Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc finger protein 692

Gene

ZNF692

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

May be involved in transcriptional regulation.

Regions

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri328 – 353C2H2-type 1PROSITE-ProRule annotationAdd BLAST26
Zinc fingeri359 – 383C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri389 – 411C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri417 – 439C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri448 – 471C2H2-type 5PROSITE-ProRule annotationAdd BLAST24

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Transcription, Transcription regulation

Keywords - Ligandi

DNA-binding, Metal-binding, Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000171163-MONOMER.
ReactomeiR-HSA-212436. Generic Transcription Pathway.
SIGNORiQ9BU19.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc finger protein 692
Gene namesi
Name:ZNF692
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 1

Organism-specific databases

HGNCiHGNC:26049. ZNF692.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

OpenTargetsiENSG00000171163.
PharmGKBiPA142670491.

Polymorphism and mutation databases

BioMutaiZNF692.
DMDMi74761262.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002340141 – 519Zinc finger protein 692Add BLAST519

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei162PhosphoserineCombined sources1
Modified residuei231PhosphoserineCombined sources1

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9BU19.
PaxDbiQ9BU19.
PeptideAtlasiQ9BU19.
PRIDEiQ9BU19.
TopDownProteomicsiQ9BU19-3. [Q9BU19-3]

PTM databases

iPTMnetiQ9BU19.
PhosphoSitePlusiQ9BU19.

Expressioni

Gene expression databases

BgeeiENSG00000171163.
CleanExiHS_ZNF692.
ExpressionAtlasiQ9BU19. baseline and differential.
GenevisibleiQ9BU19. HS.

Organism-specific databases

HPAiHPA059337.

Interactioni

Protein-protein interaction databases

BioGridi120789. 28 interactors.
IntActiQ9BU19. 1 interactor.
STRINGi9606.ENSP00000391200.

Structurei

Secondary structure

1519
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Turni333 – 335Combined sources3
Beta strandi338 – 341Combined sources4
Helixi342 – 351Combined sources10
Helixi352 – 354Combined sources3
Turni364 – 366Combined sources3
Beta strandi369 – 372Combined sources4
Helixi373 – 384Combined sources12
Beta strandi420 – 422Combined sources3
Beta strandi425 – 428Combined sources4
Helixi429 – 442Combined sources14
Turni443 – 445Combined sources3
Turni451 – 453Combined sources3
Beta strandi456 – 459Combined sources4
Helixi460 – 469Combined sources10
Turni472 – 474Combined sources3
Beta strandi479 – 481Combined sources3

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D9HNMR-A417-481[»]
2DLKNMR-A328-393[»]
ProteinModelPortaliQ9BU19.
SMRiQ9BU19.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9BU19.

Family & Domainsi

Sequence similaritiesi

Contains 5 C2H2-type zinc fingers.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Zinc fingeri328 – 353C2H2-type 1PROSITE-ProRule annotationAdd BLAST26
Zinc fingeri359 – 383C2H2-type 2PROSITE-ProRule annotationAdd BLAST25
Zinc fingeri389 – 411C2H2-type 3PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri417 – 439C2H2-type 4PROSITE-ProRule annotationAdd BLAST23
Zinc fingeri448 – 471C2H2-type 5PROSITE-ProRule annotationAdd BLAST24

Keywords - Domaini

Repeat, Zinc-finger

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00530000063153.
HOGENOMiHOG000039991.
HOVERGENiHBG057936.
InParanoidiQ9BU19.
OMAiDASLWTY.
OrthoDBiEOG091G03R1.
PhylomeDBiQ9BU19.
TreeFamiTF332664.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 5 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 5 hits.
[Graphical view]

