Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Histone H2A.J

Gene

H2AFJ

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling.

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Ligandi

DNA-binding

Enzyme and pathway databases

ReactomeiR-HSA-1221632. Meiotic synapsis.
R-HSA-171306. Packaging Of Telomere Ends.
R-HSA-201722. Formation of the beta-catenin:TCF transactivating complex.
R-HSA-212300. PRC2 methylates histones and DNA.
R-HSA-2299718. Condensation of Prophase Chromosomes.
R-HSA-2559580. Oxidative Stress Induced Senescence.
R-HSA-2559582. Senescence-Associated Secretory Phenotype (SASP).
R-HSA-2559586. DNA Damage/Telomere Stress Induced Senescence.
R-HSA-3214858. RMTs methylate histone arginines.
R-HSA-427359. SIRT1 negatively regulates rRNA Expression.
R-HSA-427389. ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression.
R-HSA-427413. NoRC negatively regulates rRNA expression.
R-HSA-5250924. B-WICH complex positively regulates rRNA expression.
R-HSA-5334118. DNA methylation.
R-HSA-5578749. Transcriptional regulation by small RNAs.
R-HSA-5617472. Activation of anterior HOX genes in hindbrain development during early embryogenesis.
R-HSA-5625886. Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3.
R-HSA-606279. Deposition of new CENPA-containing nucleosomes at the centromere.
R-HSA-73728. RNA Polymerase I Promoter Opening.
R-HSA-73777. RNA Polymerase I Chain Elongation.
R-HSA-912446. Meiotic recombination.

Names & Taxonomyi

Protein namesi
Recommended name:
Histone H2A.J
Short name:
H2a/j
Gene namesi
Name:H2AFJ
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 12

Organism-specific databases

HGNCiHGNC:14456. H2AFJ.

Subcellular locationi

GO - Cellular componenti

  • extracellular exosome Source: UniProtKB
  • nuclear chromatin Source: GO_Central
  • nucleosome Source: UniProtKB-KW
Complete GO annotation...

Keywords - Cellular componenti

Chromosome, Nucleosome core, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi55766.
OpenTargetsiENSG00000246705.
PharmGKBiPA29108.

Polymorphism and mutation databases

BioMutaiH2AFJ.
DMDMi74733131.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003442471 – 129Histone H2A.JAdd BLAST129

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei6N6-acetyllysineBy similarity1
Modified residuei10N6-acetyllysineBy similarity1
Modified residuei105N5-methylglutamineBy similarity1
Modified residuei121Phosphothreonine; by VPRBPBy similarity1

Post-translational modificationi

Monoubiquitination of Lys-120 (H2AXK119ub) gives a specific tag for epigenetic transcriptional repression. Following DNA double-strand breaks (DSBs), it is ubiquitinated through 'Lys-63' linkage of ubiquitin moieties (By similarity).By similarity
Phosphorylation on Ser-2 (H2AS1ph) is enhanced during mitosis. Phosphorylation on Ser-2 by RPS6KA5/MSK1 directly represses transcription. Acetylation of H3 inhibits Ser-2 phosphorylation by RPS6KA5/MSK1. Phosphorylation at Thr-121 (H2AT120ph) by VPRBP is present in the regulatory region of many tumor suppresor genes and down-regulates their transcription (By similarity).By similarity
Glutamine methylation at Gln-105 (H2AQ104me) by FBL is specifically dedicated to polymerase I. It is present at 35S ribosomal DNA locus and impairs binding of the FACT complex (By similarity).By similarity

Keywords - PTMi

Acetylation, Isopeptide bond, Methylation, Phosphoprotein, Ubl conjugation

Proteomic databases

MaxQBiQ9BTM1.
PaxDbiQ9BTM1.
PeptideAtlasiQ9BTM1.
PRIDEiQ9BTM1.
TopDownProteomicsiQ9BTM1-1. [Q9BTM1-1]

PTM databases

iPTMnetiQ9BTM1.
PhosphoSitePlusiQ9BTM1.
SwissPalmiQ9BTM1.

Expressioni

Gene expression databases

BgeeiENSG00000246705.
CleanExiHS_H2AFJ.
ExpressionAtlasiQ9BTM1. baseline and differential.
GenevisibleiQ9BTM1. HS.

