Reviewed,
UniProtKB/Swiss-Prot Q9BST9 (RTKN_HUMAN)
Last modified
February 9, 2010.
Version 69.
History...
Clusters with 100%,
90%,
50% identity |
Documents (3) |
Third-party data |
Customize display | text xml rdf/xml gff fasta |
Names and origin
| Protein names | Recommended name: Rhotekin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Complete proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 563 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level. |
General annotation (Comments)
| Function | Mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. May play a novel role in the organization of septin structures. Ref.3 Ref.4 Ref.5 |
| Subunit structure | Interacts via its C-terminal region with the TAX1BP3 PDZ domain. This interaction facilitates Rho-mediated activation of the c-Fos serum response element (SRE). Interacts with SEPT9. Specifically binds to GTP-bound RHOA, RHOB and RHOC and inhibits their GTPase activity. Ref.3 Ref.5 UniProtKB Q8C6B2 |
| Tissue specificity | Highly expressed in prostate, moderately in kidney, heart, brain, spleen, testis, placenta, small intestine, pancreas, skeletal muscle and peripheral blood leukocytes, and weakly in ovary, colon and thymus. Weakly expressed in all normal cell lines tested. Overexpressed in various cancer cell lines. Ref.4 Ref.1 |
| Sequence similarities | Contains 1 PH domain. Contains 1 REM (Hr1) repeat. |
| Sequence caution | The sequence AAL16767.1 differs from that shown. Reason: Frameshift at positions 15 and 20. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Coding sequence diversity | Alternative splicing |
| Ligand | GTP-binding Nucleotide-binding |
| PTM | Phosphoprotein |
| Technical term | Complete proteome |
| Gene Ontology (GO) | |
| Biological process | Rho protein signal transduction Ref.4 Inferred from direct assay. Source: UniProtKB apoptosisInferred from electronic annotation. Source: UniProtKB-KW regulation of anti-apoptosis Ref.4Inferred from direct assay. Source: UniProtKB |
| Cellular component | intracellular Inferred from electronic annotation. Source: InterPro |
| Molecular function | GTP binding Inferred from electronic annotation. Source: UniProtKB-KW GTP-Rho binding Ref.3Inferred from direct assay. Source: UniProtKB GTPase inhibitor activity Ref.3Inferred from direct assay. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| RHOA | P61586 | 1 | EBI-446694,EBI-446668 | |
| Rhoa | Q9QUI0 | 1 | EBI-446694,EBI-643583 | From a different organism. |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.1 (identifier: Q9BST9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.2 (identifier: Q9BST9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-36: MFSRNHRSRVTVARGSALEMEFKRGRFRLSLFSDLP → MQDRLHILEDLNMLYIRQMALSL | ||||||
| Note: No experimental confirmation is available. | ||||||
| Isoform 3 Ref.3 (identifier: Q9BST9-3) The sequence of this isoform differs from the canonical sequence as follows: 1-36: MFSRNHRSRV...FRLSLFSDLP → SESGLVSCLE...LSLSSLLWKS | ||||||
| Note: Incomplete sequence. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 563 | 563 | Rhotekin | PRO_0000233940 | |||||
Regions | |||||||||
| Repeat | 36 – 99 | 64 | REM | ||||||
| Domain | 309 – 416 | 108 | PH | ||||||
| Compositional bias | 479 – 544 | 66 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 106 | 1 | Phosphoserine | ||||||
| Modified residue | 232 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 241 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 520 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 543 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 36 | 36 | MFSRN…FSDLP → MQDRLHILEDLNMLYIRQMA LSL in isoform 2. Ref.2 | VSP_052004 | |||||
| Alternative sequence | 1 – 36 | 36 | MFSRN…FSDLP → SESGLVSCLEGKGPAEGSGD SSRQAHPCLPLSLSSLLWKS in isoform 3. Ref.3 | VSP_052005 | |||||
Experimental info | |||||||||
| Mutagenesis | 561 – 563 | 3 | SPV → APA: Impairs interaction with TAX1BP3. Ref.3 | ||||||
| Sequence conflict | 18 – 19 | 2 | LE → WR Ref.1 | ||||||
| Sequence conflict | 55 | 1 | A → P in AAL16767. Ref.1 | ||||||
| Sequence conflict | 61 | 1 | A → P in AAL16767. Ref.1 | ||||||
| Sequence conflict | 65 – 66 | 2 | RE → AR in AAL16767. Ref.1 | ||||||
| Sequence conflict | 102 | 1 | S → N in AAL16767. Ref.1 | ||||||
| Sequence conflict | 112 | 1 | A → P in AAL16767. Ref.1 | ||||||
| Sequence conflict | 160 | 1 | Q → H in AAG01181. Ref.3 | ||||||
| Sequence conflict | 163 | 1 | E → D in AAG01181. Ref.3 | ||||||
| Sequence conflict | 178 | 1 | S → N in AAG01181. Ref.3 | ||||||
