Q9BTM1 (H2AJ_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 90.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Histone H2A.J Short name=H2a/j | ||
| Gene names |
| ||
| Organism | Homo sapiens (Human) [Reference proteome] | ||
| Taxonomic identifier | 9606 [NCBI] | ||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 129 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Core component of nucleosome. Nucleosomes wrap and compact DNA into chromatin, limiting DNA accessibility to the cellular machineries which require DNA as a template. Histones thereby play a central role in transcription regulation, DNA repair, DNA replication and chromosomal stability. DNA accessibility is regulated via a complex set of post-translational modifications of histones, also called histone code, and nucleosome remodeling. |
| Subunit structure | The nucleosome is a histone octamer containing two molecules each of H2A, H2B, H3 and H4 assembled in one H3-H4 heterotetramer and two H2A-H2B heterodimers. The octamer wraps approximately 147 bp of DNA. |
| Subcellular location | Nucleus By similarity. Chromosome By similarity. |
| Post-translational modification | Monoubiquitination of Lys-120 (H2AXK119ub) gives a specific tag for epigenetic transcriptional repression. Following DNA double-strand breaks (DSBs), it is ubiquitinated through 'Lys-63' linkage of ubiquitin moieties By similarity. Phosphorylation on Ser-2 is enhanced during mitosis. Phosphorylation on Ser-2 directly represses transcription By similarity. |
| Sequence similarities | Belongs to the histone H2A family. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Chromosome Nucleosome core Nucleus |
| Coding sequence diversity | Alternative splicing |
| Ligand | DNA-binding |
| PTM | Isopeptide bond Phosphoprotein Ubl conjugation |
| Technical term | 3D-structure Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | nucleosome assembly Inferred from electronic annotation. Source: InterPro |
| Cellular_component | nucleosome Inferred from electronic annotation. Source: UniProtKB-KW nucleusInferred from electronic annotation. Source: UniProtKB-SubCell |
| Molecular_function | DNA binding Inferred from electronic annotation. Source: UniProtKB-KW |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BTM1-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BTM1-2) The sequence of this isoform differs from the canonical sequence as follows: 119-129: KKTESQKTKSK → VCEHSGPSSGKIPSDRAELGAGSVCGHIFQKVE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 129 | 129 | Histone H2A.J | PRO_0000344247 | |||||
Amino acid modifications | |||||||||
| Cross-link | 14 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) By similarity | |||||||
| Cross-link | 16 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) By similarity | |||||||
| Cross-link | 120 | Glycyl lysine isopeptide (Lys-Gly) (interchain with G-Cter in ubiquitin) By similarity | |||||||
Natural variations | |||||||||
| Alternative sequence | 119 – 129 | 11 | KKTESQKTKSK → VCEHSGPSSGKIPSDRAELG AGSVCGHIFQKVE in isoform 2. | VSP_034750 | |||||
Sequences
| ||||||||||||||||||||||||
References
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AK001765 mRNA. Translation: BAA91894.1. CH471094 Genomic DNA. Translation: EAW96326.1. BC003602 mRNA. Translation: AAH03602.1. | ||||||||||||
| IPI | IPI00102165. IPI00220855. | ||||||||||||
| RefSeq | NP_808760.1. NM_177925.2. | ||||||||||||
| UniGene | Hs.524280. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9BTM1. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9BTM1. 14 interactions. | ||||||||||||
| STRING | 9606.ENSP00000373730. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9BTM1. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 74733131. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9BTM1. | ||||||||||||
| PRIDE | Q9BTM1. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 55766. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000389078; ENSP00000373730; ENSG00000246705. ENST00000544848; ENSP00000438553; ENSG00000246705. | ||||||||||||
| GeneID | 55766. | ||||||||||||
| KEGG | hsa:55766. | ||||||||||||
| UCSC | uc009zia.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 55766. | ||||||||||||
| GeneCards | GC12P014827. | ||||||||||||
| HGNC | HGNC:14456. H2AFJ. | ||||||||||||
| neXtProt | NX_Q9BTM1. | ||||||||||||
| PharmGKB | PA29108. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | COG5262. | ||||||||||||
| HOGENOM | HOG000234652. | ||||||||||||
| HOVERGEN | HBG009342. | ||||||||||||
| KO | K11251. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9BTM1. | ||||||||||||
| Bgee | Q9BTM1. | ||||||||||||
| CleanEx | HS_H2AFJ. | ||||||||||||
| Genevestigator | Q9BTM1. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 1.10.20.10. 1 hit. | ||||||||||||
| InterPro | IPR009072. Histone-fold. IPR007125. Histone_core_D. IPR002119. Histone_H2A. [Graphical view] | ||||||||||||
| Pfam | PF00125. Histone. 1 hit. [Graphical view] | ||||||||||||
| PRINTS | PR00620. HISTONEH2A. | ||||||||||||
| SMART | SM00414. H2A. 1 hit. [Graphical view] | ||||||||||||
| SUPFAM | SSF47113. Histone-fold. 1 hit. | ||||||||||||
| PROSITE | PS00046. HISTONE_H2A. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| GenomeRNAi | 55766. | ||||||||||||
| NextBio | 60813. | ||||||||||||
Entry information
| Entry name | H2AJ_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BTM1 Secondary accession number(s): Q9NV63 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 12 Human chromosome 12: entries, gene names and cross-references to MIM |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