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BU19-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MASSPAVDVS CRRREKRRQL DARRSKCRIR LGGHMEQWCL LKERLGFSLH
60 70 80 90 100
SQLAKFLLDR YTSSGCVLCA GPEPLPPKGL QYLVLLSHAH SRECSLVPGL
110 120 130 140 150
RGPGGQDGGL VWECSAGHTF SWGPSLSPTP SEAPKPASLP HTTRRSWCSE
160 170 180 190 200
ATSGQELADL ESEHDERTQE ARLPRRVGPP PETFPPPGEE EGEEEEDNDE
210 220 230 240 250
DEEEMLSDAS LWTYSSSPDD SEPDAPRLLP SPVTCTPKEG ETPPAPAALS
260 270 280 290 300
SPLAVPALSA SSLSSRAPPP AEVRVQPQLS RTPQAAQQTE ALASTGSQAQ
310 320 330 340 350
SAPTPAWDED TAQIGPKRIR KAAKRELMPC DFPGCGRIFS NRQYLNHHKK
360 370 380 390 400
YQHIHQKSFS CPEPACGKSF NFKKHLKEHM KLHSDTRDYI CEFCARSFRT
410 420 430 440 450
SSNLVIHRRI HTGEKPLQCE ICGFTCRQKA SLNWHQRKHA ETVAALRFPC
460 470 480 490 500
EFCGKRFEKP DSVAAHRSKS HPALLLAPQE SPSGPLEPCP SISAPGPLGS
510
SEGSRPSASP QAPTLLPQQ
Length:519
Mass (Da):56,968
Last modified:June 1, 2001 - v1
Checksum:iDEFAEF73C910619E
GO
Isoform 2 (identifier: Q9BU19-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     175-220: RRVGPPPETFPPPGEEEGEEEEDNDEDEEEMLSDASLWTYSSSPDD → S

Note: No experimental confirmation available.
Show »
Length:474
Mass (Da):51,876
Checksum:iD550C5B21F03C12F
GO
Isoform 3 (identifier: Q9BU19-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     88-259: Missing.

Show »
Length:347
Mass (Da):38,643
Checksum:i8C92016FCA82AAE3
GO
Isoform 4 (identifier: Q9BU19-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     61-96: YTSSGCVLCAGPEPLPPKGLQYLVLLSHAHSRECSL → ACPAALFHPQVSHFTRTACVTCGLRGSCSPPHGLSE
     97-519: Missing.

Note: No experimental confirmation available.
Show »
Length:96
Mass (Da):10,819
Checksum:i6D555AC70BA6CF00
GO
Isoform 5 (identifier: Q9BU19-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1: M → MPLVHM

Note: No experimental confirmation available.
Show »
Length:524
Mass (Da):57,546
Checksum:i5A64D0C5F805388F
GO

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti373K → R in BAA91490 (PubMed:14702039).Curated1
Sequence conflicti401S → G in BAA91239 (PubMed:14702039).Curated1
Sequence conflicti435H → R in BAA91490 (PubMed:14702039).Curated1

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_033590230P → R.1 PublicationCorresponds to variant rs13313088dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0430251M → MPLVHM in isoform 5. 1 Publication1
Alternative sequenceiVSP_01818561 – 96YTSSG…RECSL → ACPAALFHPQVSHFTRTACV TCGLRGSCSPPHGLSE in isoform 4. 1 PublicationAdd BLAST36
Alternative sequenceiVSP_01818688 – 259Missing in isoform 3. 1 PublicationAdd BLAST172
Alternative sequenceiVSP_01818797 – 519Missing in isoform 4. 1 PublicationAdd BLAST423
Alternative sequenceiVSP_018188175 – 220RRVGP…SSPDD → S in isoform 2. 1 PublicationAdd BLAST46

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000538 mRNA. Translation: BAA91239.1.
AK001070 mRNA. Translation: BAA91490.1.
AK302187 mRNA. Translation: BAG63552.1.
AL133100 mRNA. Translation: CAB61410.2.
AL672291 Genomic DNA. Translation: CAI18799.1.
AL672291 Genomic DNA. Translation: CAI18800.1.
AL672291 Genomic DNA. Translation: CAI18801.1.
BC002948 mRNA. Translation: AAH02948.1.
AF256175 Transcribed RNA. Translation: AAG15327.1.
CCDSiCCDS31127.1. [Q9BU19-1]
CCDS44348.1. [Q9BU19-5]
CCDS53487.1. [Q9BU19-2]
PIRiT42682.
RefSeqiNP_001129508.1. NM_001136036.2. [Q9BU19-5]
NP_001180257.1. NM_001193328.1. [Q9BU19-2]
NP_060335.2. NM_017865.3. [Q9BU19-1]
XP_011542524.1. XM_011544222.1. [Q9BU19-1]
UniGeneiHs.377705.

