Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BTX1

- NDC1_HUMAN

UniProt

Q9BTX1 - NDC1_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Nucleoporin NDC1

Gene

NDC1

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 5 out of 5- Experimental evidence at protein leveli

Functioni

Component of the nuclear pore complex (NPC), which plays a key role in de novo assembly and insertion of NPC in the nuclear envelope. Required for NPC and nuclear envelope assembly, possibly by forming a link between the nuclear envelope membrane and soluble nucleoporins, thereby anchoring the NPC in the membrane.2 Publications

GO - Molecular functioni

  1. structural constituent of nuclear pore Source: UniProtKB

GO - Biological processi

  1. mRNA transport Source: UniProtKB-KW
  2. nuclear pore complex assembly Source: UniProtKB
  3. nuclear pore distribution Source: UniProtKB
  4. protein transport Source: UniProtKB
  5. spermatogenesis Source: Ensembl
  6. synapsis Source: Ensembl
Complete GO annotation...

Keywords - Biological processi

mRNA transport, Protein transport, Translocation, Transport

Names & Taxonomyi

Protein namesi
Recommended name:
Nucleoporin NDC1
Short name:
hNDC1
Alternative name(s):
Transmembrane protein 48
Gene namesi
Name:NDC1
Synonyms:TMEM48
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 1

Organism-specific databases

HGNCiHGNC:25525. NDC1.

Subcellular locationi

Nucleusnuclear pore complex. Nucleus membrane; Multi-pass membrane protein
Note: Central core structure of the nuclear pore complex.

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 2424CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei25 – 4521Helical; Name=1Sequence AnalysisAdd
BLAST
Topological domaini46 – 6823Perinuclear spaceSequence AnalysisAdd
BLAST
Transmembranei69 – 8921Helical; Name=2Sequence AnalysisAdd
BLAST
Topological domaini90 – 11425CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei115 – 13521Helical; Name=3Sequence AnalysisAdd
BLAST
Topological domaini136 – 16530Perinuclear spaceSequence AnalysisAdd
BLAST
Transmembranei166 – 18621Helical; Name=4Sequence AnalysisAdd
BLAST
Topological domaini187 – 22539CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei226 – 24621Helical; Name=5Sequence AnalysisAdd
BLAST
Topological domaini247 – 27226Perinuclear spaceSequence AnalysisAdd
BLAST
Transmembranei273 – 29321Helical; Name=6Sequence AnalysisAdd
BLAST
Topological domaini294 – 674381CytoplasmicSequence AnalysisAdd
BLAST

GO - Cellular componenti

  1. cytoplasm Source: Ensembl
  2. membrane Source: UniProtKB
  3. nuclear pore Source: UniProtKB
Complete GO annotation...

Keywords - Cellular componenti

Membrane, Nuclear pore complex, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142670764.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 674674Nucleoporin NDC1PRO_0000235240Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei406 – 4061Phosphoserine3 Publications
Modified residuei414 – 4141Phosphothreonine1 Publication
Modified residuei439 – 4391Phosphoserine1 Publication
Modified residuei440 – 4401Phosphothreonine1 Publication
Modified residuei445 – 4451Phosphoserine2 Publications
Modified residuei449 – 4491Phosphothreonine1 Publication
Modified residuei471 – 4711Phosphoserine2 Publications
Modified residuei474 – 4741Phosphoserine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9BTX1.
PaxDbiQ9BTX1.
PRIDEiQ9BTX1.

PTM databases

PhosphoSiteiQ9BTX1.

Expressioni

Gene expression databases

BgeeiQ9BTX1.
CleanExiHS_TMEM48.
ExpressionAtlasiQ9BTX1. baseline and differential.
GenevestigatoriQ9BTX1.

Interactioni

Subunit structurei

Interacts with the NUP35/NUP53 (By similarity). Interacts with AAAS, anchoring it to the nuclear envelope.By similarity1 Publication

Protein-protein interaction databases

BioGridi120831. 9 interactions.
IntActiQ9BTX1. 1 interaction.
STRINGi9606.ENSP00000360483.

