Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Tubulin-specific chaperone D

Gene

TBCD

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

Tubulin-folding protein; involved in the first step of the tubulin folding pathway. Modulates microtubule dynamics by capturing GTP-bound beta-tubulin (TUBB). Acts as a GTPase-activating protein (GAP) for ARL2. Its ability to interact with beta tubulin is regulated via its interaction with ARL2. Induces microtubule disruption in absence of ARL2. Increases degradation of beta tubulin, when overexpressed in polarized cells. Promotes epithelial cell detachment, a process antagonized by ARL2. Induces tight adherens and tight junctions disassembly at the lateral cell membrane.4 Publications

GO - Molecular functioni

  • beta-tubulin binding Source: UniProtKB
  • chaperone binding Source: ProtInc
  • GTPase activator activity Source: UniProtKB

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Chaperone, GTPase activation

Enzyme and pathway databases

ReactomeiR-HSA-389977. Post-chaperonin tubulin folding pathway.

Names & Taxonomyi

Protein namesi
Recommended name:
Tubulin-specific chaperone D
Alternative name(s):
Beta-tubulin cofactor D
Short name:
tfcD
SSD-1
Tubulin-folding cofactor D
Gene namesi
Name:TBCD
Synonyms:KIAA0988, SSD1, TFCD
ORF Names:PP1096
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 17

Organism-specific databases

HGNCiHGNC:11581. TBCD.

Subcellular locationi

GO - Cellular componenti

  • adherens junction Source: UniProtKB
  • bicellular tight junction Source: UniProtKB
  • cytoplasm Source: UniProtKB-SubCell
  • lateral plasma membrane Source: UniProtKB
  • microtubule Source: ProtInc
Complete GO annotation...

Keywords - Cellular componenti

Cell junction, Cell membrane, Cytoplasm, Membrane, Tight junction

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA36345.

Polymorphism and mutation databases

BioMutaiTBCD.
DMDMi296452924.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 11921192Tubulin-specific chaperone DPRO_0000080049Add
BLAST

Proteomic databases

EPDiQ9BTW9.
MaxQBiQ9BTW9.
PaxDbiQ9BTW9.
PeptideAtlasiQ9BTW9.
PRIDEiQ9BTW9.

PTM databases

iPTMnetiQ9BTW9.
PhosphoSiteiQ9BTW9.
SwissPalmiQ9BTW9.

Expressioni

Tissue specificityi

Ubiquitously expressed.2 Publications

Inductioni

Down-regulated by shear stress.1 Publication

Gene expression databases

BgeeiENSG00000141556.
ExpressionAtlasiQ9BTW9. baseline and differential.
GenevisibleiQ9BTW9. HS.

Organism-specific databases

HPAiHPA045200.

Interactioni

Subunit structurei

Found in a complex with at least ARL2, PPP2CB, PPP2R1A, PPP2R2A, PPP2R5E and TBCD. Interacts with PPP2CB. Interacts with ARL2 (By similarity). Supercomplex made of cofactors A to E. Cofactors A and D function by capturing and stabilizing tubulin in a quasi-native conformation. Cofactor E binds to the cofactor D-tubulin complex; interaction with cofactor C then causes the release of tubulin polypeptides that are committed to the native state. Interacts with ARL2; interaction is enhanced with the GDP-bound form of ARL2. Does not interact with ARL3, ARL4A and ARL4D. Interacts with beta tubulin.By similarity1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
ACDQ96AP02EBI-356005,EBI-717666

GO - Molecular functioni

  • beta-tubulin binding Source: UniProtKB
  • chaperone binding Source: ProtInc

Protein-protein interaction databases

BioGridi112767. 51 interactions.
IntActiQ9BTW9. 13 interactions.
MINTiMINT-1138609.
STRINGi9606.ENSP00000347719.

Structurei

3D structure databases

ProteinModelPortaliQ9BTW9.
SMRiQ9BTW9. Positions 354-430, 572-624, 845-883.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Repeati361 – 39939HEAT 1Add
BLAST
Repeati557 – 59438HEAT 2Add
BLAST
Repeati596 – 63237HEAT 3Add
BLAST

Sequence similaritiesi

Belongs to the TBCD family.Curated
Contains 3 HEAT repeats.Curated

Keywords - Domaini

Repeat

Phylogenomic databases

eggNOGiKOG1943. Eukaryota.
COG5234. LUCA.
GeneTreeiENSGT00390000017103.
HOVERGENiHBG053297.
InParanoidiQ9BTW9.
PhylomeDBiQ9BTW9.
TreeFamiTF105754.