Organism-specific databases

HPAiHPA041189.

Interactioni

Subunit structurei

The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA.

Protein-protein interaction databases

BioGridi120884. 8 interactors.
IntActiQ9BTM1. 15 interactors.
MINTiMINT-5001944.
STRINGi9606.ENSP00000373730.

Structurei

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4EDUX-ray2.58T31-46[»]
ProteinModelPortaliQ9BTM1.
SMRiQ9BTM1.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Belongs to the histone H2A family.Curated

Phylogenomic databases

eggNOGiKOG1756. Eukaryota.
COG5262. LUCA.
GeneTreeiENSGT00760000118934.
HOGENOMiHOG000234652.
HOVERGENiHBG009342.
InParanoidiQ9BTM1.
KOiK11251.
OMAiKTEICGR.
OrthoDBiEOG091G0XGD.
PhylomeDBiQ9BTM1.
TreeFamiTF300137.

Family and domain databases

Gene3Di1.10.20.10. 1 hit.
InterProiIPR009072. Histone-fold.
IPR002119. Histone_H2A.
IPR007125. Histone_H2A/H2B/H3.
IPR032454. Histone_H2A_C.
IPR032458. Histone_H2A_CS.
[Graphical view]
PfamiPF00125. Histone. 1 hit.
PF16211. Histone_H2A_C. 1 hit.
[Graphical view]
PRINTSiPR00620. HISTONEH2A.
SMARTiSM00414. H2A. 1 hit.
[Graphical view]
SUPFAMiSSF47113. SSF47113. 1 hit.
PROSITEiPS00046. HISTONE_H2A. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BTM1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSGRGKQGGK VRAKAKSRSS RAGLQFPVGR VHRLLRKGNY AERVGAGAPV
60 70 80 90 100
YLAAVLEYLT AEILELAGNA ARDNKKTRII PRHLQLAIRN DEELNKLLGK
110 120
VTIAQGGVLP NIQAVLLPKK TESQKTKSK
Length:129
Mass (Da):14,019
Last modified:June 1, 2001 - v1
Checksum:iE35049617B456D45
GO
Isoform 2 (identifier: Q9BTM1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     119-129: KKTESQKTKSK → VCEHSGPSSGKIPSDRAELGAGSVCGHIFQKVE

Show »
Length:151
Mass (Da):16,110
Checksum:i5CD96E044A740AB5
GO

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_034750119 – 129KKTESQKTKSK → VCEHSGPSSGKIPSDRAELG AGSVCGHIFQKVE in isoform 2. 1 PublicationAdd BLAST11

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001765 mRNA. Translation: BAA91894.1.
CH471094 Genomic DNA. Translation: EAW96326.1.
BC003602 mRNA. Translation: AAH03602.1.
CCDSiCCDS31752.1. [Q9BTM1-1]
RefSeqiNP_808760.1. NM_177925.3. [Q9BTM1-1]
UniGeneiHs.524280.

Genome annotation databases

EnsembliENST00000389078; ENSP00000373730; ENSG00000246705. [Q9BTM1-1]
ENST00000544848; ENSP00000438553; ENSG00000246705. [Q9BTM1-1]
GeneIDi55766.
KEGGihsa:55766.
UCSCiuc009zia.4. human. [Q9BTM1-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK001765 mRNA. Translation: BAA91894.1.
CH471094 Genomic DNA. Translation: EAW96326.1.
BC003602 mRNA. Translation: AAH03602.1.
CCDSiCCDS31752.1. [Q9BTM1-1]
RefSeqiNP_808760.1. NM_177925.3. [Q9BTM1-1]
UniGeneiHs.524280.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
4EDUX-ray2.58T31-46[»]
ProteinModelPortaliQ9BTM1.
SMRiQ9BTM1.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi120884. 8 interactors.
IntActiQ9BTM1. 15 interactors.
MINTiMINT-5001944.
STRINGi9606.ENSP00000373730.

PTM databases

iPTMnetiQ9BTM1.
PhosphoSitePlusiQ9BTM1.
SwissPalmiQ9BTM1.

Polymorphism and mutation databases

BioMutaiH2AFJ.
DMDMi74733131.