Structurei

3D structure databases

ProteinModelPortaliQ9BTX1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the NDC1 family.Curated

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiNOG298560.
GeneTreeiENSGT00390000014590.
HOGENOMiHOG000231135.
HOVERGENiHBG080133.
InParanoidiQ9BTX1.
KOiK14315.
OMAiDECLPKV.
OrthoDBiEOG7XH6PF.
PhylomeDBiQ9BTX1.
TreeFamiTF324843.

Family and domain databases

InterProiIPR019049. Nucleoporin_prot_Ndc1/Nup.
[Graphical view]
PfamiPF09531. Ndc1_Nup. 1 hit.
[Graphical view]

Sequences (6)i

Sequence statusi: Complete.

This entry describes 6 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BTX1-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MATAVSRPCA GRSRDILWRV LGWRIVASIV WSVLFLPICT TVFIIFSRID
60 70 80 90 100
LFHPIQWLSD SFSDLYSSYV IFYFLLLSVV IIIISIFNVE FYAVVPSIPC
110 120 130 140 150
SRLALIGKII HPQQLMHSFI HAAMGMVMAW CAAVITQGQY SFLVVPCTGT
160 170 180 190 200
NSFGSPAAQT CLNEYHLFFL LTGAFMGYSY SLLYFVNNMN YLPFPIIQQY
210 220 230 240 250
KFLRFRRSLL LLVKHSCVES LFLVRNFCIL YYFLGYIPKA WISTAMNLHI
260 270 280 290 300
DEQVHRPLDT VSGLLNLSLL YHVWLCGVFL LTTWYVSWIL FKIYATEAHV
310 320 330 340 350
FPVQPPFAEG SDECLPKVLN SNPPPIIKYL ALQDLMLLSQ YSPSRRQEVF
360 370 380 390 400
SLSQPGGHPH NWTAISRECL NLLNGMTQKL ILYQEAAATN GRVSSSYPVE
410 420 430 440 450
PKKLNSPEET AFQTPKSSQM PRPSVPPLVK TSLFSSKLST PDVVSPFGTP
460 470 480 490 500
FGSSVMNRMA GIFDVNTCYG SPQSPQLIRR GPRLWTSASD QQMTEFSNPS
510 520 530 540 550
PSTSISAEGK TMRQPSVIYS WIQNKREQIK NFLSKRVLIM YFFSKHPEAS
560 570 580 590 600
IQAVFSDAQM HIWALEGLSH LVAASFTEDR FGVVQTTLPA ILNTLLTLQE
610 620 630 640 650
AVDKYFKLPH ASSKPPRISG SLVDTSYKTL RFAFRASLKT AIYRITTTFG
660 670
EHLNAVQASA EHQKRLQQFL EFKE
Length:674
Mass (Da):76,305
Last modified:May 16, 2006 - v2
Checksum:i78368FEB232895D9
GO
Isoform 2 (identifier: Q9BTX1-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     93-93: Missing.

Note: No experimental confirmation available.

Show »
Length:673
Mass (Da):76,234
Checksum:i27A688260C1B2852
GO
Isoform 3 (identifier: Q9BTX1-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     376-492: Missing.

Note: No experimental confirmation available.

Show »
Length:557
Mass (Da):63,572
Checksum:iC9AC3DCCCF3D5EBE
GO
Isoform 4 (identifier: Q9BTX1-4) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     509-542: GKTMRQPSVIYSWIQNKREQIKNFLSKRVLIMYF → APRGLHSGCFFRCPNAYLGIRRSVALSSSIIYRG
     543-674: Missing.

Note: No experimental confirmation available.

Show »
Length:542
Mass (Da):61,009
Checksum:i06630F6E487BAC55
GO
Isoform 5 (identifier: Q9BTX1-5) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     95-135: VPSIPCSRLALIGKIIHPQQLMHSFIHAAMGMVMAWCAAVI → I

Note: No experimental confirmation available.

