Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BTE1

- DCTN5_HUMAN

UniProt

Q9BTE1 - DCTN5_HUMAN

Protein

Dynactin subunit 5

Gene

DCTN5

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 101 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    GO - Biological processi

    1. antigen processing and presentation of exogenous peptide antigen via MHC class II Source: Reactome

    Enzyme and pathway databases

    ReactomeiREACT_121399. MHC class II antigen presentation.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Dynactin subunit 5
    Alternative name(s):
    Dynactin subunit p25
    Gene namesi
    Name:DCTN5
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:24594. DCTN5.

    Subcellular locationi

    Cytoplasmcytoskeleton By similarity. Chromosomecentromerekinetochore 1 Publication

    GO - Cellular componenti

    1. centrosome Source: UniProtKB
    2. condensed chromosome kinetochore Source: UniProtKB-SubCell
    3. cytosol Source: Reactome

    Keywords - Cellular componenti

    Centromere, Chromosome, Cytoplasm, Cytoskeleton, Kinetochore

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA142672007.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 182182Dynactin subunit 5PRO_0000079827Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei1 – 11N-acetylmethionine2 Publications

    Keywords - PTMi

    Acetylation

    Proteomic databases

    MaxQBiQ9BTE1.
    PaxDbiQ9BTE1.
    PRIDEiQ9BTE1.

    PTM databases

    PhosphoSiteiQ9BTE1.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9BTE1.
    BgeeiQ9BTE1.
    CleanExiHS_DCTN5.
    GenevestigatoriQ9BTE1.

    Organism-specific databases

    HPAiHPA042003.

    Interactioni

    Subunit structurei

    Member of the pointed-end complex of the dynactin shoulder complex which contains DCTN4, DCTN5 and DCTN6 subunits and ACTR10. Within the complex DCTN6 forms a heterodimer with DCTN5.1 Publication

    Protein-protein interaction databases

    BioGridi124110. 6 interactions.
    IntActiQ9BTE1. 6 interactions.
    MINTiMINT-1474973.
    STRINGi9606.ENSP00000300087.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BTE1.
    SMRiQ9BTE1. Positions 22-159.
    ModBaseiSearch...
    MobiDBiSearch...

    Family & Domainsi

    Sequence similaritiesi

    Phylogenomic databases

    eggNOGiNOG282896.
    HOGENOMiHOG000198229.
    HOVERGENiHBG051325.
    InParanoidiQ9BTE1.
    KOiK10427.
    OrthoDBiEOG751NGQ.
    PhylomeDBiQ9BTE1.
    TreeFamiTF314194.

    Family and domain databases

    InterProiIPR001451. Hexapep_transf.
    IPR011004. Trimer_LpxA-like.
    [Graphical view]
    PfamiPF00132. Hexapep. 1 hit.
    [Graphical view]
    SUPFAMiSSF51161. SSF51161. 1 hit.

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BTE1-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MELGELLYNK SEYIETASGN KVSRQSVLCG SQNIVLNGKT IVMNDCIIRG    50
    DLANVRVGRH CVVKSRSVIR PPFKKFSKGV AFFPLHIGDH VFIEEDCVVN 100
    AAQIGSYVHV GKNCVIGRRC VLKDCCKILD NTVLPPETVV PPFTVFSGCP 150
    GLFSGELPEC TQELMIDVTK SYYQKFLPLT QV 182
    Length:182
    Mass (Da):20,127
    Last modified:June 1, 2001 - v1
    Checksum:i476DBD27A6CA1C35
    GO
    Isoform 2 (identifier: Q9BTE1-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         151-182: GLFSGELPECTQELMIDVTKSYYQKFLPLTQV → AP

    Note: No experimental confirmation available.

    Show »
    Length:152
    Mass (Da):16,633
    Checksum:iFFC398F012D63D03
    GO
    Isoform 3 (identifier: Q9BTE1-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         40-182: TIVMNDCIIR...YQKFLPLTQV → NFVISVFLSP...EWWGLVNWRM

    Show »
    Length:84
    Mass (Da):9,740
    Checksum:iB269846E7CD827D3
    GO

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei40 – 182143TIVMN…PLTQV → NFVISVFLSPYIRCHSACRD RKRSDESVRLSVNNREWWGL VNWRM in isoform 3. CuratedVSP_046697Add
    BLAST
    Alternative sequencei151 – 18232GLFSG…PLTQV → AP in isoform 2. 1 PublicationVSP_046023Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK027387 mRNA. Translation: BAB55077.1.
    AK292843 mRNA. Translation: BAF85532.1.
    AC008870 Genomic DNA. No translation available.
    CH471145 Genomic DNA. Translation: EAW55809.1.
    CH471145 Genomic DNA. Translation: EAW55810.1.
    BC004191 mRNA. Translation: AAH04191.1.
    CD388246 mRNA. No translation available.
    CCDSiCCDS10615.1. [Q9BTE1-1]
    CCDS58435.1. [Q9BTE1-3]
    CCDS58436.1. [Q9BTE1-2]
    RefSeqiNP_001185940.1. NM_001199011.1. [Q9BTE1-3]
    NP_001186672.1. NM_001199743.1. [Q9BTE1-2]
    NP_115875.1. NM_032486.3. [Q9BTE1-1]
    UniGeneiHs.435941.

