Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Dynactin subunit 5

Gene

DCTN5

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

GO - Biological processi

Complete GO annotation...

Enzyme and pathway databases

ReactomeiREACT_121399. MHC class II antigen presentation.

Names & Taxonomyi

Protein namesi
Recommended name:
Dynactin subunit 5
Alternative name(s):
Dynactin subunit p25
Gene namesi
Name:DCTN5
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:24594. DCTN5.

Subcellular locationi

GO - Cellular componenti

  • centrosome Source: UniProtKB
  • condensed chromosome kinetochore Source: UniProtKB-SubCell
  • cytosol Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Centromere, Chromosome, Cytoplasm, Cytoskeleton, Kinetochore

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA142672007.

Polymorphism and mutation databases

BioMutaiDCTN5.
DMDMi62900103.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 182182Dynactin subunit 5PRO_0000079827Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei1 – 11N-acetylmethionine2 Publications

Keywords - PTMi

Acetylation

Proteomic databases

MaxQBiQ9BTE1.
PaxDbiQ9BTE1.
PRIDEiQ9BTE1.

PTM databases

PhosphoSiteiQ9BTE1.

Expressioni

Gene expression databases

BgeeiQ9BTE1.
CleanExiHS_DCTN5.
ExpressionAtlasiQ9BTE1. baseline and differential.
GenevisibleiQ9BTE1. HS.

Organism-specific databases

HPAiHPA042003.

Interactioni

Subunit structurei

Member of the pointed-end complex of the dynactin shoulder complex which contains DCTN4, DCTN5 and DCTN6 subunits and ACTR10. Within the complex DCTN6 forms a heterodimer with DCTN5.1 Publication

Binary interactionsi

WithEntry#Exp.IntActNotes
FATE1Q969F03EBI-747324,EBI-743099
RBPMSQ930623EBI-747324,EBI-740322

Protein-protein interaction databases

BioGridi124110. 14 interactions.
IntActiQ9BTE1. 8 interactions.
MINTiMINT-1474973.
STRINGi9606.ENSP00000300087.

Structurei

3D structure databases

ProteinModelPortaliQ9BTE1.
SMRiQ9BTE1. Positions 22-159.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Phylogenomic databases

eggNOGiNOG282896.
GeneTreeiENSGT00390000015360.
HOGENOMiHOG000198229.
HOVERGENiHBG051325.
InParanoidiQ9BTE1.
KOiK10427.
OMAiPPYKTYR.
OrthoDBiEOG751NGQ.
PhylomeDBiQ9BTE1.
TreeFamiTF314194.

Family and domain databases

InterProiIPR001451. Hexapep_transf.
IPR011004. Trimer_LpxA-like.
[Graphical view]
PfamiPF00132. Hexapep. 1 hit.
[Graphical view]
SUPFAMiSSF51161. SSF51161. 1 hit.

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BTE1-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MELGELLYNK SEYIETASGN KVSRQSVLCG SQNIVLNGKT IVMNDCIIRG
60 70 80 90 100
DLANVRVGRH CVVKSRSVIR PPFKKFSKGV AFFPLHIGDH VFIEEDCVVN
110 120 130 140 150
AAQIGSYVHV GKNCVIGRRC VLKDCCKILD NTVLPPETVV PPFTVFSGCP
160 170 180
GLFSGELPEC TQELMIDVTK SYYQKFLPLT QV
Length:182
Mass (Da):20,127
Last modified:June 1, 2001 - v1
Checksum:i476DBD27A6CA1C35
GO
Isoform 2 (identifier: Q9BTE1-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     151-182: GLFSGELPECTQELMIDVTKSYYQKFLPLTQV → AP

Note: No experimental confirmation available.
Show »
Length:152
Mass (Da):16,633
Checksum:iFFC398F012D63D03
GO
Isoform 3 (identifier: Q9BTE1-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     40-182: TIVMNDCIIR...YQKFLPLTQV → NFVISVFLSP...EWWGLVNWRM

Show »
Length:84
Mass (Da):9,740
Checksum:iB269846E7CD827D3
GO

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei40 – 182143TIVMN…PLTQV → NFVISVFLSPYIRCHSACRD RKRSDESVRLSVNNREWWGL VNWRM in isoform 3. CuratedVSP_046697Add
BLAST
Alternative sequencei151 – 18232GLFSG…PLTQV → AP in isoform 2. 1 PublicationVSP_046023Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027387 mRNA. Translation: BAB55077.1.
AK292843 mRNA. Translation: BAF85532.1.
AC008870 Genomic DNA. No translation available.
CH471145 Genomic DNA. Translation: EAW55809.1.
CH471145 Genomic DNA. Translation: EAW55810.1.
BC004191 mRNA. Translation: AAH04191.1.
CD388246 mRNA. No translation available.
CCDSiCCDS10615.1. [Q9BTE1-1]
CCDS58435.1. [Q9BTE1-3]
CCDS58436.1. [Q9BTE1-2]
RefSeqiNP_001185940.1. NM_001199011.1. [Q9BTE1-3]
NP_001186672.1. NM_001199743.1. [Q9BTE1-2]
NP_115875.1. NM_032486.3. [Q9BTE1-1]
UniGeneiHs.435941.

