Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Rhotekin

Gene

RTKN

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

Mediates Rho signaling to activate NF-kappa-B and may confer increased resistance to apoptosis to cells in gastric tumorigenesis. May play a novel role in the organization of septin structures.3 Publications

GO - Molecular functioni

  • GTPase inhibitor activity Source: UniProtKB
  • GTP binding Source: UniProtKB-KW
  • GTP-Rho binding Source: UniProtKB

GO - Biological processi

  • apoptotic process Source: UniProtKB-KW
  • regulation of apoptotic process Source: UniProtKB
  • Rho protein signal transduction Source: UniProtKB
  • septin cytoskeleton organization Source: InterPro
  • signal transduction Source: UniProtKB

Keywordsi

Biological processApoptosis
LigandGTP-binding, Nucleotide-binding

Enzyme and pathway databases

ReactomeiR-HSA-5666185 RHO GTPases Activate Rhotekin and Rhophilins
SIGNORiQ9BST9

Names & Taxonomyi

Protein namesi
Recommended name:
Rhotekin
Gene namesi
Name:RTKNImported
Synonyms:RTKN1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 2

Organism-specific databases

EuPathDBiHostDB:ENSG00000114993.15
HGNCiHGNC:10466 RTKN
MIMi602288 gene
neXtProtiNX_Q9BST9

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Pathology & Biotechi

Mutagenesis

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Mutagenesisi561 – 563SPV → APA: Impairs interaction with TAX1BP3. 1 Publication3

Organism-specific databases

DisGeNETi6242
OpenTargetsiENSG00000114993
PharmGKBiPA34879

Polymorphism and mutation databases

BioMutaiRTKN
DMDMi74733052

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002339401 – 563RhotekinAdd BLAST563

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei14Omega-N-methylarginineCombined sources1
Modified residuei30PhosphoserineCombined sources1
Modified residuei106PhosphoserineCombined sources1
Modified residuei230Asymmetric dimethylarginineBy similarity1
Modified residuei232PhosphoserineCombined sources1
Modified residuei520PhosphoserineCombined sources1
Modified residuei529PhosphoserineCombined sources1
Modified residuei543PhosphoserineCombined sources1

Keywords - PTMi

Methylation, Phosphoprotein

Proteomic databases

EPDiQ9BST9
MaxQBiQ9BST9
PaxDbiQ9BST9
PeptideAtlasiQ9BST9
PRIDEiQ9BST9

PTM databases

iPTMnetiQ9BST9
PhosphoSitePlusiQ9BST9

Expressioni

Tissue specificityi

Highly expressed in prostate, moderately in kidney, heart, brain, spleen, testis, placenta, small intestine, pancreas, skeletal muscle and peripheral blood leukocytes, and weakly in ovary, colon and thymus. Weakly expressed in all normal cell lines tested. Overexpressed in various cancer cell lines.2 Publications

Gene expression databases

BgeeiENSG00000114993
CleanExiHS_RTKN
ExpressionAtlasiQ9BST9 baseline and differential
GenevisibleiQ9BST9 HS

Organism-specific databases

HPAiHPA030259

Interactioni

Subunit structurei

Interacts via its C-terminal region with the TAX1BP3 PDZ domain. This interaction facilitates Rho-mediated activation of the c-Fos serum response element (SRE). Interacts with SEPT9. Specifically binds to GTP-bound RHOA, RHOB and RHOC and inhibits their GTPase activity.By similarity2 Publications

Binary interactionsi

Show more details

GO - Molecular functioni

  • GTP-Rho binding Source: UniProtKB

Protein-protein interaction databases

BioGridi112156, 76 interactors
DIPiDIP-31098N
IntActiQ9BST9, 11 interactors
MINTiQ9BST9
STRINGi9606.ENSP00000272430

Structurei

3D structure databases

ProteinModelPortaliQ9BST9
SMRiQ9BST9
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini17 – 98REM-1PROSITE-ProRule annotationAdd BLAST82
Domaini309 – 416PHPROSITE-ProRule annotationAdd BLAST108

