Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BTX1

- NDC1_HUMAN

UniProt

Q9BTX1 - NDC1_HUMAN

Protein

Nucleoporin NDC1

Gene

NDC1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 99 (01 Oct 2014)
      Sequence version 2 (16 May 2006)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. Required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane.2 Publications

    GO - Molecular functioni

    1. structural constituent of nuclear pore Source: UniProtKB

    GO - Biological processi

    1. mRNA transport Source: UniProtKB-KW
    2. nuclear pore complex assembly Source: UniProtKB
    3. nuclear pore distribution Source: UniProtKB
    4. protein transport Source: UniProtKB

    Keywords - Biological processi

    mRNA transport, Protein transport, Translocation, Transport

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Nucleoporin NDC1
    Short name:
    hNDC1
    Alternative name(s):
    Transmembrane protein 48
    Gene namesi
    Name:NDC1
    Synonyms:TMEM48
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 1

    Organism-specific databases

    HGNCiHGNC:25525. NDC1.

    Subcellular locationi

    Nucleusnuclear pore complex. Nucleus membrane; Multi-pass membrane protein
    Note: Central core structure of the nuclear pore complex.

    GO - Cellular componenti

    1. membrane Source: UniProtKB
    2. nuclear membrane Source: UniProtKB-SubCell
    3. nuclear pore Source: UniProtKB

    Keywords - Cellular componenti

    Membrane, Nuclear pore complex, Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142670764.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 674674Nucleoporin NDC1PRO_0000235240Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei406 – 4061Phosphoserine4 Publications
    Modified residuei414 – 4141Phosphothreonine2 Publications
    Modified residuei439 – 4391Phosphoserine2 Publications
    Modified residuei440 – 4401Phosphothreonine2 Publications
    Modified residuei445 – 4451Phosphoserine3 Publications
    Modified residuei449 – 4491Phosphothreonine2 Publications
    Modified residuei471 – 4711Phosphoserine3 Publications
    Modified residuei474 – 4741Phosphoserine3 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9BTX1.
    PaxDbiQ9BTX1.
    PRIDEiQ9BTX1.

    PTM databases

    PhosphoSiteiQ9BTX1.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9BTX1.
    BgeeiQ9BTX1.
    CleanExiHS_TMEM48.
    GenevestigatoriQ9BTX1.

    Interactioni

    Subunit structurei

    Interacts with the NUP35/NUP53 By similarity. Interacts with AAAS, anchoring it to the nuclear envelope.By similarity1 Publication

    Protein-protein interaction databases

    BioGridi120831. 2 interactions.
    IntActiQ9BTX1. 1 interaction.
    STRINGi9606.ENSP00000360483.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BTX1.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 2424CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini46 – 6823Perinuclear spaceSequence AnalysisAdd
    BLAST
    Topological domaini90 – 11425CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini136 – 16530Perinuclear spaceSequence AnalysisAdd
    BLAST
    Topological domaini187 – 22539CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini247 – 27226Perinuclear spaceSequence AnalysisAdd
    BLAST
    Topological domaini294 – 674381CytoplasmicSequence AnalysisAdd
    BLAST

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei25 – 4521Helical; Name=1Sequence AnalysisAdd
    BLAST
    Transmembranei69 – 8921Helical; Name=2Sequence AnalysisAdd
    BLAST
    Transmembranei115 – 13521Helical; Name=3Sequence AnalysisAdd
    BLAST
    Transmembranei166 – 18621Helical; Name=4Sequence AnalysisAdd
    BLAST
    Transmembranei226 – 24621Helical; Name=5Sequence AnalysisAdd
    BLAST
    Transmembranei273 – 29321Helical; Name=6Sequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Belongs to the NDC1 family.Curated

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiNOG298560.
    HOGENOMiHOG000231135.
    HOVERGENiHBG080133.
    InParanoidiQ9BTX1.
    KOiK14315.
    OMAiDECLPKV.
    OrthoDBiEOG7XH6PF.
    PhylomeDBiQ9BTX1.
    TreeFamiTF324843.

