Q9BSQ5 (CCM2_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
May 1, 2013.
Version 97.
History...
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Interactions·Alt products·Sequence annotation·Sequences·References·Web links·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Malcavernin Alternative name(s): Cerebral cavernous malformations 2 protein | ||||||
| Gene names |
| ||||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||||
| Taxonomic identifier | 9606 [NCBI] | ||||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 444 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Component of the CCM signaling pathway which is a crucial regulator of heart and vessel formation and integrity. May act through the stabilization of endothelial cell junctions By similarity. May function as a scaffold protein for MAP2K3-MAP3K3 signaling. Seems to play a major role in the modulation of MAP3K3-dependent p38 activation induced by hyperosmotic shock By similarity. |
| Subunit structure | Part of a complex with MAP2K3, MAP3K3 and RAC1. Binds RAC1 directly and independently of its nucleotide-bound state By similarity. Interacts with HEG1 and KRIT1; KRIT1 greatly facilitates the interaction with HEG1 By similarity. Interacts with PDCD10. Ref.10 Ref.11 |
| Subcellular location | Cytoplasm By similarity. |
| Domain | The C-terminal region constitutes an independently folded domain that has structural similarity with the USH1C (harmonin) N-terminus, despite very low sequence similarity. Ref.11 |
| Involvement in disease | Cerebral cavernous malformations 2 (CCM2) [MIM:603284]: A congenital vascular anomaly of the central nervous system that can result in hemorrhagic stroke, seizures, recurrent headaches, and focal neurologic deficits. The lesions are characterized by grossly enlarged blood vessels consisting of a single layer of endothelium and without any intervening neural tissue, ranging in diameter from a few millimeters to several centimeters. |
| Sequence similarities | Belongs to the CCM2 family. Contains 1 PID domain. |
Ontologies
| Keywords | |
|---|---|
| Cellular component | Cytoplasm |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Disease | Disease mutation |
| Molecular function | Developmental protein |
| PTM | Phosphoprotein |
| Technical term | 3D-structure Complete proteome Direct protein sequencing Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | endothelial tube morphogenesis Inferred from mutant phenotype PubMed 19151727. Source: MGI integrin-mediated signaling pathwayTraceable author statement PubMed 16037064. Source: UniProtKB stress-activated MAPK cascadeTraceable author statement PubMed 16037064. Source: UniProtKB vasculogenesisInferred from mutant phenotype Ref.12. Source: UniProtKB |
| Cellular_component | cytoplasm Inferred from direct assay PubMed 16037064. Source: UniProtKB |
| Complete GO annotation... | |
Binary interactions
With | Entry | #Exp. | IntAct | Notes |
|---|---|---|---|---|
| KRIT1 | O00522 | 3 | EBI-1573056,EBI-1573121 | |
| PDCD10 | Q9BUL8 | 4 | EBI-1573056,EBI-740195 |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BSQ5-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BSQ5-2) The sequence of this isoform differs from the canonical sequence as follows: 1-10: MEEEGKKGKK → MHSSCRQRRNQNLSKEIPQTEFHTGYSMENE |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | |||||||||||||||||
Molecule processing | ||||||||||||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 444 | 444 | Malcavernin | PRO_0000089424 | ||||||||||||||||||
Regions | ||||||||||||||||||||||
| Domain | 59 – 248 | 190 | PID | |||||||||||||||||||
| Region | 283 – 376 | 94 | Harmonin homology domain | |||||||||||||||||||
Amino acid modifications | ||||||||||||||||||||||
| Modified residue | 384 | 1 | Phosphoserine Ref.9 | |||||||||||||||||||
Natural variations | ||||||||||||||||||||||
| Alternative sequence | 1 – 10 | 10 | MEEEGKKGKK → MHSSCRQRRNQNLSKEIPQT EFHTGYSMENE in isoform 2. | VSP_024402 | ||||||||||||||||||
| Natural variant | 53 | 1 | V → I. Ref.12 Corresponds to variant rs2107732 [ dbSNP | Ensembl ]. | VAR_023575 | ||||||||||||||||||
| Natural variant | 120 | 1 | V → I. Ref.12 Corresponds to variant rs11552377 [ dbSNP | Ensembl ]. | VAR_023576 | ||||||||||||||||||
| Natural variant | 198 | 1 | L → R in CCM2. Ref.12 | VAR_023577 | ||||||||||||||||||
| Natural variant | 215 | 1 | Q → H in CCM2; associated with Q-229. Ref.13 | VAR_067352 | ||||||||||||||||||
| Natural variant | 229 | 1 | L → Q in CCM2; associated with H-215. Ref.13 | VAR_067353 | ||||||||||||||||||
| Natural variant | 289 | 1 | S → N. Corresponds to variant rs2289366 [ dbSNP | Ensembl ]. | VAR_050768 | ||||||||||||||||||