Family and domain databases

Gene3Di1.25.10.10. 6 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR033162. TBCD.
IPR022577. Tubulin_specific_chaperoneD_C.
[Graphical view]
PANTHERiPTHR12658:SF0. PTHR12658:SF0. 1 hit.
PfamiPF12612. TFCD_C. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.

Sequences (5)i

Sequence statusi: Complete.

This entry describes 5 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BTW9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MALSDEPAAG GPEEEAEDET LAFGAALEAF GESAETRALL GRLREVHGGG
60 70 80 90 100
AEREVALERF RVIMDKYQEQ PHLLDPHLEW MMNLLLDIVQ DQTSPASLVH
110 120 130 140 150
LAFKFLYIIT KVRGYKTFLR LFPHEVADVE PVLDLVTIQN PKDHEAWETR
160 170 180 190 200
YMLLLWLSVT CLIPFDFSRL DGNLLTQPGQ ARMSIMDRIL QIAESYLIVS
210 220 230 240 250
DKARDAAAVL VSRFITRPDV KQSKMAEFLD WSLCNLARSS FQTMQGVITM
260 270 280 290 300
DGTLQALAQI FKHGKREDCL PYAATVLRCL DGCRLPESNQ TLLRKLGVKL
310 320 330 340 350
VQRLGLTFLK PKVAAWRYQR GCRSLAANLQ LLTQGQSEQK PLILTEDDDE
360 370 380 390 400
DDDVPEGVER VIEQLLVGLK DKDTVVRWSA AKGIGRMAGR LPRALADDVV
410 420 430 440 450
GSVLDCFSFQ ETDKAWHGGC LALAELGRRG LLLPSRLVDV VAVILKALTY
460 470 480 490 500
DEKRGACSVG TNVRDAACYV CWAFARAYEP QELKPFVTAI SSALVIAAVF
510 520 530 540 550
DRDINCRRAA SAAFQENVGR QGTFPHGIDI LTTADYFAVG NRSNCFLVIS
560 570 580 590 600
VFIAGFPEYT QPMIDHLVTM KISHWDGVIR ELAARALHNL AQQAPEFSAT
610 620 630 640 650
QVFPRLLSMT LSPDLHMRHG SILACAEVAY ALYKLAAQEN RPVTDHLDEQ
660 670 680 690 700
AVQGLKQIHQ QLYDRQLYRG LGGQLMRQAV CVLIEKLSLS KMPFRGDTVI
710 720 730 740 750
DGWQWLINDT LRHLHLISSH SRQQMKDAAV SALAALCSEY YMKEPGEADP
760 770 780 790 800
AIQEELITQY LAELRNPEEM TRCGFSLALG ALPGFLLKGR LQQVLTGLRA
810 820 830 840 850
VTHTSPEDVS FAESRRDGLK AIARICQTVG VKAGAPDEAV CGENVSQIYC
860 870 880 890 900
ALLGCMDDYT TDSRGDVGTW VRKAAMTSLM DLTLLLARSQ PELIEAHTCE
910 920 930 940 950
RIMCCVAQQA SEKIDRFRAH AASVFLTLLH FDSPPIPHVP HRGELEKLFP
960 970 980 990 1000
RSDVASVNWS APSQAFPRIT QLLGLPTYRY HVLLGLVVSL GGLTESTIRH
1010 1020 1030 1040 1050
STQSLFEYMK GIQSDPQALG SFSGTLLQIF EDNLLNERVS VPLLKTLDHV
1060 1070 1080 1090 1100
LTHGCFDIFT TEEDHPFAVK LLALCKKEIK NSKDIQKLLS GIAVFCEMVQ
1110 1120 1130 1140 1150
FPGDVRRQAL LQLCLLLCHR FPLIRKTTAS QVYETLLTYS DVVGADVLDE
1160 1170 1180 1190
VVTVLSDTAW DAELAVVREQ RNRLCDLLGV PRPQLVPQPG AC
Length:1,192
Mass (Da):132,600
Last modified:May 18, 2010 - v2
Checksum:iC46BE2048A5FEBC2
GO
Isoform 2 (identifier: Q9BTW9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-1008: Missing.

Note: No experimental confirmation available.
Show »
Length:184
Mass (Da):20,490
Checksum:i93591120628A7A54
GO
Isoform 3 (identifier: Q9BTW9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-546: Missing.
     547-549: LVI → MFN
     662-697: LYDRQLYRGLGGQLMRQAVCVLIEKLSLSKMPFRGD → PCICSWGLMSPESKAEFCVCVCRISLGRQCVHLSGL
     698-1192: Missing.