    Family and domain databases

    InterProiIPR019049. Nucleoporin_prot_Ndc1/Nup.
    [Graphical view]
    PfamiPF09531. Ndc1_Nup. 1 hit.
    [Graphical view]

    Sequences (6)i

    Sequence statusi: Complete.

    This entry describes 6 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BTX1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MATAVSRPCA GRSRDILWRV LGWRIVASIV WSVLFLPICT TVFIIFSRID    50
    LFHPIQWLSD SFSDLYSSYV IFYFLLLSVV IIIISIFNVE FYAVVPSIPC 100
    SRLALIGKII HPQQLMHSFI HAAMGMVMAW CAAVITQGQY SFLVVPCTGT 150
    NSFGSPAAQT CLNEYHLFFL LTGAFMGYSY SLLYFVNNMN YLPFPIIQQY 200
    KFLRFRRSLL LLVKHSCVES LFLVRNFCIL YYFLGYIPKA WISTAMNLHI 250
    DEQVHRPLDT VSGLLNLSLL YHVWLCGVFL LTTWYVSWIL FKIYATEAHV 300
    FPVQPPFAEG SDECLPKVLN SNPPPIIKYL ALQDLMLLSQ YSPSRRQEVF 350
    SLSQPGGHPH NWTAISRECL NLLNGMTQKL ILYQEAAATN GRVSSSYPVE 400
    PKKLNSPEET AFQTPKSSQM PRPSVPPLVK TSLFSSKLST PDVVSPFGTP 450
    FGSSVMNRMA GIFDVNTCYG SPQSPQLIRR GPRLWTSASD QQMTEFSNPS 500
    PSTSISAEGK TMRQPSVIYS WIQNKREQIK NFLSKRVLIM YFFSKHPEAS 550
    IQAVFSDAQM HIWALEGLSH LVAASFTEDR FGVVQTTLPA ILNTLLTLQE 600
    AVDKYFKLPH ASSKPPRISG SLVDTSYKTL RFAFRASLKT AIYRITTTFG 650
    EHLNAVQASA EHQKRLQQFL EFKE 674
    Length:674
    Mass (Da):76,305
    Last modified:May 16, 2006 - v2
    Checksum:i78368FEB232895D9
    GO
    Isoform 2 (identifier: Q9BTX1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         93-93: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:673
    Mass (Da):76,234
    Checksum:i27A688260C1B2852
    GO
    Isoform 3 (identifier: Q9BTX1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         376-492: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:557
    Mass (Da):63,572
    Checksum:iC9AC3DCCCF3D5EBE
    GO
    Isoform 4 (identifier: Q9BTX1-4) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         509-542: GKTMRQPSVIYSWIQNKREQIKNFLSKRVLIMYF → APRGLHSGCFFRCPNAYLGIRRSVALSSSIIYRG
         543-674: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:542
    Mass (Da):61,009
    Checksum:i06630F6E487BAC55
    GO
    Isoform 5 (identifier: Q9BTX1-5) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         95-135: VPSIPCSRLALIGKIIHPQQLMHSFIHAAMGMVMAWCAAVI → I

    Note: No experimental confirmation available.

    Show »
    Length:634
    Mass (Da):71,992
    Checksum:iF80C5BBAFEF9C41F
    GO
    Isoform 6 (identifier: Q9BTX1-6) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         1-115: Missing.

    Note: No experimental confirmation available.

    Show »
    Length:559
    Mass (Da):63,158
    Checksum:iB2DD7D9EE6AF56EA
    GO

    Sequence cautioni

    The sequence BAB14135.1 differs from that shown. Reason: Erroneous initiation.
    The sequence BAC03665.1 differs from that shown. Reason: Erroneous initiation.