Genome annotation databases

EnsembliENST00000300087; ENSP00000300087; ENSG00000166847. [Q9BTE1-1]
ENST00000563998; ENSP00000454691; ENSG00000166847. [Q9BTE1-2]
ENST00000568272; ENSP00000455685; ENSG00000166847. [Q9BTE1-3]
GeneIDi84516.
KEGGihsa:84516.
UCSCiuc002dly.2. human. [Q9BTE1-1]
uc021tfh.1. human.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK027387 mRNA. Translation: BAB55077.1.
AK292843 mRNA. Translation: BAF85532.1.
AC008870 Genomic DNA. No translation available.
CH471145 Genomic DNA. Translation: EAW55809.1.
CH471145 Genomic DNA. Translation: EAW55810.1.
BC004191 mRNA. Translation: AAH04191.1.
CD388246 mRNA. No translation available.
CCDSiCCDS10615.1. [Q9BTE1-1]
CCDS58435.1. [Q9BTE1-3]
CCDS58436.1. [Q9BTE1-2]
RefSeqiNP_001185940.1. NM_001199011.1. [Q9BTE1-3]
NP_001186672.1. NM_001199743.1. [Q9BTE1-2]
NP_115875.1. NM_032486.3. [Q9BTE1-1]
UniGeneiHs.435941.

3D structure databases

ProteinModelPortaliQ9BTE1.
SMRiQ9BTE1. Positions 22-159.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124110. 14 interactions.
IntActiQ9BTE1. 8 interactions.
MINTiMINT-1474973.
STRINGi9606.ENSP00000300087.

PTM databases

PhosphoSiteiQ9BTE1.

Polymorphism and mutation databases

BioMutaiDCTN5.
DMDMi62900103.

Proteomic databases

MaxQBiQ9BTE1.
PaxDbiQ9BTE1.
PRIDEiQ9BTE1.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000300087; ENSP00000300087; ENSG00000166847. [Q9BTE1-1]
ENST00000563998; ENSP00000454691; ENSG00000166847. [Q9BTE1-2]
ENST00000568272; ENSP00000455685; ENSG00000166847. [Q9BTE1-3]
GeneIDi84516.
KEGGihsa:84516.
UCSCiuc002dly.2. human. [Q9BTE1-1]
uc021tfh.1. human.

Organism-specific databases

CTDi84516.
GeneCardsiGC16P023652.
H-InvDBHIX0134374.
HGNCiHGNC:24594. DCTN5.
HPAiHPA042003.
MIMi612962. gene.
neXtProtiNX_Q9BTE1.
PharmGKBiPA142672007.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiNOG282896.
GeneTreeiENSGT00390000015360.
HOGENOMiHOG000198229.
HOVERGENiHBG051325.
InParanoidiQ9BTE1.
KOiK10427.
OMAiPPYKTYR.
OrthoDBiEOG751NGQ.
PhylomeDBiQ9BTE1.
TreeFamiTF314194.

Enzyme and pathway databases

ReactomeiREACT_121399. MHC class II antigen presentation.

Miscellaneous databases

ChiTaRSiDCTN5. human.
GeneWikiiDCTN5.
GenomeRNAii84516.
NextBioi74322.
PROiQ9BTE1.
SOURCEiSearch...

Gene expression databases

BgeeiQ9BTE1.
CleanExiHS_DCTN5.
ExpressionAtlasiQ9BTE1. baseline and differential.
GenevisibleiQ9BTE1. HS.

Family and domain databases

InterProiIPR001451. Hexapep_transf.
IPR011004. Trimer_LpxA-like.
[Graphical view]
PfamiPF00132. Hexapep. 1 hit.
[Graphical view]
SUPFAMiSSF51161. SSF51161. 1 hit.
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Mammary gland and Trachea.
  2. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Kidney and Trophoblast.
  5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  6. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
    Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
    Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
    Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  7. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. "Dynactin helps target Polo-like kinase 1 to kinetochores via its left-handed beta-helical p27 subunit."
    Yeh T.Y., Kowalska A.K., Scipioni B.R., Cheong F.K., Zheng M., Derewenda U., Derewenda Z.S., Schroer T.A.
    EMBO J. 32:1023-1035(2013) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBUNIT, SUBCELLULAR LOCATION.

Entry informationi

Entry nameiDCTN5_HUMAN
AccessioniPrimary (citable) accession number: Q9BTE1
Secondary accession number(s): A8K9X8, H3BN51, H3BQA4
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 26, 2005
Last sequence update: June 1, 2001
Last modified: June 24, 2015
This is version 106 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.