Show »
Length:151
Mass (Da):16,862
Checksum:i327EBC8C058A1F63
GO
Isoform 4 (identifier: Q9BTW9-4) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1094-1094: V → VDFPSATLVCVGTVQMYAHTHLRLGAPGPHCAHGSAMPR
     1182-1192: RPQLVPQPGAC → SPTWCPAWCLLKPVLEPIPHPCLVRMSCS

Note: No experimental confirmation available.
Show »
Length:1,248
Mass (Da):138,669
Checksum:iC4677BCAFB301E0A
GO
Isoform 5 (identifier: Q9BTW9-5) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     62-78: Missing.
     739-1156: Missing.

Note: No experimental confirmation available.
Show »
Length:757
Mass (Da):84,263
Checksum:i1EBCE9E996D5C8C8
GO

Sequence cautioni

The sequence AAH39654 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated
The sequence BAA76832 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti31 – 311G → S in CAA07022 (PubMed:11110777).Curated
Sequence conflicti472 – 4721W → C in BAA76832 (PubMed:10231032).Curated
Sequence conflicti799 – 8013RAV → GAL in CAA07022 (PubMed:11110777).Curated
Sequence conflicti985 – 9851G → R in CAA07022 (PubMed:11110777).Curated
Sequence conflicti1068 – 10681A → S in AAH12824 (PubMed:15489334).Curated
Sequence conflicti1075 – 10751C → V in CAA07022 (PubMed:11110777).Curated
Sequence conflicti1097 – 10971E → G in CAA07022 (PubMed:11110777).Curated
Sequence conflicti1097 – 10971E → G in BAA76832 (PubMed:10231032).Curated
Sequence conflicti1097 – 10971E → G in AAH03094 (PubMed:15489334).Curated

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti617 – 6171M → T.1 Publication
Corresponds to variant rs2292971 [ dbSNP | Ensembl ].
VAR_057264
Natural varianti923 – 9231S → N.
Corresponds to variant rs3214033 [ dbSNP | Ensembl ].
VAR_057265
Natural varianti943 – 9431G → V.
Corresponds to variant rs8072406 [ dbSNP | Ensembl ].
VAR_057266
Natural varianti1185 – 11851L → P.
Corresponds to variant rs2292969 [ dbSNP | Ensembl ].
VAR_057267

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei1 – 10081008Missing in isoform 2. 1 PublicationVSP_017210Add
BLAST
Alternative sequencei1 – 546546Missing in isoform 3. 1 PublicationVSP_017211Add
BLAST
Alternative sequencei62 – 7817Missing in isoform 5. 1 PublicationVSP_017212Add
BLAST
Alternative sequencei547 – 5493LVI → MFN in isoform 3. 1 PublicationVSP_017215
Alternative sequencei662 – 69736LYDRQ…PFRGD → PCICSWGLMSPESKAEFCVC VCRISLGRQCVHLSGL in isoform 3. 1 PublicationVSP_017213Add
BLAST
Alternative sequencei698 – 1192495Missing in isoform 3. 1 PublicationVSP_017214Add
BLAST
Alternative sequencei739 – 1156418Missing in isoform 5. 1 PublicationVSP_017216Add
BLAST
Alternative sequencei1094 – 10941V → VDFPSATLVCVGTVQMYAHT HLRLGAPGPHCAHGSAMPR in isoform 4. 1 PublicationVSP_017217
Alternative sequencei1182 – 119211RPQLVPQPGAC → SPTWCPAWCLLKPVLEPIPH PCLVRMSCS in isoform 4. 1 PublicationVSP_017218Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ006417 mRNA. Translation: CAA07022.1.
AF193042 mRNA. Translation: AAG22470.1.
AB023205 mRNA. Translation: BAA76832.2. Different initiation.
AK091959 mRNA. Translation: BAC03777.1.
AL133562 mRNA. Translation: CAB63716.1.
AL096745 mRNA. Translation: CAB62532.2.
AC024361 Genomic DNA. No translation available.
AC068014 Genomic DNA. No translation available.
AC068584 Genomic DNA. No translation available.
AC087222 Genomic DNA. No translation available.
AC130371 Genomic DNA. No translation available.
BC003094 mRNA. Translation: AAH03094.1.
BC012824 mRNA. Translation: AAH12824.2.
BC039654 mRNA. Translation: AAH39654.1. Different initiation.
CCDSiCCDS45818.1. [Q9BTW9-1]
PIRiT12548.
T43482.
RefSeqiNP_005984.3. NM_005993.4. [Q9BTW9-1]
UniGeneiHs.464391.