Proteomic databases

MaxQBiQ9BTM1.
PaxDbiQ9BTM1.
PeptideAtlasiQ9BTM1.
PRIDEiQ9BTM1.
TopDownProteomicsiQ9BTM1-1. [Q9BTM1-1]

Protocols and materials databases

DNASUi55766.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000389078; ENSP00000373730; ENSG00000246705. [Q9BTM1-1]
ENST00000544848; ENSP00000438553; ENSG00000246705. [Q9BTM1-1]
GeneIDi55766.
KEGGihsa:55766.
UCSCiuc009zia.4. human. [Q9BTM1-1]

Organism-specific databases

CTDi55766.
DisGeNETi55766.
GeneCardsiH2AFJ.
HGNCiHGNC:14456. H2AFJ.
HPAiHPA041189.
neXtProtiNX_Q9BTM1.
OpenTargetsiENSG00000246705.
PharmGKBiPA29108.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1756. Eukaryota.
COG5262. LUCA.
GeneTreeiENSGT00760000118934.
HOGENOMiHOG000234652.
HOVERGENiHBG009342.
InParanoidiQ9BTM1.
KOiK11251.
OMAiKTEICGR.
OrthoDBiEOG091G0XGD.
PhylomeDBiQ9BTM1.
TreeFamiTF300137.

Enzyme and pathway databases

ReactomeiR-HSA-1221632. Meiotic synapsis.
R-HSA-171306. Packaging Of Telomere Ends.
R-HSA-201722. Formation of the beta-catenin:TCF transactivating complex.
R-HSA-212300. PRC2 methylates histones and DNA.
R-HSA-2299718. Condensation of Prophase Chromosomes.
R-HSA-2559580. Oxidative Stress Induced Senescence.
R-HSA-2559582. Senescence-Associated Secretory Phenotype (SASP).
R-HSA-2559586. DNA Damage/Telomere Stress Induced Senescence.
R-HSA-3214858. RMTs methylate histone arginines.
R-HSA-427359. SIRT1 negatively regulates rRNA Expression.
R-HSA-427389. ERCC6 (CSB) and EHMT2 (G9a) positively regulate rRNA expression.
R-HSA-427413. NoRC negatively regulates rRNA expression.
R-HSA-5250924. B-WICH complex positively regulates rRNA expression.
R-HSA-5334118. DNA methylation.
R-HSA-5578749. Transcriptional regulation by small RNAs.
R-HSA-5617472. Activation of anterior HOX genes in hindbrain development during early embryogenesis.
R-HSA-5625886. Activated PKN1 stimulates transcription of AR (androgen receptor) regulated genes KLK2 and KLK3.
R-HSA-606279. Deposition of new CENPA-containing nucleosomes at the centromere.
R-HSA-73728. RNA Polymerase I Promoter Opening.
R-HSA-73777. RNA Polymerase I Chain Elongation.
R-HSA-912446. Meiotic recombination.

Miscellaneous databases

GeneWikiiH2AFJ.
GenomeRNAii55766.
PROiQ9BTM1.

Gene expression databases

BgeeiENSG00000246705.
CleanExiHS_H2AFJ.
ExpressionAtlasiQ9BTM1. baseline and differential.
GenevisibleiQ9BTM1. HS.

Family and domain databases

Gene3Di1.10.20.10. 1 hit.
InterProiIPR009072. Histone-fold.
IPR002119. Histone_H2A.
IPR007125. Histone_H2A/H2B/H3.
IPR032454. Histone_H2A_C.
IPR032458. Histone_H2A_CS.
[Graphical view]
PfamiPF00125. Histone. 1 hit.
PF16211. Histone_H2A_C. 1 hit.
[Graphical view]
PRINTSiPR00620. HISTONEH2A.
SMARTiSM00414. H2A. 1 hit.
[Graphical view]
SUPFAMiSSF47113. SSF47113. 1 hit.
PROSITEiPS00046. HISTONE_H2A. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiH2AJ_HUMAN
AccessioniPrimary (citable) accession number: Q9BTM1
Secondary accession number(s): Q9NV63
Entry historyi
Integrated into UniProtKB/Swiss-Prot: July 22, 2008
Last sequence update: June 1, 2001
Last modified: November 2, 2016
This is version 120 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 12
    Human chromosome 12: entries, gene names and cross-references to MIM
  2. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  3. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.