Show »
Length:634
Mass (Da):71,992
Checksum:iF80C5BBAFEF9C41F
GO
Isoform 6 (identifier: Q9BTX1-6) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-115: Missing.

Note: No experimental confirmation available.

Show »
Length:559
Mass (Da):63,158
Checksum:iB2DD7D9EE6AF56EA
GO

Sequence cautioni

The sequence BAB14135.1 differs from that shown. Reason: Erroneous initiation. Curated
The sequence BAC03665.1 differs from that shown. Reason: Erroneous initiation. Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti261 – 2611V → A in BAG58064. (PubMed:14702039)Curated
Sequence conflicti476 – 4761Q → R in BAG58064. (PubMed:14702039)Curated
Sequence conflicti525 – 5251K → R in BAG61017. (PubMed:14702039)Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti154 – 1541G → D.2 Publications
Corresponds to variant rs17849721 [ dbSNP | Ensembl ].
VAR_026388

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 115115Missing in isoform 6. 1 PublicationVSP_055331Add
BLAST
Alternative sequencei93 – 931Missing in isoform 2. 1 PublicationVSP_018396
Alternative sequencei95 – 13541VPSIP…CAAVI → I in isoform 5. 1 PublicationVSP_055332Add
BLAST
Alternative sequencei376 – 492117Missing in isoform 3. 1 PublicationVSP_018397Add
BLAST
Alternative sequencei509 – 54234GKTMR…LIMYF → APRGLHSGCFFRCPNAYLGI RRSVALSSSIIYRG in isoform 4. CuratedVSP_018398Add
BLAST
Alternative sequencei543 – 674132Missing in isoform 4. CuratedVSP_018399Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ141696 mRNA. Translation: AAZ73087.1.
AK001269 mRNA. Translation: BAA91592.1.
AK022618 mRNA. Translation: BAB14135.1. Different initiation.
AK091439 mRNA. Translation: BAC03665.1. Different initiation.
AK298909 mRNA. Translation: BAG61017.1.
AK295000 mRNA. Translation: BAG58064.1.
AL354612 mRNA. Translation: CAB89725.1.
AL354613 mRNA. Translation: CAB89726.1.
AL049745 Genomic DNA. Translation: CAI22180.1.
CH471059 Genomic DNA. Translation: EAX06731.1.
BC003082 mRNA. Translation: AAH03082.1.
CCDSiCCDS583.1. [Q9BTX1-1]
RefSeqiNP_001162023.1. NM_001168551.1. [Q9BTX1-5]
NP_060557.3. NM_018087.4. [Q9BTX1-1]
UniGeneiHs.476525.

Genome annotation databases

EnsembliENST00000371429; ENSP00000360483; ENSG00000058804. [Q9BTX1-1]
GeneIDi55706.
KEGGihsa:55706.
UCSCiuc001cvs.3. human. [Q9BTX1-1]

Polymorphism databases

DMDMi97180263.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
DQ141696 mRNA. Translation: AAZ73087.1 .
AK001269 mRNA. Translation: BAA91592.1 .
AK022618 mRNA. Translation: BAB14135.1 . Different initiation.
AK091439 mRNA. Translation: BAC03665.1 . Different initiation.
AK298909 mRNA. Translation: BAG61017.1 .
AK295000 mRNA. Translation: BAG58064.1 .
AL354612 mRNA. Translation: CAB89725.1 .
AL354613 mRNA. Translation: CAB89726.1 .
AL049745 Genomic DNA. Translation: CAI22180.1 .
CH471059 Genomic DNA. Translation: EAX06731.1 .
BC003082 mRNA. Translation: AAH03082.1 .
CCDSi CCDS583.1. [Q9BTX1-1 ]
RefSeqi NP_001162023.1. NM_001168551.1. [Q9BTX1-5 ]
NP_060557.3. NM_018087.4. [Q9BTX1-1 ]
UniGenei Hs.476525.