Experimental info | ||||||||||||||||||||||
| Sequence conflict | 268 | 1 | F → C in BAG53562. Ref.1 | |||||||||||||||||||
| Sequence conflict | 440 | 1 | D → A in AAQ15228. Ref.2 | |||||||||||||||||||
| Sequence conflict | 444 | 1 | A → ALWTVDGGAPTPSAQLS in AAQ15228. Ref.2 | |||||||||||||||||||
Secondary structure | ||||||||||||||||||||||
Helix Strand Turn | ||||||||||||||||||||||
| Helix | 288 – 291 | 4 | ||||||||||||||||||||
| Helix | 293 – 306 | 14 | ||||||||||||||||||||
| Turn | 307 – 309 | 3 | ||||||||||||||||||||
| Helix | 312 – 326 | 15 | ||||||||||||||||||||
| Helix | 331 – 342 | 12 | ||||||||||||||||||||
| Helix | 344 – 356 | 13 | ||||||||||||||||||||
| Helix | 359 – 371 | 13 | ||||||||||||||||||||
Sequences
| ||||||||||||||||||||||||
References
Web resources
Cross-references
Sequence databases | |||||||||||||
|---|---|---|---|---|---|---|---|---|---|---|---|---|---|
| EMBL GenBank DDBJ | AK098005 mRNA. Translation: BAG53562.1. AF370392 mRNA. Translation: AAQ15228.1. AC004847 Genomic DNA. No translation available. AC013416 Genomic DNA. No translation available. CH236960 Genomic DNA. Translation: EAL23746.1. CH471128 Genomic DNA. Translation: EAW61061.1. CH471128 Genomic DNA. Translation: EAW61064.1. BC004903 mRNA. Translation: AAH04903.1. BC008859 mRNA. Translation: AAH08859.1. BC016832 mRNA. Translation: AAH16832.1. BC025958 mRNA. Translation: AAH25958.1. | ||||||||||||
| IPI | IPI00465425. IPI00619952. | ||||||||||||
| RefSeq | NP_001025006.1. NM_001029835.2. NP_001161407.1. NM_001167935.1. NP_113631.1. NM_031443.3. | ||||||||||||
| UniGene | Hs.148272. | ||||||||||||
3D structure databases | |||||||||||||
| PDBe RCSB PDB PDBj |
| ||||||||||||
| ProteinModelPortal | Q9BSQ5. | ||||||||||||
| ModBase | Search... | ||||||||||||
Protein-protein interaction databases | |||||||||||||
| IntAct | Q9BSQ5. 3 interactions. | ||||||||||||
| STRING | 9606.ENSP00000370503. | ||||||||||||
PTM databases | |||||||||||||
| PhosphoSite | Q9BSQ5. | ||||||||||||
Polymorphism databases | |||||||||||||
| DMDM | 74733042. | ||||||||||||
Proteomic databases | |||||||||||||
| PaxDb | Q9BSQ5. | ||||||||||||
| PRIDE | Q9BSQ5. | ||||||||||||
Protocols and materials databases | |||||||||||||
| DNASU | 83605. | ||||||||||||
| StructuralBiologyKnowledgebase | Search... | ||||||||||||
Genome annotation databases | |||||||||||||
| Ensembl | ENST00000258781; ENSP00000258781; ENSG00000136280. ENST00000381112; ENSP00000370503; ENSG00000136280. | ||||||||||||
| GeneID | 83605. | ||||||||||||
| KEGG | hsa:83605. | ||||||||||||
| UCSC | uc003tmo.3. human. | ||||||||||||
Organism-specific databases | |||||||||||||
| CTD | 83605. | ||||||||||||
| GeneCards | GC07P045039. | ||||||||||||
| HGNC | HGNC:21708. CCM2. | ||||||||||||
| HPA | HPA020273. HPA021669. | ||||||||||||
| MIM | 603284. phenotype. 607929. gene. | ||||||||||||
| neXtProt | NX_Q9BSQ5. | ||||||||||||
| Orphanet | 221061. Hereditary cerebral cavernous malformation. | ||||||||||||
| PharmGKB | PA26145. | ||||||||||||
| GenAtlas | Search... | ||||||||||||
Phylogenomic databases | |||||||||||||
| eggNOG | NOG39125. | ||||||||||||
| HOGENOM | HOG000231916. | ||||||||||||
| HOVERGEN | HBG054451. | ||||||||||||
| OMA | AVSYIRD. | ||||||||||||
| OrthoDB | EOG4RFKSP. | ||||||||||||
| PhylomeDB | Q9BSQ5. | ||||||||||||
Enzyme and pathway databases | |||||||||||||
| Pathway_Interaction_DB | p38_mkk3_6pathway. p38 MAPK signaling pathway. p38alphabetapathway. Regulation of p38-alpha and p38-beta. | ||||||||||||
Gene expression databases | |||||||||||||
| ArrayExpress | Q9BSQ5. | ||||||||||||
| Bgee | Q9BSQ5. | ||||||||||||
| CleanEx | HS_CCM2. | ||||||||||||
| Genevestigator | Q9BSQ5. | ||||||||||||
| GermOnline | ENSG00000136280. Homo sapiens. | ||||||||||||
Family and domain databases | |||||||||||||
| Gene3D | 2.30.29.30. 1 hit. | ||||||||||||
| InterPro | IPR026159. Malcavernin. IPR011993. PH_like_dom. IPR006020. PTyr_interaction_dom. [Graphical view] | ||||||||||||
| PANTHER | PTHR21642. PTHR21642. 1 hit. | ||||||||||||
| PROSITE | PS01179. PID. 1 hit. [Graphical view] | ||||||||||||
| ProtoNet | Search... | ||||||||||||
Other | |||||||||||||
| GenomeRNAi | 83605. | ||||||||||||
| NextBio | 35470159. | ||||||||||||
| SOURCE | Search... | ||||||||||||
Entry information
| Entry name | CCM2_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BSQ5 Secondary accession number(s): A4D2L4 Q8TAT4 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 7 Human chromosome 7: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| PDB cross-references Index of Protein Data Bank (PDB) cross-references |
| SIMILARITY comments Index of protein domains and families |

Clusters with
