.15 | ||||||||||||||||||||||||||||||||||||||||||||||
| Active site | 147 | 1 | Probable Ref.15 | ||||||||||||||||||||||||||||||||||||||||||||||
| Binding site | 131 | 1 | Substrate Probable Ref.15 | ||||||||||||||||||||||||||||||||||||||||||||||
Amino acid modifications | |||||||||||||||||||||||||||||||||||||||||||||||||
| Modified residue | 45 | 1 | Phosphoserine By similarity | ||||||||||||||||||||||||||||||||||||||||||||||
Natural variations | |||||||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 1 | 1 | M → MAGPAALSAAAAAALAAALL LLRREDPGPGAGPSM in isoform 3. | VSP_038339 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 102 – 133 | 32 | EGFVR…LLSSK → VRKAYALFPFCWPVISRILF LLTLFLCACCNA in isoform 2. | VSP_051864 | |||||||||||||||||||||||||||||||||||||||||||||
| Alternative sequence | 134 – 242 | 109 | Missing in isoform 2. | VSP_051865 | |||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 106 | 1 | R → S in a hepatocellular carcinoma sample. Ref.12 | VAR_023713 | |||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 108 | 1 | D → Y in a hepatocellular carcinoma sample. Ref.12 | VAR_023714 | |||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 116 | 1 | A → T in a hepatocellular carcinoma sample. Ref.12 | VAR_023715 | |||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 134 | 1 | G → V in a hepatocellular carcinoma sample; reduces protein stability. Ref.12 | VAR_023716 | |||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 144 | 1 | L → I in a hepatocellular carcinoma sample. Ref.12 | VAR_023717 | |||||||||||||||||||||||||||||||||||||||||||||
| Natural variant | 197 | 1 | S → R. Ref.1 Ref.9 Ref.16 Corresponds to variant rs3824886 [ dbSNP | Ensembl ]. | VAR_023718 | |||||||||||||||||||||||||||||||||||||||||||||
Experimental info | |||||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 28 – 31 | 4 | GETG → VETA: Loss of proapoptotic and metastatis-inhibiting effect. Ref.10 | ||||||||||||||||||||||||||||||||||||||||||||||
| Mutagenesis | 106 | 1 | R → H: Loss of association with nucleus. Ref.12 | ||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 87 | 1 | V → F in CAG33102. Ref.5 | ||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 170 | 1 | L → P in BAD96730. Ref.6 | ||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 182 | 1 | W → R in AAC39694. Ref.2 | ||||||||||||||||||||||||||||||||||||||||||||||
| Sequence conflict | 187 | 1 | F → L in AAB84360. Ref.1 | ||||||||||||||||||||||||||||||||||||||||||||||
Secondary structure | |||||||||||||||||||||||||||||||||||||||||||||||||
Helix Strand Turn | |||||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 6 – 16 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 20 – 24 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 29 – 41 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 45 – 53 | 9 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 60 – 64 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 66 – 69 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 72 – 82 | 11 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 86 – 90 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 96 – 108 | 13 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 110 – 121 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 126 – 130 | 5 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 142 – 155 | 14 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 160 – 166 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 169 – 171 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 175 – 177 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 179 – 188 | 10 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 195 – 198 | 4 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 200 – 202 | 3 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 203 – 214 | 12 | |||||||||||||||||||||||||||||||||||||||||||||||
| Beta strand | 220 – 226 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||
| Helix | 227 – 233 | 7 | |||||||||||||||||||||||||||||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "A link between metastasis and resistance to apoptosis of variant small cell lung carcinoma." Shtivelman E. Oncogene 14:2167-2173(1997) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), FUNCTION, TISSUE SPECIFICITY, VARIANT ARG-197. Tissue: Lung cancer. |
| [2] | "A cofactor, TIP30, specifically enhances HIV-1 Tat-activated transcription." Xiao H., Tao Y., Greenblatt J., Roeder R.G. Proc. Natl. Acad. Sci. U.S.A. 95:2146-2151(1998) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), INTERACTION WITH HIV-1 TAT. Tissue: Pancreatic islet. |
| [3] | "Alternatively spliced products CC3 and TC3 have opposing effects on apoptosis." Whitman S., Wang X., Shalaby R., Shtivelman E. Mol. Cell. Biol. 20:583-593(2000) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 2), FUNCTION, INTERACTION WITH PSMD4. Tissue: Placenta. |
| [4] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Synovium. |
| [5] | "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)." Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B. Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). |
| [6] | Suzuki Y., Sugano S., Totoki Y., Toyoda A., Takeda T., Sakaki Y., Tanaka A., Yokoyama S. Submitted (APR-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1). Tissue: Small intestine. |
| [7] | "Human chromosome 11 DNA sequence and analysis including novel gene identification." Taylor T.D., Noguchi H., Totoki Y., Toyoda A., Kuroki Y., Dewar K., Lloyd C., Itoh T., Takeda T., Kim D.-W., She X., Barlow K.F., Bloom T., Bruford E., Chang J.L., Cuomo C.A., Eichler E., FitzGerald M.G. Sakaki Y.Nature 440:497-500(2006) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [8] | Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. Venter J.C.Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA]. |
| [9] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 3), VARIANT ARG-197. Tissue: Cervix and Skin. |
| [10] | "TIP30 has an intrinsic kinase activity required for up-regulation of a subset of apoptotic genes." Xiao H., Palhan V., Yang Y., Roeder R.G. EMBO J. 19:956-963(2000) [PubMed] [Europe PMC] [Abstract] Cited for: MUTAGENESIS OF 28-GLY--GLY-31. |
| [11] | "Metastasis suppressor CC3 inhibits angiogenic properties of tumor cells in vitro." NicAmhlaoibh R., Shtivelman E. Oncogene 20:270-275(2001) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION. |
| [12] | "TIP30 deficiency increases susceptibility to tumorigenesis." Ito M., Jiang C., Krumm K., Zhang X., Pecha J., Zhao J., Guo Y., Roeder R.G., Xiao H. Cancer Res. 63:8763-8767(2003) [PubMed] [Europe PMC] [Abstract] Cited for: TISSUE SPECIFICITY, VARIANTS SER-106; TYR-108; THR-116; VAL-134 AND ILE-144, MUTAGENESIS OF ARG-106, CHARACTERIZATION OF VARIANT VAL-134. |
| [13] | "TIP30 interacts with an estrogen receptor alpha-interacting coactivator CIA and regulates c-myc transcription." Jiang C., Ito M., Piening V., Bruck K., Roeder R.G., Xiao H. J. Biol. Chem. 279:27781-27789(2004) [PubMed] [Europe PMC] [Abstract] Cited for: INTERACTION WITH NCOA5. |
| [14] | "Inhibition of nuclear import by the proapoptotic protein CC3." King F.W., Shtivelman E. Mol. Cell. Biol. 24:7091-7101(2004) [PubMed] [Europe PMC] [Abstract] Cited for: FUNCTION, SUBCELLULAR LOCATION, INTERACTION WITH XPO4; IPO5; IPO7; IPO9; KPNB1; GCN1L1 AND LRPPRC. |
| [15] | "Crystal structure of CC3 (TIP30): implications for its role as a tumor suppressor." El Omari K., Bird L.E., Nichols C.E., Ren J., Stammers D.K. J. Biol. Chem. 280:18229-18236(2005) [PubMed] [Europe PMC] [Abstract] Cited for: X-RAY CRYSTALLOGRAPHY (1.7 ANGSTROMS). |
| [16] | "Initial characterization of the human central proteome." Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J. BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract] Cited for: VARIANT [LARGE SCALE ANALYSIS] ARG-197, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | U69161 mRNA. Translation: AAB84360.1. AF039103 mRNA. Translation: AAC39694.1. AF092095 mRNA. Translation: AAC78331.1. AK292092 mRNA. Translation: BAF84781.1. CR456821 mRNA. Translation: CAG33102.1. AK223010 mRNA. Translation: BAD96730.1. AK222969 mRNA. Translation: BAD96689.1. AC025972 Genomic DNA. No translation available. CH471064 Genomic DNA. Translation: EAW68338.1. CH471064 Genomic DNA. Translation: EAW68339.1. BC002439 mRNA. Translation: AAH02439.2. BC015358 mRNA. Translation: AAH15358.1. | ||||||||||||
| IPI | IPI00383665. IPI00784029. IPI00847689. | ||||||||||||
| RefSeq | NP_001091990.1. NM_001098520.1. NP_001091991.1. NM_001098521.1. NP_001091992.1. NM_001098522.1. NP_001091993.1. NM_001098523.1. NP_006401.3. NM_006410.4. | ||||||||||||
| UniGene | Hs.90753. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9BUP3. | ||||||||||||
| SMR | Q9BUP3. Positions 5-235. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| STRING | 9606.ENSP00000392985. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9BUP3. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 74733240. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9BUP3. | ||||||||||||
| PRIDE | Q9BUP3. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 10553. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000419348; ENSP00000392985; ENSG00000109854. ENST00000421577; ENSP00000397752; ENSG00000109854. ENST00000443524; ENSP00000387876; ENSG00000109854. ENST00000451739; ENSP00000394259; ENSG00000109854. ENST00000530266; ENSP00000436548; ENSG00000109854. ENST00000532081; ENSP00000432107; ENSG00000109854. ENST00000532505; ENSP00000432338; ENSG00000109854. | ||||||||||||
| GeneID | 10553. | ||||||||||||
| KEGG | hsa:10553. | ||||||||||||
| UCSC | uc001mpx.2. human. uc001mpy.4. human. uc001mpz.2. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 10553. | ||||||||||||
| GeneCards | GC11P020341. | ||||||||||||
| HGNC | HGNC:16637. HTATIP2. | ||||||||||||
| HPA | HPA006417. HPA024321. | ||||||||||||
| MIM | 605628. gene. | ||||||||||||
| neXtProt | NX_Q9BUP3. | ||||||||||||
| PharmGKB | PA29539. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG0702. | ||||||||||||
| HOVERGEN | HBG052833. | ||||||||||||
| InParanoid | Q9BUP3. | ||||||||||||
| OMA | HLENPVG. | ||||||||||||
| OrthoDB | EOG43JC5K. | ||||||||||||
| PhylomeDB | Q9BUP3. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9BUP3. | ||||||||||||
| Bgee | Q9BUP3. | ||||||||||||
| CleanEx | HS_HTATIP2. | ||||||||||||
| Genevestigator | Q9BUP3. | ||||||||||||
| GermOnline | ENSG00000109854. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 3.40.50.720. 1 hit. | ||||||||||||
| InterPro | IPR016040. NAD(P)-bd_dom. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| EvolutionaryTrace | Q9BUP3. | ||||||||||||
| GenomeRNAi | 10553. | ||||||||||||
| NextBio | 40029. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | HTAI2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BUP3 Secondary accession number(s): A8K7S7 Q6IBI3 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 11 Human chromosome 11: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |

Clusters with