3D structure databases

ProteinModelPortali Q9BTX1.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 120831. 9 interactions.
IntActi Q9BTX1. 1 interaction.
STRINGi 9606.ENSP00000360483.

PTM databases

PhosphoSitei Q9BTX1.

Polymorphism databases

DMDMi 97180263.

Proteomic databases

MaxQBi Q9BTX1.
PaxDbi Q9BTX1.
PRIDEi Q9BTX1.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000371429 ; ENSP00000360483 ; ENSG00000058804 . [Q9BTX1-1 ]
GeneIDi 55706.
KEGGi hsa:55706.
UCSCi uc001cvs.3. human. [Q9BTX1-1 ]

Organism-specific databases

CTDi 55706.
GeneCardsi GC01M054232.
H-InvDB HIX0000603.
HGNCi HGNC:25525. NDC1.
MIMi 610115. gene.
neXtProti NX_Q9BTX1.
PharmGKBi PA142670764.
GenAtlasi Search...

Phylogenomic databases

eggNOGi NOG298560.
GeneTreei ENSGT00390000014590.
HOGENOMi HOG000231135.
HOVERGENi HBG080133.
InParanoidi Q9BTX1.
KOi K14315.
OMAi DECLPKV.
OrthoDBi EOG7XH6PF.
PhylomeDBi Q9BTX1.
TreeFami TF324843.

Miscellaneous databases

GeneWikii TMEM48.
GenomeRNAii 55706.
NextBioi 35474194.
PROi Q9BTX1.
SOURCEi Search...

Gene expression databases

Bgeei Q9BTX1.
CleanExi HS_TMEM48.
ExpressionAtlasi Q9BTX1. baseline and differential.
Genevestigatori Q9BTX1.