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi479 – 544Pro-richSequence analysisAdd BLAST66

Keywords - Domaini

Coiled coil

Phylogenomic databases

eggNOGiENOG410IIHF Eukaryota
ENOG410ZX8Y LUCA
GeneTreeiENSGT00390000000104
HOGENOMiHOG000015094
HOVERGENiHBG059480
InParanoidiQ9BST9
OMAiAERSPCR
OrthoDBiEOG091G09OJ
PhylomeDBiQ9BST9
TreeFamiTF331476

Family and domain databases

Gene3Di2.30.29.30, 1 hit
InterProiView protein in InterPro
IPR012966 AHD
IPR011072 HR1_rho-bd
IPR011993 PH-like_dom_sf
IPR001849 PH_domain
IPR030471 RTKN
PANTHERiPTHR21538:SF19 PTHR21538:SF19, 1 hit
PfamiView protein in Pfam
PF08174 Anillin, 1 hit
PF00169 PH, 1 hit
SMARTiView protein in SMART
SM00742 Hr1, 1 hit
SM00233 PH, 1 hit
PROSITEiView protein in PROSITE
PS50003 PH_DOMAIN, 1 hit
PS51860 REM_1, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 11 Publication (identifier: Q9BST9-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MFSRNHRSRV TVARGSALEM EFKRGRFRLS LFSDLPEDTE LQRKLDHEIR
60 70 80 90 100
MREGACKLLA ACSQREQALE ATKSLLVCNS RILSYMGELQ RRKEAQVLGK
110 120 130 140 150
TSRRPSDSGP PAERSPCRGR VCISDLRIPL MWKDTEYFKN KGDLHRWAVF
160 170 180 190 200
LLLQLGEHIQ DTEMILVDRT LTDISFQSNV LFAEAGPDFE LRLELYGACV
210 220 230 240 250
EEEGALTGGP KRLATKLSSS LGRSSGRRVR ASLDSAGGSG SSPILLPTPV
260 270 280 290 300
VGGPRYHLLA HTTLTLAAVQ DGFRTHDLTL ASHEENPAWL PLYGSVCCRL
310 320 330 340 350
AAQPLCMTQP TASGTLRVQQ AGEMQNWAQV HGVLKGTNLF CYRQPEDADT
360 370 380 390 400
GEEPLLTIAV NKETRVRAGE LDQALGRPFT LSISNQYGDD EVTHTLQTES
410 420 430 440 450
REALQSWMEA LWQLFFDMSQ WKQCCDEIMK IETPAPRKPP QALAKQGSLY
460 470 480 490 500
HEMAIEPLDD IAAVTDILTQ REGARLETPP PWLAMFTDQP ALPNPCSPAS
510 520 530 540 550
VAPAPDWTHP LPWGRPRTFS LDAVPPDHSP RARSVAPLPP QRSPRTRGLC
560
SKGQPRTWLQ SPV
Length:563
Mass (Da):62,667
Last modified:March 1, 2004 - v2
Checksum:iB3C64CB737E88501
GO
Isoform 21 Publication (identifier: Q9BST9-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-36: MFSRNHRSRVTVARGSALEMEFKRGRFRLSLFSDLP → MQDRLHILEDLNMLYIRQMALSL

Note: No experimental confirmation available.
Show »
Length:550
Mass (Da):61,229
Checksum:i606C424DF55DD690
GO
Isoform 31 Publication (identifier: Q9BST9-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-50: Missing.