    Experimental Info

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Sequence conflicti261 – 2611V → A in BAG58064. (PubMed:14702039)Curated
    Sequence conflicti476 – 4761Q → R in BAG58064. (PubMed:14702039)Curated
    Sequence conflicti525 – 5251K → R in BAG61017. (PubMed:14702039)Curated

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti154 – 1541G → D.2 Publications
    Corresponds to variant rs17849721 [ dbSNP | Ensembl ].
    VAR_026388

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei1 – 115115Missing in isoform 6. 1 PublicationVSP_055331Add
    BLAST
    Alternative sequencei93 – 931Missing in isoform 2. 1 PublicationVSP_018396
    Alternative sequencei95 – 13541VPSIP…CAAVI → I in isoform 5. 1 PublicationVSP_055332Add
    BLAST
    Alternative sequencei376 – 492117Missing in isoform 3. 1 PublicationVSP_018397Add
    BLAST
    Alternative sequencei509 – 54234GKTMR…LIMYF → APRGLHSGCFFRCPNAYLGI RRSVALSSSIIYRG in isoform 4. CuratedVSP_018398Add
    BLAST
    Alternative sequencei543 – 674132Missing in isoform 4. CuratedVSP_018399Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ141696 mRNA. Translation: AAZ73087.1.
    AK001269 mRNA. Translation: BAA91592.1.
    AK022618 mRNA. Translation: BAB14135.1. Different initiation.
    AK091439 mRNA. Translation: BAC03665.1. Different initiation.
    AK298909 mRNA. Translation: BAG61017.1.
    AK295000 mRNA. Translation: BAG58064.1.
    AL354612 mRNA. Translation: CAB89725.1.
    AL354613 mRNA. Translation: CAB89726.1.
    AL049745 Genomic DNA. Translation: CAI22180.1.
    CH471059 Genomic DNA. Translation: EAX06731.1.
    BC003082 mRNA. Translation: AAH03082.1.
    CCDSiCCDS583.1. [Q9BTX1-1]
    RefSeqiNP_001162023.1. NM_001168551.1.
    NP_060557.3. NM_018087.4. [Q9BTX1-1]
    UniGeneiHs.476525.

    Genome annotation databases

    EnsembliENST00000371429; ENSP00000360483; ENSG00000058804. [Q9BTX1-1]
    GeneIDi55706.
    KEGGihsa:55706.
    UCSCiuc001cvs.3. human. [Q9BTX1-1]

    Polymorphism databases

    DMDMi97180263.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    DQ141696 mRNA. Translation: AAZ73087.1 .
    AK001269 mRNA. Translation: BAA91592.1 .
    AK022618 mRNA. Translation: BAB14135.1 . Different initiation.
    AK091439 mRNA. Translation: BAC03665.1 . Different initiation.
    AK298909 mRNA. Translation: BAG61017.1 .
    AK295000 mRNA. Translation: BAG58064.1 .
    AL354612 mRNA. Translation: CAB89725.1 .
    AL354613 mRNA. Translation: CAB89726.1 .
    AL049745 Genomic DNA. Translation: CAI22180.1 .
    CH471059 Genomic DNA. Translation: EAX06731.1 .
    BC003082 mRNA. Translation: AAH03082.1 .
    CCDSi CCDS583.1. [Q9BTX1-1 ]
    RefSeqi NP_001162023.1. NM_001168551.1.
    NP_060557.3. NM_018087.4. [Q9BTX1-1 ]
    UniGenei Hs.476525.

    3D structure databases

    ProteinModelPortali Q9BTX1.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 120831. 2 interactions.
    IntActi Q9BTX1. 1 interaction.
    STRINGi 9606.ENSP00000360483.

    PTM databases

    PhosphoSitei Q9BTX1.

    Polymorphism databases

    DMDMi 97180263.

    Proteomic databases

    MaxQBi Q9BTX1.
    PaxDbi Q9BTX1.
    PRIDEi Q9BTX1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000371429 ; ENSP00000360483 ; ENSG00000058804 . [Q9BTX1-1 ]
    GeneIDi 55706.
    KEGGi hsa:55706.
    UCSCi uc001cvs.3. human. [Q9BTX1-1 ]

    Organism-specific databases

    CTDi 55706.
    GeneCardsi GC01M054232.
    H-InvDB HIX0000603.
    HGNCi HGNC:25525. NDC1.
    MIMi 610115. gene.
    neXtProti NX_Q9BTX1.
    PharmGKBi PA142670764.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG298560.
    HOGENOMi HOG000231135.
    HOVERGENi HBG080133.
    InParanoidi Q9BTX1.
    KOi K14315.
    OMAi DECLPKV.
    OrthoDBi EOG7XH6PF.
    PhylomeDBi Q9BTX1.
    TreeFami TF324843.

    Miscellaneous databases

    ChiTaRSi TMEM48. human.
    GeneWikii TMEM48.
    GenomeRNAii 55706.
    NextBioi 35474194.
    PROi Q9BTX1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BTX1.
    Bgeei Q9BTX1.
    CleanExi HS_TMEM48.
    Genevestigatori Q9BTX1.

    Family and domain databases

    InterProi IPR019049. Nucleoporin_prot_Ndc1/Nup.
    [Graphical view ]
    Pfami PF09531. Ndc1_Nup. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "NDC1: a crucial membrane-integral nucleoporin of metazoan nuclear pore complexes."
      Stavru F., Hulsmann B.B., Spang A., Hartmann E., Cordes V.C., Gorlich D.
      J. Cell Biol. 173:509-519(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ASP-154, FUNCTION, SUBCELLULAR LOCATION, MISCELLANEOUS.
    2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 5 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 225-674 (ISOFORM 3).
      Tissue: Brain and Teratocarcinoma.
    3. Rhodes S., Huckle E.
      Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    4. "The DNA sequence and biological annotation of human chromosome 1."
      Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
      , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
      Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASP-154.
      Tissue: Brain.
    7. "Nuclear membrane proteins with potential disease links found by subtractive proteomics."
      Schirmer E.C., Florens L., Guan T., Yates J.R. III, Gerace L.
      Science 301:1380-1382(2003) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.
    8. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
      Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
      Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-406, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    9. "The conserved transmembrane nucleoporin NDC1 is required for nuclear pore complex assembly in vertebrate cells."
      Mansfeld J., Guettinger S., Hawryluk-Gara L.A., Pante N., Mall M., Galy V., Haselmann U., Muehlhaeusser P., Wozniak R.W., Mattaj I.W., Kutay U., Antonin W.
      Mol. Cell 22:93-103(2006) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, SUBCELLULAR LOCATION, TOPOLOGY, PHOSPHORYLATION.
    10. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-406, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-439; THR-440; SER-445; THR-449; SER-471 AND SER-474, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    12. "The nuclear pore complex protein ALADIN is anchored via NDC1 but not via POM121 and GP210 in the nuclear envelope."
      Kind B., Koehler K., Lorenz M., Huebner A.
      Biochem. Biophys. Res. Commun. 390:205-210(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBCELLULAR LOCATION, INTERACTION WITH AAAS.
    13. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-406; THR-414; SER-445; SER-471 AND SER-474, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiNDC1_HUMAN
    AccessioniPrimary (citable) accession number: Q9BTX1
    Secondary accession number(s): B4DHA3
    , B4DQQ5, G3XA81, Q8NB76, Q9H9T6, Q9NSG3, Q9NSG4, Q9NVZ7
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: May 16, 2006
    Last sequence update: May 16, 2006
    Last modified: October 1, 2014
    This is version 99 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Miscellaneous

    Depletion of NDC1 from HeLa cells interferes with the assembly of phenylalanine-glycine (FG) repeat Nups into nuclear pore complexes.

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 1
      Human chromosome 1: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3