Genome annotation databases

EnsembliENST00000355528; ENSP00000347719; ENSG00000141556. [Q9BTW9-1]
GeneIDi6904.
KEGGihsa:6904.
UCSCiuc002kfz.4. human. [Q9BTW9-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ006417 mRNA. Translation: CAA07022.1.
AF193042 mRNA. Translation: AAG22470.1.
AB023205 mRNA. Translation: BAA76832.2. Different initiation.
AK091959 mRNA. Translation: BAC03777.1.
AL133562 mRNA. Translation: CAB63716.1.
AL096745 mRNA. Translation: CAB62532.2.
AC024361 Genomic DNA. No translation available.
AC068014 Genomic DNA. No translation available.
AC068584 Genomic DNA. No translation available.
AC087222 Genomic DNA. No translation available.
AC130371 Genomic DNA. No translation available.
BC003094 mRNA. Translation: AAH03094.1.
BC012824 mRNA. Translation: AAH12824.2.
BC039654 mRNA. Translation: AAH39654.1. Different initiation.
CCDSiCCDS45818.1. [Q9BTW9-1]
PIRiT12548.
T43482.
RefSeqiNP_005984.3. NM_005993.4. [Q9BTW9-1]
UniGeneiHs.464391.

3D structure databases

ProteinModelPortaliQ9BTW9.
SMRiQ9BTW9. Positions 354-430, 572-624, 845-883.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi112767. 51 interactions.
IntActiQ9BTW9. 13 interactions.
MINTiMINT-1138609.
STRINGi9606.ENSP00000347719.

PTM databases

iPTMnetiQ9BTW9.
PhosphoSiteiQ9BTW9.
SwissPalmiQ9BTW9.

Polymorphism and mutation databases

BioMutaiTBCD.
DMDMi296452924.

Proteomic databases

EPDiQ9BTW9.
MaxQBiQ9BTW9.
PaxDbiQ9BTW9.
PeptideAtlasiQ9BTW9.
PRIDEiQ9BTW9.

Protocols and materials databases

DNASUi6904.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000355528; ENSP00000347719; ENSG00000141556. [Q9BTW9-1]
GeneIDi6904.
KEGGihsa:6904.
UCSCiuc002kfz.4. human. [Q9BTW9-1]

Organism-specific databases

CTDi6904.
GeneCardsiTBCD.
H-InvDBHIX0021105.
HGNCiHGNC:11581. TBCD.
HPAiHPA045200.
MIMi604649. gene.
neXtProtiNX_Q9BTW9.
PharmGKBiPA36345.
HUGEiSearch...
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1943. Eukaryota.
COG5234. LUCA.
GeneTreeiENSGT00390000017103.
HOVERGENiHBG053297.
InParanoidiQ9BTW9.
PhylomeDBiQ9BTW9.
TreeFamiTF105754.

Enzyme and pathway databases

ReactomeiR-HSA-389977. Post-chaperonin tubulin folding pathway.

Miscellaneous databases

ChiTaRSiTBCD. human.
GeneWikiiTBCD.
GenomeRNAii6904.
PROiQ9BTW9.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000141556.
ExpressionAtlasiQ9BTW9. baseline and differential.
GenevisibleiQ9BTW9. HS.

Family and domain databases

Gene3Di1.25.10.10. 6 hits.
InterProiIPR011989. ARM-like.
IPR016024. ARM-type_fold.
IPR033162. TBCD.
IPR022577. Tubulin_specific_chaperoneD_C.
[Graphical view]
PANTHERiPTHR12658:SF0. PTHR12658:SF0. 1 hit.
PfamiPF12612. TFCD_C. 1 hit.
[Graphical view]
SUPFAMiSSF48371. SSF48371. 1 hit.
ProtoNetiSearch...

Entry informationi

Entry nameiTBCD_HUMAN
AccessioniPrimary (citable) accession number: Q9BTW9
Secondary accession number(s): O95458
, Q7L8K1, Q8IXP6, Q8NAX0, Q8WYH4, Q96E74, Q9UF82, Q9UG46, Q9Y2J3
Entry historyi
Integrated into UniProtKB/Swiss-Prot: February 7, 2006
Last sequence update: May 18, 2010
Last modified: September 7, 2016
This is version 133 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 17
    Human chromosome 17: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.