Q9BST9 (RTKN_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
January 25, 2012.
Version 84.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Rhotekin | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo |
Protein attributes
| Sequence length | 563 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. May play a novel role in the organization of septin structures. Ref.3 Ref.4 Ref.5 |
| Subunit structure | Interacts via its C-terminal region with the TAX1BP3 PDZ domain. This interaction facilitates Rho-mediated activation of the c-Fos serum response element (SRE). Interacts with SEPT9. Specifically binds to GTP-bound RHOA, RHOB and RHOC and inhibits their GTPase activity. Ref.3 Ref.5 UniProtKB Q8C6B2 |
| Tissue specificity | Highly expressed in prostate, moderately in kidney, heart, brain, spleen, testis, placenta, small intestine, pancreas, skeletal muscle and peripheral blood leukocytes, and weakly in ovary, colon and thymus. Weakly expressed in all normal cell lines tested. Overexpressed in various cancer cell lines. Ref.1 Ref.4 |
| Sequence similarities | Contains 1 PH domain. Contains 1 REM (Hr1) repeat. |
| Sequence caution | The sequence AAL16767.1 differs from that shown. Reason: Frameshift at positions 15 and 20. |
Ontologies
| Keywords | |
|---|---|
| Biological process | Apoptosis |
| Coding sequence diversity | Alternative splicing |
| Ligand | GTP-binding Nucleotide-binding |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological process | Rho protein signal transduction Inferred from direct assay Ref.4. Source: UniProtKB apoptotic processInferred from electronic annotation. Source: UniProtKB-KW regulation of anti-apoptosisInferred from direct assay Ref.4. Source: UniProtKB |
| Cellular component | intracellular Inferred from electronic annotation. Source: InterPro |
| Molecular function | GTP binding Inferred from electronic annotation. Source: UniProtKB-KW GTP-Rho bindingInferred from direct assay Ref.3. Source: UniProtKB GTPase inhibitor activityInferred from direct assay Ref.3. Source: UniProtKB |
| Complete GO annotation... | |
Alternative products
| This entry describes 3 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 Ref.1 (identifier: Q9BST9-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 Ref.2 (identifier: Q9BST9-2) The sequence of this isoform differs from the canonical sequence as follows: 1-36: MFSRNHRSRVTVARGSALEMEFKRGRFRLSLFSDLP → MQDRLHILEDLNMLYIRQMALSL | ||||||
| Note: No experimental confirmation available. | ||||||
| Isoform 3 Ref.3 (identifier: Q9BST9-3) The sequence of this isoform differs from the canonical sequence as follows: 1-36: MFSRNHRSRV...FRLSLFSDLP → SESGLVSCLE...LSLSSLLWKS | ||||||
| Note: Incomplete sequence. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 563 | 563 | Rhotekin | PRO_0000233940 | |||||
Regions | |||||||||
| Repeat | 36 – 99 | 64 | REM | ||||||
| Domain | 309 – 416 | 108 | PH | ||||||
| Compositional bias | 479 – 544 | 66 | Pro-rich | ||||||
Amino acid modifications | |||||||||
| Modified residue | 106 | 1 | Phosphoserine Ref.7 | ||||||
| Modified residue | 232 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 241 | 1 | Phosphoserine Ref.6 | ||||||
| Modified residue | 520 | 1 | Phosphoserine By similarity | ||||||
| Modified residue | 543 | 1 | Phosphoserine Ref.6 | ||||||
Natural variations | |||||||||
| Alternative sequence | 1 – 36 | 36 | MFSRN…FSDLP → MQDRLHILEDLNMLYIRQMA LSL in isoform 2. Ref.2 | VSP_052004 | |||||
| Alternative sequence | 1 – 36 | 36 | MFSRN…FSDLP → SESGLVSCLEGKGPAEGSGD SSRQAHPCLPLSLSSLLWKS in isoform 3. Ref.3 | VSP_052005 | |||||
Experimental info | |||||||||
| Mutagenesis | 561 – 563 | 3 | SPV → APA: Impairs interaction with TAX1BP3. Ref.3 | ||||||
| Sequence conflict | 18 – 19 | 2 | LE → WR Ref.1 | ||||||
| Sequence conflict | 55 | 1 | A → P in AAL16767. Ref.1 | ||||||
| Sequence conflict | 61 | 1 | A → P in AAL16767. Ref.1 | ||||||
| Sequence conflict | 65 – 66 | 2 | RE → AR in AAL16767. Ref.1 | ||||||
| Sequence conflict | 102 | 1 | S → N in AAL16767. Ref.1 | ||||||
| Sequence conflict | 112 | 1 | A → P in AAL16767. Ref.1 | ||||||
| Sequence conflict | 160 | 1 | Q → H in AAG01181. Ref.3 | ||||||
| Sequence conflict | 163 | 1 | E → D in AAG01181. Ref.3 | ||||||
| Sequence conflict | 178 | 1 | S → N in AAG01181. Ref.3 | ||||||
| Sequence conflict | 202 – 205 | 4 | EEGA → KKRG in AAG01181. Ref.3 | ||||||
| Sequence conflict | 227 | 1 | R → K in AAG01181. Ref.3 | ||||||
| Sequence conflict | 274 | 1 | R → L in AAL16767. Ref.1 | ||||||
| Sequence conflict | 336 | 1 | G → S in AAG01181. Ref.3 | ||||||
| Sequence conflict | 356 | 1 | L → F in AAL16767. Ref.1 | ||||||
| Sequence conflict | 365 – 366 | 2 | RV → PI in AAG01181. Ref.3 | ||||||