Family and domain databases

InterProi IPR019049. Nucleoporin_prot_Ndc1/Nup.
[Graphical view ]
Pfami PF09531. Ndc1_Nup. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "NDC1: a crucial membrane-integral nucleoporin of metazoan nuclear pore complexes."
    Stavru F., Hulsmann B.B., Spang A., Hartmann E., Cordes V.C., Gorlich D.
    J. Cell Biol. 173:509-519(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), VARIANT ASP-154, FUNCTION, SUBCELLULAR LOCATION, MISCELLANEOUS.
  2. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1; 5 AND 6), NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] OF 225-674 (ISOFORM 3).
    Tissue: Brain and Teratocarcinoma.
  3. Rhodes S., Huckle E.
    Submitted (APR-2000) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  4. "The DNA sequence and biological annotation of human chromosome 1."
    Gregory S.G., Barlow K.F., McLay K.E., Kaul R., Swarbreck D., Dunham A., Scott C.E., Howe K.L., Woodfine K., Spencer C.C.A., Jones M.C., Gillson C., Searle S., Zhou Y., Kokocinski F., McDonald L., Evans R., Phillips K.
    , Atkinson A., Cooper R., Jones C., Hall R.E., Andrews T.D., Lloyd C., Ainscough R., Almeida J.P., Ambrose K.D., Anderson F., Andrew R.W., Ashwell R.I.S., Aubin K., Babbage A.K., Bagguley C.L., Bailey J., Beasley H., Bethel G., Bird C.P., Bray-Allen S., Brown J.Y., Brown A.J., Buckley D., Burton J., Bye J., Carder C., Chapman J.C., Clark S.Y., Clarke G., Clee C., Cobley V., Collier R.E., Corby N., Coville G.J., Davies J., Deadman R., Dunn M., Earthrowl M., Ellington A.G., Errington H., Frankish A., Frankland J., French L., Garner P., Garnett J., Gay L., Ghori M.R.J., Gibson R., Gilby L.M., Gillett W., Glithero R.J., Grafham D.V., Griffiths C., Griffiths-Jones S., Grocock R., Hammond S., Harrison E.S.I., Hart E., Haugen E., Heath P.D., Holmes S., Holt K., Howden P.J., Hunt A.R., Hunt S.E., Hunter G., Isherwood J., James R., Johnson C., Johnson D., Joy A., Kay M., Kershaw J.K., Kibukawa M., Kimberley A.M., King A., Knights A.J., Lad H., Laird G., Lawlor S., Leongamornlert D.A., Lloyd D.M., Loveland J., Lovell J., Lush M.J., Lyne R., Martin S., Mashreghi-Mohammadi M., Matthews L., Matthews N.S.W., McLaren S., Milne S., Mistry S., Moore M.J.F., Nickerson T., O'Dell C.N., Oliver K., Palmeiri A., Palmer S.A., Parker A., Patel D., Pearce A.V., Peck A.I., Pelan S., Phelps K., Phillimore B.J., Plumb R., Rajan J., Raymond C., Rouse G., Saenphimmachak C., Sehra H.K., Sheridan E., Shownkeen R., Sims S., Skuce C.D., Smith M., Steward C., Subramanian S., Sycamore N., Tracey A., Tromans A., Van Helmond Z., Wall M., Wallis J.M., White S., Whitehead S.L., Wilkinson J.E., Willey D.L., Williams H., Wilming L., Wray P.W., Wu Z., Coulson A., Vaudin M., Sulston J.E., Durbin R.M., Hubbard T., Wooster R., Dunham I., Carter N.P., McVean G., Ross M.T., Harrow J., Olson M.V., Beck S., Rogers J., Bentley D.R.
    Nature 441:315-321(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  6. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1), VARIANT ASP-154.
    Tissue: Brain.
  7. "Nuclear membrane proteins with potential disease links found by subtractive proteomics."
    Schirmer E.C., Florens L., Guan T., Yates J.R. III, Gerace L.
    Science 301:1380-1382(2003) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY, SUBCELLULAR LOCATION.
  8. "Global, in vivo, and site-specific phosphorylation dynamics in signaling networks."
    Olsen J.V., Blagoev B., Gnad F., Macek B., Kumar C., Mortensen P., Mann M.
    Cell 127:635-648(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-406, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  9. "The conserved transmembrane nucleoporin NDC1 is required for nuclear pore complex assembly in vertebrate cells."
    Mansfeld J., Guettinger S., Hawryluk-Gara L.A., Pante N., Mall M., Galy V., Haselmann U., Muehlhaeusser P., Wozniak R.W., Mattaj I.W., Kutay U., Antonin W.
    Mol. Cell 22:93-103(2006) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, SUBCELLULAR LOCATION, TOPOLOGY, PHOSPHORYLATION.
  10. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-406, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  11. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-439; THR-440; SER-445; THR-449; SER-471 AND SER-474, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  12. "The nuclear pore complex protein ALADIN is anchored via NDC1 but not via POM121 and GP210 in the nuclear envelope."
    Kind B., Koehler K., Lorenz M., Huebner A.
    Biochem. Biophys. Res. Commun. 390:205-210(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBCELLULAR LOCATION, INTERACTION WITH AAAS.
  13. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  14. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-406; THR-414; SER-445; SER-471 AND SER-474, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiNDC1_HUMAN
AccessioniPrimary (citable) accession number: Q9BTX1
Secondary accession number(s): B4DHA3
, B4DQQ5, G3XA81, Q8NB76, Q9H9T6, Q9NSG3, Q9NSG4, Q9NVZ7
Entry historyi
Integrated into UniProtKB/Swiss-Prot: May 16, 2006
Last sequence update: May 16, 2006
Last modified: November 26, 2014
This is version 101 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Miscellaneous

Depletion of NDC1 from HeLa cells interferes with the assembly of phenylalanine-glycine (FG) repeat Nups into nuclear pore complexes.

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 1
    Human chromosome 1: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3