Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BTE1 (DCTN5_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 99. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (3) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Dynactin subunit 5
Alternative name(s):
Dynactin subunit p25
Gene names
Name:DCTN5
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length182 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Subunit structure

Member of the pointed-end complex of the dynactin shoulder complex which contains DCTN4, DCTN5 and DCTN6 subunits and ACTR10. Within the complex DCTN6 forms a heterodimer with DCTN5. Ref.8

Subcellular location

Cytoplasmcytoskeleton By similarity. Chromosomecentromerekinetochore Ref.8.

Sequence similarities

Belongs to the dynactin subunits 5/6 family. Dynactin subunit 5 subfamily.

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BTE1-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9BTE1-2)

The sequence of this isoform differs from the canonical sequence as follows:
     151-182: GLFSGELPECTQELMIDVTKSYYQKFLPLTQV → AP
Note: No experimental confirmation available.
Isoform 3 (identifier: Q9BTE1-3)

The sequence of this isoform differs from the canonical sequence as follows:
     40-182: TIVMNDCIIR...YQKFLPLTQV → NFVISVFLSP...EWWGLVNWRM

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 182182Dynactin subunit 5
PRO_0000079827

Amino acid modifications

Modified residue11N-acetylmethionine Ref.6 Ref.7

Natural variations

Alternative sequence40 – 182143TIVMN…PLTQV → NFVISVFLSPYIRCHSACRD RKRSDESVRLSVNNREWWGL VNWRM in isoform 3.
VSP_046697
Alternative sequence151 – 18232GLFSG…PLTQV → AP in isoform 2.
VSP_046023

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2001. Version 1.
Checksum: 476DBD27A6CA1C35

FASTA18220,127
        10         20         30         40         50         60 
MELGELLYNK SEYIETASGN KVSRQSVLCG SQNIVLNGKT IVMNDCIIRG DLANVRVGRH 

        70         80         90        100        110        120 
CVVKSRSVIR PPFKKFSKGV AFFPLHIGDH VFIEEDCVVN AAQIGSYVHV GKNCVIGRRC 

       130        140        150        160        170        180 
VLKDCCKILD NTVLPPETVV PPFTVFSGCP GLFSGELPEC TQELMIDVTK SYYQKFLPLT 


QV 

« Hide

Isoform 2 [UniParc].

Checksum: FFC398F012D63D03
Show »

FASTA15216,633
Isoform 3 [UniParc].

Checksum: B269846E7CD827D3
Show »

FASTA849,740

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Mammary gland and Trachea.
[2]"The sequence and analysis of duplication-rich human chromosome 16."
Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. expand/collapse author list , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[3]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (SEP-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Kidney and Trophoblast.
[5]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[6]"Comparative large-scale characterisation of plant vs. mammal proteins reveals similar and idiosyncratic N-alpha acetylation features."
Bienvenut W.V., Sumpton D., Martinez A., Lilla S., Espagne C., Meinnel T., Giglione C.
Mol. Cell. Proteomics 11:M111.015131-M111.015131(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[7]"N-terminal acetylome analyses and functional insights of the N-terminal acetyltransferase NatB."
Van Damme P., Lasa M., Polevoda B., Gazquez C., Elosegui-Artola A., Kim D.S., De Juan-Pardo E., Demeyer K., Hole K., Larrea E., Timmerman E., Prieto J., Arnesen T., Sherman F., Gevaert K., Aldabe R.
Proc. Natl. Acad. Sci. U.S.A. 109:12449-12454(2012) [PubMed] [Europe PMC] [Abstract]
Cited for: ACETYLATION [LARGE SCALE ANALYSIS] AT MET-1, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[8]"Dynactin helps target Polo-like kinase 1 to kinetochores via its left-handed beta-helical p27 subunit."
Yeh T.Y., Kowalska A.K., Scipioni B.R., Cheong F.K., Zheng M., Derewenda U., Derewenda Z.S., Schroer T.A.
EMBO J. 32:1023-1035(2013) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBUNIT, SUBCELLULAR LOCATION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK027387 mRNA. Translation: BAB55077.1.
AK292843 mRNA. Translation: BAF85532.1.
AC008870 Genomic DNA. No translation available.
CH471145 Genomic DNA. Translation: EAW55809.1.
CH471145 Genomic DNA. Translation: EAW55810.1.
BC004191 mRNA. Translation: AAH04191.1.
CD388246 mRNA. No translation available.
CCDSCCDS10615.1. [Q9BTE1-1]
CCDS58435.1. [Q9BTE1-3]
CCDS58436.1. [Q9BTE1-2]
RefSeqNP_001185940.1. NM_001199011.1. [Q9BTE1-3]
NP_001186672.1. NM_001199743.1. [Q9BTE1-2]
NP_115875.1. NM_032486.3. [Q9BTE1-1]
UniGeneHs.435941.

3D structure databases

ProteinModelPortalQ9BTE1.
SMRQ9BTE1. Positions 22-159.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid124110. 6 interactions.
IntActQ9BTE1. 6 interactions.
MINTMINT-1474973.
STRING9606.ENSP00000300087.

PTM databases

PhosphoSiteQ9BTE1.

Polymorphism databases

DMDM62900103.

Proteomic databases

MaxQBQ9BTE1.
PaxDbQ9BTE1.
PRIDEQ9BTE1.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000300087; ENSP00000300087; ENSG00000166847. [Q9BTE1-1]
ENST00000563998; ENSP00000454691; ENSG00000166847. [Q9BTE1-2]
ENST00000568272; ENSP00000455685; ENSG00000166847. [Q9BTE1-3]
GeneID84516.
KEGGhsa:84516.
UCSCuc002dly.2. human. [Q9BTE1-1]

Organism-specific databases

CTD84516.
GeneCardsGC16P023652.
H-InvDBHIX0134374.
HGNCHGNC:24594. DCTN5.
HPAHPA042003.
MIM612962. gene.
neXtProtNX_Q9BTE1.
PharmGKBPA142672007.
GenAtlasSearch...

Phylogenomic databases

eggNOGNOG282896.
HOGENOMHOG000198229.
HOVERGENHBG051325.
InParanoidQ9BTE1.
KOK10427.
OrthoDBEOG751NGQ.
PhylomeDBQ9BTE1.
TreeFamTF314194.

Enzyme and pathway databases

ReactomeREACT_6900. Immune System.

Gene expression databases

ArrayExpressQ9BTE1.
BgeeQ9BTE1.
CleanExHS_DCTN5.
GenevestigatorQ9BTE1.

Family and domain databases

InterProIPR001451. Hexapep_transf.
IPR011004. Trimer_LpxA-like.
[Graphical view]
PfamPF00132. Hexapep. 1 hit.
[Graphical view]
SUPFAMSSF51161. SSF51161. 1 hit.
ProtoNetSearch...

Other

ChiTaRSDCTN5. human.
GeneWikiDCTN5.
GenomeRNAi84516.
NextBio74322.
PROQ9BTE1.
SOURCESearch...

Entry information

Entry nameDCTN5_HUMAN
AccessionPrimary (citable) accession number: Q9BTE1
Secondary accession number(s): A8K9X8, H3BN51, H3BQA4
Entry history
Integrated into UniProtKB/Swiss-Prot: April 26, 2005
Last sequence update: June 1, 2001
Last modified: July 9, 2014
This is version 99 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM