Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Lipase maturation factor 2

Gene

LMF2

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Involved in the maturation of specific proteins in the endoplasmic reticulum. May be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway (By similarity).By similarity

GO - Biological processi

Enzyme and pathway databases

ReactomeiR-HSA-8963889 Assembly of active LPL and LIPC lipase complexes

Names & Taxonomyi

Protein namesi
Recommended name:
Lipase maturation factor 2
Alternative name(s):
Transmembrane protein 112B
Transmembrane protein 153
Gene namesi
Name:LMF2
Synonyms:TMEM112B, TMEM153
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 22

Organism-specific databases

EuPathDBiHostDB:ENSG00000100258.17
HGNCiHGNC:25096 LMF2
neXtProtiNX_Q9BU23

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Transmembranei10 – 30HelicalSequence analysisAdd BLAST21
Transmembranei78 – 98HelicalSequence analysisAdd BLAST21
Transmembranei102 – 122HelicalSequence analysisAdd BLAST21
Transmembranei123 – 143HelicalSequence analysisAdd BLAST21
Transmembranei165 – 185HelicalSequence analysisAdd BLAST21
Transmembranei227 – 247HelicalSequence analysisAdd BLAST21
Transmembranei259 – 279HelicalSequence analysisAdd BLAST21
Transmembranei310 – 330HelicalSequence analysisAdd BLAST21
Transmembranei364 – 384HelicalSequence analysisAdd BLAST21
Transmembranei399 – 419HelicalSequence analysisAdd BLAST21
Transmembranei637 – 657HelicalSequence analysisAdd BLAST21

Keywords - Cellular componenti

Endoplasmic reticulum, Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi91289
OpenTargetsiENSG00000100258
PharmGKBiPA162394144

Polymorphism and mutation databases

BioMutaiLMF2
DMDMi74733167

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003245101 – 707Lipase maturation factor 2Add BLAST707

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Glycosylationi489N-linked (GlcNAc...) asparagineSequence analysis1
Glycosylationi616N-linked (GlcNAc...) asparagineSequence analysis1

Keywords - PTMi

Glycoprotein

Proteomic databases

EPDiQ9BU23
MaxQBiQ9BU23
PaxDbiQ9BU23
PeptideAtlasiQ9BU23
PRIDEiQ9BU23
ProteomicsDBi79046
79047 [Q9BU23-2]
79048 [Q9BU23-3]

PTM databases

iPTMnetiQ9BU23
PhosphoSitePlusiQ9BU23
SwissPalmiQ9BU23

Expressioni

Gene expression databases

BgeeiENSG00000100258
CleanExiHS_LMF2
GenevisibleiQ9BU23 HS

Organism-specific databases

HPAiHPA062626

Interactioni

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi124811, 40 interactors
IntActiQ9BU23, 10 interactors
STRINGi9606.ENSP00000424381

Family & Domainsi

Sequence similaritiesi

Belongs to the lipase maturation factor family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiENOG410IFKQ Eukaryota
ENOG410XPYW LUCA
GeneTreeiENSGT00530000063702
HOGENOMiHOG000019333
HOVERGENiHBG108090
InParanoidiQ9BU23
OMAiWVEEFFP
OrthoDBiEOG091G05XZ
PhylomeDBiQ9BU23
TreeFamiTF314339