| Sequence conflict | 372 | 1 | D → E in AAG01181. Ref.3 | ||||||
| Sequence conflict | 401 – 406 | 6 | REALQS → LETLQN in AAG01181. Ref.3 | ||||||
| Sequence conflict | 437 – 439 | 3 | RKP → PKT in AAG01181. Ref.3 | ||||||
| Sequence conflict | 454 | 1 | A → V in AAG01181. Ref.3 | ||||||
| Sequence conflict | 540 | 1 | P → T in AAG01181. Ref.3 | ||||||
| Sequence conflict | 549 | 1 | L → F in AAG01181. Ref.3 | ||||||
| Sequence conflict | 555 | 1 | P → L in AAG01181. Ref.3 | ||||||
Sequences
| ||||||||||||||||||||||||||||||
References
| « Hide 'large scale' references | |
| [1] | "Molecular cloning, expression characterization, and mapping of a novel putative inhibitor of rho GTPase activity, RTKN, to D2S145-D2S286." Fu Q., Yu L., Liu Q., Zhang J., Zhang H., Zhao S. Genomics 66:328-332(2000) [PubMed: 10873388] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 1), TISSUE SPECIFICITY. Tissue: Kidney. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed: 15489334] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Brain and Placenta. |
| [3] | "The PDZ protein TIP-1 interacts with the Rho effector rhotekin and is involved in Rho signaling to the serum response element." Reynaud C., Fabre S., Jalinot P. J. Biol. Chem. 275:33962-33968(2000) [PubMed: 10940294] [Abstract] Cited for: PARTIAL NUCLEOTIDE SEQUENCE [MRNA] (ISOFORM 3), FUNCTION, INTERACTION WITH RHOA AND TAX1BP3, MUTAGENESIS OF 561-SER--VAL-563. Tissue: Leukocyte. |
| [4] | "Rho/Rhotekin-mediated NF-kappaB activation confers resistance to apoptosis." Liu C.-A., Wang M.-J., Chi C.-W., Wu C.-W., Chen J.-Y. Oncogene 23:8731-8742(2004) [PubMed: 15480428] [Abstract] Cited for: FUNCTION, TISSUE SPECIFICITY. |
| [5] | "Possible role of Rho/Rhotekin signaling in mammalian septin organization." Ito H., Iwamoto I., Morishita R., Nozawa Y., Narumiya S., Asano T., Nagata K. Oncogene 24:7064-7072(2005) [PubMed: 16007136] [Abstract] Cited for: FUNCTION, INTERACTION WITH SEPT9. |
| [6] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed: 18669648] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-232; SER-241 AND SER-543, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [7] | "Large-scale proteomics analysis of the human kinome." Oppermann F.S., Gnad F., Olsen J.V., Hornberger R., Greff Z., Keri G., Mann M., Daub H. Mol. Cell. Proteomics 8:1751-1764(2009) [PubMed: 19369195] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-106, MASS SPECTROMETRY. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AF049227 mRNA. Translation: AAL16767.1. Frameshift. BC004558 mRNA. Translation: AAH04558.2. BC017727 mRNA. Translation: AAH17727.1. AF290512 mRNA. Translation: AAG01181.1. |
| IPI | IPI00029834. IPI00157230. IPI00386977. |
| RefSeq | NP_001015055.1. NM_001015055.1. NP_001015056.1. NM_001015056.1. NP_149035.1. NM_033046.2. |
| UniGene | Hs.192854. |
3D structure databases | |
| ProteinModelPortal | Q9BST9. |
| SMR | Q9BST9. Positions 311-415. |
| ModBase | Search... |
Protein-protein interaction databases | |
| IntAct | Q9BST9. 2 interactions. |
| MINT | MINT-142514. |
| STRING | Q9BST9. |
PTM databases | |
| PhosphoSite | Q9BST9. |
Polymorphism databases | |
| DMDM | 74733052. |
Proteomic databases | |
| PRIDE | Q9BST9. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000272430; ENSP00000272430; ENSG00000114993. |
| GeneID | 6242. |
| KEGG | hsa:6242. |
| UCSC | uc002sle.1. human. |
Organism-specific databases | |
| CTD | 6242. |
| GeneCards | GC02M074653. |
| H-InvDB | HIX0002182. |
| HGNC | HGNC:10466. RTKN. |
| HPA | HPA030259. |
| MIM | 602288. gene. |
| neXtProt | NX_Q9BST9. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | prNOG04291. |
| GeneTree | ENSGT00390000000104. |
| HOGENOM | HBG715547. |
| HOVERGEN | HBG059480. |
| InParanoid | Q9BST9. |
| OMA | HEMAIEP. |
Gene expression databases | |
| ArrayExpress | Q9BST9. |
| Bgee | Q9BST9. |
| CleanEx | HS_RTKN. |
| Genevestigator | Q9BST9. |
| GermOnline | ENSG00000114993. Homo sapiens. |
Family and domain databases | |
| InterPro | IPR011072. HR1_rho-bd. IPR011993. PH_type. IPR001849. Pleckstrin_homology. [Graphical view] |
| Gene3D | G3DSA:2.30.29.30. PH_type. 1 hit. |
| Pfam | PF02185. HR1. 1 hit. PF00169. PH. 1 hit. [Graphical view] |
| SMART | SM00742. Hr1. 1 hit. SM00233. PH. 1 hit. [Graphical view] |
| PROSITE | PS50003. PH_DOMAIN. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| NextBio | 24241. |
| SOURCE | Search... |
Entry information
| Entry name | RTKN_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BST9 Secondary accession number(s): Q8WVN1, Q96PT6, Q9HB05 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 2 Human chromosome 2: entries, gene names and cross-references to MIM |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with