Note: Incomplete sequence.1 Publication
Show »
Length:513
Mass (Da):56,666
Checksum:i9846C3E5E95D609A
GO

Sequence cautioni

The sequence AAL16767 differs from that shown. Reason: Frameshift at positions 15 and 20.Curated

Experimental Info

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Sequence conflicti18 – 19LE → WR (PubMed:10873388).Curated2
Sequence conflicti55A → P in AAL16767 (PubMed:10873388).Curated1
Sequence conflicti61A → P in AAL16767 (PubMed:10873388).Curated1
Sequence conflicti65 – 66RE → AR in AAL16767 (PubMed:10873388).Curated2
Sequence conflicti102S → N in AAL16767 (PubMed:10873388).Curated1
Sequence conflicti112A → P in AAL16767 (PubMed:10873388).Curated1
Sequence conflicti160Q → H in AAG01181 (PubMed:10940294).Curated1
Sequence conflicti163E → D in AAG01181 (PubMed:10940294).Curated1
Sequence conflicti178S → N in AAG01181 (PubMed:10940294).Curated1
Sequence conflicti202 – 205EEGA → KKRG in AAG01181 (PubMed:10940294).Curated4
Sequence conflicti227R → K in AAG01181 (PubMed:10940294).Curated1
Sequence conflicti274R → L in AAL16767 (PubMed:10873388).Curated1
Sequence conflicti336G → S in AAG01181 (PubMed:10940294).Curated1
Sequence conflicti356L → F in AAL16767 (PubMed:10873388).Curated1
Sequence conflicti365 – 366RV → PI in AAG01181 (PubMed:10940294).Curated2
Sequence conflicti372D → E in AAG01181 (PubMed:10940294).Curated1
Sequence conflicti401 – 406REALQS → LETLQN in AAG01181 (PubMed:10940294).Curated6
Sequence conflicti437 – 439RKP → PKT in AAG01181 (PubMed:10940294).Curated3
Sequence conflicti454A → V in AAG01181 (PubMed:10940294).Curated1
Sequence conflicti540P → T in AAG01181 (PubMed:10940294).Curated1
Sequence conflicti549L → F in AAG01181 (PubMed:10940294).Curated1
Sequence conflicti555P → L in AAG01181 (PubMed:10940294).Curated1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0520051 – 50Missing in isoform 3. 1 PublicationAdd BLAST50
Alternative sequenceiVSP_0520041 – 36MFSRN…FSDLP → MQDRLHILEDLNMLYIRQMA LSL in isoform 2. 1 PublicationAdd BLAST36

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AF049227 mRNA Translation: AAL16767.1 Frameshift.
AF290512 mRNA Translation: AAG01181.1
AC005041 Genomic DNA No translation available.
BC004558 mRNA Translation: AAH04558.2
BC017727 mRNA Translation: AAH17727.1
CCDSiCCDS1941.1 [Q9BST9-2]
CCDS33226.1 [Q9BST9-1]
CCDS42699.1 [Q9BST9-3]
RefSeqiNP_001015055.1, NM_001015055.1 [Q9BST9-1]
NP_001015056.1, NM_001015056.1 [Q9BST9-3]
NP_149035.1, NM_033046.2 [Q9BST9-2]
XP_016860124.1, XM_017004635.1 [Q9BST9-2]
UniGeneiHs.192854

Genome annotation databases

EnsembliENST00000233330; ENSP00000233330; ENSG00000114993 [Q9BST9-3]
ENST00000272430; ENSP00000272430; ENSG00000114993 [Q9BST9-1]
ENST00000305557; ENSP00000305298; ENSG00000114993 [Q9BST9-2]
GeneIDi6242
KEGGihsa:6242
UCSCiuc002slc.4 human [Q9BST9-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiRTKN_HUMAN
AccessioniPrimary (citable) accession number: Q9BST9
Secondary accession number(s): H7BXD4
, Q8WVN1, Q96PT6, Q9HB05
Entry historyiIntegrated into UniProtKB/Swiss-Prot: May 2, 2006
Last sequence update: March 1, 2004
Last modified: May 23, 2018
This is version 146 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Cookie policy

We would like to use anonymized google analytics cookies to gather statistics on how uniprot.org is used in aggregate. Learn more

UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health