    Genome annotation databases

    EnsembliENST00000300087; ENSP00000300087; ENSG00000166847. [Q9BTE1-1]
    ENST00000563998; ENSP00000454691; ENSG00000166847. [Q9BTE1-2]
    ENST00000568272; ENSP00000455685; ENSG00000166847. [Q9BTE1-3]
    GeneIDi84516.
    KEGGihsa:84516.
    UCSCiuc002dly.2. human. [Q9BTE1-1]
    uc021tfh.1. human.

    Polymorphism databases

    DMDMi62900103.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK027387 mRNA. Translation: BAB55077.1 .
    AK292843 mRNA. Translation: BAF85532.1 .
    AC008870 Genomic DNA. No translation available.
    CH471145 Genomic DNA. Translation: EAW55809.1 .
    CH471145 Genomic DNA. Translation: EAW55810.1 .
    BC004191 mRNA. Translation: AAH04191.1 .
    CD388246 mRNA. No translation available.
    CCDSi CCDS10615.1. [Q9BTE1-1 ]
    CCDS58435.1. [Q9BTE1-3 ]
    CCDS58436.1. [Q9BTE1-2 ]
    RefSeqi NP_001185940.1. NM_001199011.1. [Q9BTE1-3 ]
    NP_001186672.1. NM_001199743.1. [Q9BTE1-2 ]
    NP_115875.1. NM_032486.3. [Q9BTE1-1 ]
    UniGenei Hs.435941.

    3D structure databases

    ProteinModelPortali Q9BTE1.
    SMRi Q9BTE1. Positions 22-159.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 124110. 6 interactions.
    IntActi Q9BTE1. 6 interactions.
    MINTi MINT-1474973.
    STRINGi 9606.ENSP00000300087.

    PTM databases

    PhosphoSitei Q9BTE1.

    Polymorphism databases

    DMDMi 62900103.

    Proteomic databases

    MaxQBi Q9BTE1.
    PaxDbi Q9BTE1.
    PRIDEi Q9BTE1.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000300087 ; ENSP00000300087 ; ENSG00000166847 . [Q9BTE1-1 ]
    ENST00000563998 ; ENSP00000454691 ; ENSG00000166847 . [Q9BTE1-2 ]
    ENST00000568272 ; ENSP00000455685 ; ENSG00000166847 . [Q9BTE1-3 ]
    GeneIDi 84516.
    KEGGi hsa:84516.
    UCSCi uc002dly.2. human. [Q9BTE1-1 ]
    uc021tfh.1. human.

    Organism-specific databases

    CTDi 84516.
    GeneCardsi GC16P023652.
    H-InvDB HIX0134374.
    HGNCi HGNC:24594. DCTN5.
    HPAi HPA042003.
    MIMi 612962. gene.
    neXtProti NX_Q9BTE1.
    PharmGKBi PA142672007.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi NOG282896.
    HOGENOMi HOG000198229.
    HOVERGENi HBG051325.
    InParanoidi Q9BTE1.
    KOi K10427.
    OrthoDBi EOG751NGQ.
    PhylomeDBi Q9BTE1.
    TreeFami TF314194.

    Enzyme and pathway databases

    Reactomei REACT_121399. MHC class II antigen presentation.

    Miscellaneous databases

    ChiTaRSi DCTN5. human.
    GeneWikii DCTN5.
    GenomeRNAii 84516.
    NextBioi 74322.
    PROi Q9BTE1.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BTE1.
    Bgeei Q9BTE1.
    CleanExi HS_DCTN5.
    Genevestigatori Q9BTE1.

    Family and domain databases

    InterProi IPR001451. Hexapep_transf.
    IPR011004. Trimer_LpxA-like.
    [Graphical view ]
    Pfami PF00132. Hexapep. 1 hit.
    [Graphical view ]
    SUPFAMi SSF51161. SSF51161. 1 hit.
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Mammary gland and Trachea.
    2. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    3. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Kidney and Trophoblast.
    5. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    6. "Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
      Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
      Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
      Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    7. Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    8. "Dynactin helps target Polo-like kinase 1 to kinetochores via its left-handed beta-helical p27 subunit."
      Yeh T.Y., Kowalska A.K., Scipioni B.R., Cheong F.K., Zheng M., Derewenda U., Derewenda Z.S., Schroer T.A.
      EMBO J. 32:1023-1035(2013) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBUNIT, SUBCELLULAR LOCATION.

    Entry informationi

    Entry nameiDCTN5_HUMAN
    AccessioniPrimary (citable) accession number: Q9BTE1
    Secondary accession number(s): A8K9X8, H3BN51, H3BQA4
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 26, 2005
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 101 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3