| Sequence conflict | 202 – 205 | 4 | EEGA → KKRG in AAG01181. Ref.3 | ||||||
| Sequence conflict | 227 | 1 | R → K in AAG01181. Ref.3 | ||||||
| Sequence conflict | 274 | 1 | R → L in AAL16767. Ref.1 | ||||||
| Sequence conflict | 336 | 1 | G → S in AAG01181. Ref.3 | ||||||
| Sequence conflict | 356 | 1 | L → F in AAL16767. Ref.1 | ||||||
| Sequence conflict | 365 – 366 | 2 | RV → PI in AAG01181. Ref.3 | ||||||
| Sequence conflict | 372 | 1 | D → E in AAG01181. Ref.3 | ||||||
| Sequence conflict | 401 – 406 | 6 | REALQS → LETLQN in AAG01181. Ref.3 | ||||||
| Sequence conflict | 437 – 439 | 3 | RKP → PKT in AAG01181. Ref.3 | ||||||
| Sequence conflict | 454 | 1 | A → V in AAG01181. Ref.3 | ||||||
| Sequence conflict | 540 | 1 | P → T in AAG01181. Ref.3 | ||||||
| Sequence conflict | 549 | 1 | L → F in AAG01181. Ref.3 | ||||||
| Sequence conflict | 555 | 1 | P → L in AAG01181. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning, expression characterization, and mapping of a novel putative inhibitor of rho GTPase activity, RTKN, to D2S145-D2S286." Fu Q., Yu L., Liu Q., Zhang J., Zhang H., Zhao S. Genomics 66:328-332(2000) [PubMed: 10873388] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Kidney. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Placenta. |
| [3] | "The PDZ protein TIP-1 interacts with the Rho effector rhotekin and is involved in Rho signaling to the serum response element." Reynaud C., Fabre S., Jalinot P. J. Biol. Chem. 275:33962-33968(2000) [PubMed: 10940294] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, INTERACTION WITH RHOA AND TAX1BP3, MUTAGENESIS OF 561-SER--VAL-563. Tissue: Leukocyte. |
| [4] | "Rho/Rhotekin-mediated NF-kappaB activation confers resistance to apoptosis." Liu C.-A., Wang M.-J., Chi C.-W., Wu C.-W., Chen J.-Y. Oncogene 23:8731-8742(2004) [PubMed: 15480428] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [5] | "Possible role of Rho/Rhotekin signaling in mammalian septin organization." Ito H., Iwamoto I., Morishita R., Nozawa Y., Narumiya S., Asano T., Nagata K. Oncogene 24:7064-7072(2005) [PubMed: 16007136] [Abstract] Cited for: FUNCTION, INTERACTION WITH SEPT9. |
| [6] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-232; SER-241 AND SER-543, MASS SPECTROMETRY. |
| [7] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed: 19369195] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-106, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF049227 mRNA. Translation: AAL16767.1. Frameshift. BC004558 mRNA. Translation: AAH04558.2. BC017727 mRNA. Translation: AAH17727.1. AF290512 mRNA. Translation: AAG01181.1. |
| IPI | IPI00029834. IPI00157230. IPI00386977. |
| RefSeq | NP_001015055.1. NP_001015056.1. NP_149035.1. |
| UniGene | Hs.192854 |
3D structure databases | |
| SMR | Q9BST9. Positions 322-412. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9BST9. 2 interactions. |
| STRING | Q9BST9. |
PTM databases | |
| PhosphoSite | Q9BST9. |
Proteomic databases | |
| PRIDE | Q9BST9. |
Genome annotation databases | |
| Ensembl | ENST00000272430; ENSP00000272430; ENSG00000114993; Homo sapiens. [Genome view] |
| GeneID | 6242. |
| KEGG | hsa:6242. |
| UCSC | uc002sle.1. human. |
Organism-specific databases | |
| CTD | 6242. |
| GeneCards | GC02M074506. |
| H-InvDB | HIX0002182. |
| HGNC | HGNC:10466. RTKN. |
| MIM | 602288. gene. |
| PharmGKB | PA34879. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG04291. |
| HOGENOM | HBG715547. |
| HOVERGEN | Q9BST9. |
| InParanoid | Q9BST9. |
| OMA | HEMAIEP. |
| OrthoDB | EOG96X1V2. |
Gene expression databases | |
| ArrayExpress | Q9BST9. |
| Bgee | Q9BST9. |
| CleanEx | HS_RTKN. |
| Genevestigator | Q9BST9. |
| GermOnline | ENSG00000114993. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR000861. HR1-like_rho-bd. IPR011072. HR1_rho-bd. IPR011993. PH_type. IPR001849. Pleckstrin_homology. [Graphical view] |
| Gene3D | G3DSA:2.30.29.30. PH_type. 1 hit. |
| Pfam | PF02185. HR1. 1 hit. PF00169. PH. 1 hit. [Graphical view] |
| SMART | SM00742. Hr1. 1 hit. SM00233. PH. 1 hit. [Graphical view] |
| PROSITE | PS50003. PH_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other Resources | |
| NextBio | 24241. |
| SOURCE | Search... |
Entry information
| Entry name | RTKN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BST9 Secondary accession number(s): Q8WVN1, Q96PT6, Q9HB05 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation project | HPI (Human Proteome Initiative) | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with