Family and domain databases

InterProiView protein in InterPro
IPR009613 LMF
PfamiView protein in Pfam
PF06762 LMF1, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BU23-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGSRLPRQL FLQGVAAVFM FAFASLYTQI PGLYGPEGIL PARRTLRPQG
60 70 80 90 100
KGRWQQLWET PTLLWEAPRL GLDTAQGLEL LSLLGALVAL GALLLSPLRH
110 120 130 140 150
PVIYLLLWAA YLSACQVGQV FLYFQWDSLL LETGFLAVLV APLRPASHRK
160 170 180 190 200
EAPQGRQAGA LPHEDLPFWL VRWLLFRLMF ASGVVKLTSR CPAWWGLTAL
210 220 230 240 250
TYHYETQCLP TPAAWFAHHL PVWLHKLSVV ATFLIEIAVP PLFFAPIRRL
260 270 280 290 300
RLAAFYSQVL LQVLIIITGN YNFFNLMTLV LTTALLDDQH LAAEPGHGSR
310 320 330 340 350
KKTATSWPKA LLATLSLLLE LAVYGLLAYG TVHYFGLEVD WQQRTIHSRT
360 370 380 390 400
TFTFHQFSQW LKTLTLPTVW LGVASLVWEL LSALWRWTQV RGWLRKLSAV
410 420 430 440 450
VQLSLVGTAT VALFLISLVP YSYVEPGTHG RLWTGAHRLF GAVEHLQLAN
460 470 480 490 500
SYGLFRRMTG LGGRPEVVLE GSYDGHHWTE IEFMYKPGNL SRPPPVVVPH
510 520 530 540 550
QPRLDWQMWF AALGPHTHSP WFTSLVLRLL QGKEPVIRLV QSQVARYPFH
560 570 580 590 600
KQPPTYVRAQ RYKYWFSQPG EQGQWWRRQW VEEFFPSVSL GDPTLETLLR
610 620 630 640 650
QFGLQEKSPP RTRSANSTLA QALHWTRSQL SPLEAPALLW GLLMAVGAVR
660 670 680 690 700
FVQALLAPCS LRSSPLAPVS GEKRRPASQK DSGAASEQAT AAPNPCSSSS

RTTRRKK
Length:707
Mass (Da):79,698
Last modified:March 1, 2004 - v2
Checksum:iF3599AE9549C7E62
GO
Isoform 2 (identifier: Q9BU23-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-31: MAGSRLPRQLFLQGVAAVFMFAFASLYTQIP → MTCPPT

Show »
Length:682
Mass (Da):76,915
Checksum:i232E393DC1F5A51D
GO
Isoform 3 (identifier: Q9BU23-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     392-504: Missing.

Note: No experimental confirmation available.
Show »
Length:594
Mass (Da):67,156
Checksum:i03FAAE2CF75D5BAF
GO

Sequence cautioni

The sequence AAB03346 differs from that shown. Reason: Erroneous gene model prediction.Curated
The sequence BAC85437 differs from that shown. Chimeric cDNA.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti571E → G in BAC85437 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_03980368P → L in a breast cancer sample; somatic mutation. 1 PublicationCorresponds to variant dbSNP:rs376748648Ensembl.1
Natural variantiVAR_039804479T → M. Corresponds to variant dbSNP:rs8136495Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0322541 – 31MAGSR…YTQIP → MTCPPT in isoform 2. 1 PublicationAdd BLAST31
Alternative sequenceiVSP_032255392 – 504Missing in isoform 3. 1 PublicationAdd BLAST113

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
CR456605 mRNA Translation: CAG30491.1
U62317 Genomic DNA Translation: AAB03346.1 Sequence problems.
BC002942 mRNA Translation: AAH02942.2
BC014652 mRNA Translation: AAH14652.1
BC021143 mRNA Translation: AAH21143.1
AK130818 mRNA Translation: BAC85437.1 Sequence problems.
CCDSiCCDS14093.2 [Q9BU23-1]
RefSeqiNP_149977.2, NM_033200.2 [Q9BU23-1]
XP_005262012.1, XM_005261955.3 [Q9BU23-2]
UniGeneiHs.150540

Genome annotation databases

EnsembliENST00000216080; ENSP00000216080; ENSG00000100258 [Q9BU23-2]
ENST00000474879; ENSP00000424381; ENSG00000100258 [Q9BU23-1]
GeneIDi91289
KEGGihsa:91289
UCSCiuc003blo.3 human [Q9BU23-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiLMF2_HUMAN
AccessioniPrimary (citable) accession number: Q9BU23
Secondary accession number(s): A6NEZ0
, Q13392, Q6ZNR2, Q8WU74, Q96C62
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 18, 2008
Last sequence update: March 1, 2004
Last modified: June 20, 2018
This is version 131 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health