Genome annotation databases

EnsembliENST00000306601; ENSP00000305483; ENSG00000171163. [Q9BU19-1]
ENST00000366471; ENSP00000355427; ENSG00000171163. [Q9BU19-2]
ENST00000451251; ENSP00000391200; ENSG00000171163. [Q9BU19-5]
ENST00000463519; ENSP00000436308; ENSG00000171163. [Q9BU19-4]
GeneIDi55657.
KEGGihsa:55657.
UCSCiuc001ifc.3. human. [Q9BU19-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK000538 mRNA. Translation: BAA91239.1.
AK001070 mRNA. Translation: BAA91490.1.
AK302187 mRNA. Translation: BAG63552.1.
AL133100 mRNA. Translation: CAB61410.2.
AL672291 Genomic DNA. Translation: CAI18799.1.
AL672291 Genomic DNA. Translation: CAI18800.1.
AL672291 Genomic DNA. Translation: CAI18801.1.
BC002948 mRNA. Translation: AAH02948.1.
AF256175 Transcribed RNA. Translation: AAG15327.1.
CCDSiCCDS31127.1. [Q9BU19-1]
CCDS44348.1. [Q9BU19-5]
CCDS53487.1. [Q9BU19-2]
PIRiT42682.
RefSeqiNP_001129508.1. NM_001136036.2. [Q9BU19-5]
NP_001180257.1. NM_001193328.1. [Q9BU19-2]
NP_060335.2. NM_017865.3. [Q9BU19-1]
XP_011542524.1. XM_011544222.1. [Q9BU19-1]
UniGeneiHs.377705.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2D9HNMR-A417-481[»]
2DLKNMR-A328-393[»]
ProteinModelPortaliQ9BU19.
SMRiQ9BU19.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120789. 28 interactors.
IntActiQ9BU19. 1 interactor.
STRINGi9606.ENSP00000391200.

PTM databases

iPTMnetiQ9BU19.
PhosphoSitePlusiQ9BU19.

Polymorphism and mutation databases

BioMutaiZNF692.
DMDMi74761262.

Proteomic databases

MaxQBiQ9BU19.
PaxDbiQ9BU19.
PeptideAtlasiQ9BU19.
PRIDEiQ9BU19.
TopDownProteomicsiQ9BU19-3. [Q9BU19-3]

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306601; ENSP00000305483; ENSG00000171163. [Q9BU19-1]
ENST00000366471; ENSP00000355427; ENSG00000171163. [Q9BU19-2]
ENST00000451251; ENSP00000391200; ENSG00000171163. [Q9BU19-5]
ENST00000463519; ENSP00000436308; ENSG00000171163. [Q9BU19-4]
GeneIDi55657.
KEGGihsa:55657.
UCSCiuc001ifc.3. human. [Q9BU19-1]

Organism-specific databases

CTDi55657.
GeneCardsiZNF692.
HGNCiHGNC:26049. ZNF692.
HPAiHPA059337.
neXtProtiNX_Q9BU19.
OpenTargetsiENSG00000171163.
PharmGKBiPA142670491.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1721. Eukaryota.
COG5048. LUCA.
GeneTreeiENSGT00530000063153.
HOGENOMiHOG000039991.
HOVERGENiHBG057936.
InParanoidiQ9BU19.
OMAiDASLWTY.
OrthoDBiEOG091G03R1.
PhylomeDBiQ9BU19.
TreeFamiTF332664.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000171163-MONOMER.
ReactomeiR-HSA-212436. Generic Transcription Pathway.
SIGNORiQ9BU19.

Miscellaneous databases

ChiTaRSiZNF692. human.
EvolutionaryTraceiQ9BU19.
GenomeRNAii55657.
PROiQ9BU19.

Gene expression databases

BgeeiENSG00000171163.
CleanExiHS_ZNF692.
ExpressionAtlasiQ9BU19. baseline and differential.
GenevisibleiQ9BU19. HS.

Family and domain databases

Gene3Di3.30.160.60. 4 hits.
InterProiIPR007087. Znf_C2H2.
IPR015880. Znf_C2H2-like.
IPR013087. Znf_C2H2/integrase_DNA-bd.
[Graphical view]
SMARTiSM00355. ZnF_C2H2. 5 hits.
[Graphical view]
PROSITEiPS00028. ZINC_FINGER_C2H2_1. 5 hits.
PS50157. ZINC_FINGER_C2H2_2. 5 hits.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiZN692_HUMAN
AccessioniPrimary (citable) accession number: Q9BU19
Secondary accession number(s): B4DXZ0
, Q5SRA5, Q5SRA6, Q9HBC9, Q9NW93, Q9NWY6, Q9UF97
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: June 1, 2001
Last modified: November 30, 2016
This is version 132 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.