Q9BU23 (LMF2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 88.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Lipase maturation factor 2 Alternative name(s): Transmembrane protein 112B Transmembrane protein 153 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 707 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Involved in the maturation of specific proteins in the endoplasmic reticulum. May be required for maturation and transport of active lipoprotein lipase (LPL) through the secretory pathway By similarity. |
| Subcellular location | Endoplasmic reticulum membrane; Multi-pass membrane protein By similarity. |
| Sequence similarities | Belongs to the lipase maturation factor family. |
| Sequence caution | The sequence AAB03346.1 differs from that shown. Reason: Erroneous gene model prediction. The sequence BAC85437.1 differs from that shown. Reason: Chimeric cDNA. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Endoplasmic reticulum Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| PTM | Glycoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Cellular_component | endoplasmic reticulum membrane Inferred from electronic annotation. Source: UniProtKB-SubCell integral to membraneInferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BU23-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BU23-2) The sequence of this isoform differs from the canonical sequence as follows: 1-31: MAGSRLPRQLFLQGVAAVFMFAFASLYTQIP → MTCPPT | ||||||
| Isoform 3 (identifier: Q9BU23-3) The sequence of this isoform differs from the canonical sequence as follows: 392-504: Missing. | ||||||
| Note: No experimental confirmation available. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 707 | 707 | Lipase maturation factor 2 | PRO_0000324510 | |||||
Regions | |||||||||
| Transmembrane | 10 – 30 | 21 | Helical; Potential | ||||||
| Transmembrane | 78 – 98 | 21 | Helical; Potential | ||||||
| Transmembrane | 102 – 122 | 21 | Helical; Potential | ||||||
| Transmembrane | 123 – 143 | 21 | Helical; Potential | ||||||
| Transmembrane | 165 – 185 | 21 | Helical; Potential | ||||||
| Transmembrane | 227 – 247 | 21 | Helical; Potential | ||||||
| Transmembrane | 259 – 279 | 21 | Helical; Potential | ||||||
| Transmembrane | 310 – 330 | 21 | Helical; Potential | ||||||
| Transmembrane | 364 – 384 | 21 | Helical; Potential | ||||||
| Transmembrane | 399 – 419 | 21 | Helical; Potential | ||||||
| Transmembrane | 637 – 657 | 21 | Helical; Potential | ||||||
Amino acid modifications | |||||||||
| Glycosylation | 489 | 1 | N-linked (GlcNAc...) Potential | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 31 | 31 | MAGSR…YTQIP → MTCPPT in isoform 2. | VSP_032254 | |||||
| Alternative sequence | 392 – 504 | 113 | Missing in isoform 3. | VSP_032255 | |||||
| Natural variant | 68 | 1 | P → L in a breast cancer sample; somatic mutation. Ref.7 | VAR_039803 | |||||
| Natural variant | 479 | 1 | T → M. Corresponds to variant rs8136495 [ dbSNP | Ensembl ]. | VAR_039804 | |||||
Experimental info | |||||||||
| Sequence conflict | 571 | 1 | E → G in BAC85437. Ref.4 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | CR456605 mRNA. Translation: CAG30491.1. U62317 Genomic DNA. Translation: AAB03346.1. Sequence problems. BC002942 mRNA. Translation: AAH02942.2. BC014652 mRNA. Translation: AAH14652.1. BC021143 mRNA. Translation: AAH21143.1. AK130818 mRNA. Translation: BAC85437.1. Sequence problems. |
| IPI | IPI00385495. IPI00852693. IPI00854764. |
| RefSeq | NP_149977.2. NM_033200.2. |
| UniGene | Hs.150540. |
3D structure databases | |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000216080. |
PTM databases | |
| PhosphoSite | Q9BU23. |
Polymorphism databases | |
| DMDM | 74733167. |
Proteomic databases | |
| PaxDb | Q9BU23. |
| PRIDE | Q9BU23. |
Protocols and materials databases | |
| DNASU | 91289. |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000216080; ENSP00000216080; ENSG00000100258. ENST00000380796; ENSP00000370173; ENSG00000100258. ENST00000474879; ENSP00000424381; ENSG00000100258. |
| GeneID | 91289. |
| KEGG | hsa:91289. |
| UCSC | uc003blo.2. human. uc003blp.2. human. |
Organism-specific databases | |
| CTD | 91289. |
| GeneCards | GC22M050941. |
| H-InvDB | HIX0016614. |
| HGNC | HGNC:25096. LMF2. |
| neXtProt | NX_Q9BU23. |
| PharmGKB | PA162394144. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | NOG81106. |
| HOGENOM | HOG000019333. |
| HOVERGEN | HBG108090. |
| InParanoid | Q9BU23. |
| OrthoDB | EOG4W6NVR. |
Gene expression databases | |
| Bgee | Q9BU23. |
| CleanEx | HS_LMF2. |
| Genevestigator | Q9BU23. |
Family and domain databases | |
| InterPro | IPR009613. LMF. [Graphical view] |
| Pfam | PF06762. LMF1. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| ChiTaRS | LMF2. human. |
| GenomeRNAi | 91289. |
| NextBio | 77159. |
Entry information
| Entry name | LMF2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BU23 Secondary accession number(s): A6NEZ0 Q96C62 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 22 Human chromosome 22: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| SIMILARITY comments Index of protein domains and families |

Clusters with
