Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Nicolin-1

Gene

NICN1

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 2 out of 5-Experimental evidence at transcript leveli

Names & Taxonomyi

Protein namesi
Recommended name:
Nicolin-1
Alternative name(s):
NPCEDRG
Tubulin polyglutamylase complex subunit 5
Short name:
PGs5
Gene namesi
Name:NICN1
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 3

Organism-specific databases

HGNCiHGNC:18317. NICN1.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Microtubule, Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA31623.

Polymorphism and mutation databases

BioMutaiNICN1.
DMDMi51701690.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 213213Nicolin-1PRO_0000096814Add
BLAST

Proteomic databases

MaxQBiQ9BSH3.
PaxDbiQ9BSH3.
PRIDEiQ9BSH3.

PTM databases

iPTMnetiQ9BSH3.
PhosphoSiteiQ9BSH3.

Expressioni

Tissue specificityi

High expression level is found in brain, testis, liver and kidney. Weak expression in spleen, leukocytes, small intestine and colon.1 Publication

Gene expression databases

BgeeiENSG00000145029.
CleanExiHS_NICN1.
ExpressionAtlasiQ9BSH3. baseline and differential.
GenevisibleiQ9BSH3. HS.

Organism-specific databases

HPAiHPA037550.

Interactioni

Subunit structurei

Part of the neuronal tubulin polyglutamylase complex which contains TPGS1, TPGS2, TTLL1, LRRC49 and NICN1.By similarity

Protein-protein interaction databases

BioGridi124003. 9 interactions.
STRINGi9606.ENSP00000273598.

Structurei

3D structure databases

ProteinModelPortaliQ9BSH3.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Phylogenomic databases

eggNOGiENOG410IHPW. Eukaryota.
ENOG4111GDK. LUCA.
GeneTreeiENSGT00390000001505.
HOGENOMiHOG000006705.
HOVERGENiHBG052619.
InParanoidiQ9BSH3.
KOiK16607.
OMAiCDMARVL.
OrthoDBiEOG091G0NXM.
PhylomeDBiQ9BSH3.
TreeFamiTF329753.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BSH3-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSRVLVPCHV KGSVALQVGD VRTSQGRPGV LVIDVTFPSV APFELQEITF
60 70 80 90 100
KNYYTAFLSI RVRQYTSAHT PAKWVTCLRD YCLMPDPHSE EGAQEYVSLF
110 120 130 140 150
KHQMLCDMAR ISELRLILRQ PSPLWLSFTV EELQIYQQGP KSPSVTFPKW
160 170 180 190 200
LSHPVPCEQP ALLREGLPDP SRVSSEVQQM WALTEMIRAS HTSARIGRFD
210
VDGCYDLNLL SYT
Length:213
Mass (Da):24,202
Last modified:June 1, 2001 - v1
Checksum:i2170A24989952652
GO
Isoform 2 (identifier: Q9BSH3-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     166-213: GLPDPSRVSSEVQQMWALTEMIRASHTSARIGRFDVDGCYDLNLLSYT → VSPHPR

Show »
Length:171
Mass (Da):19,506
Checksum:iB331EF436850AE46
GO

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti45 – 462Missing in AAN52734 (Ref. 2) Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei166 – 21348GLPDP…LLSYT → VSPHPR in isoform 2. 1 PublicationVSP_011420Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ299740 mRNA. Translation: CAC82516.1.
AF538150 mRNA. Translation: AAN52734.1.
BC005050 mRNA. Translation: AAH05050.1.
BC050653 mRNA. Translation: AAH50653.1.
CCDSiCCDS2798.1. [Q9BSH3-1]
RefSeqiNP_115692.1. NM_032316.3. [Q9BSH3-1]
UniGeneiHs.191460.

Genome annotation databases

EnsembliENST00000273598; ENSP00000273598; ENSG00000145029. [Q9BSH3-1]
ENST00000423832; ENSP00000413115; ENSG00000145029. [Q9BSH3-1]
ENST00000615713; ENSP00000478287; ENSG00000145029. [Q9BSH3-1]
GeneIDi84276.
KEGGihsa:84276.
UCSCiuc003cwz.2. human. [Q9BSH3-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AJ299740 mRNA. Translation: CAC82516.1.
AF538150 mRNA. Translation: AAN52734.1.
BC005050 mRNA. Translation: AAH05050.1.
BC050653 mRNA. Translation: AAH50653.1.
CCDSiCCDS2798.1. [Q9BSH3-1]
RefSeqiNP_115692.1. NM_032316.3. [Q9BSH3-1]
UniGeneiHs.191460.

3D structure databases

ProteinModelPortaliQ9BSH3.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi124003. 9 interactions.
STRINGi9606.ENSP00000273598.

PTM databases

iPTMnetiQ9BSH3.
PhosphoSiteiQ9BSH3.

Polymorphism and mutation databases

BioMutaiNICN1.
DMDMi51701690.

Proteomic databases

MaxQBiQ9BSH3.
PaxDbiQ9BSH3.
PRIDEiQ9BSH3.

Protocols and materials databases

DNASUi84276.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000273598; ENSP00000273598; ENSG00000145029. [Q9BSH3-1]
ENST00000423832; ENSP00000413115; ENSG00000145029. [Q9BSH3-1]
ENST00000615713; ENSP00000478287; ENSG00000145029. [Q9BSH3-1]
GeneIDi84276.
KEGGihsa:84276.
UCSCiuc003cwz.2. human. [Q9BSH3-1]

Organism-specific databases

CTDi84276.
GeneCardsiNICN1.
HGNCiHGNC:18317. NICN1.
HPAiHPA037550.
MIMi611516. gene.
neXtProtiNX_Q9BSH3.
PharmGKBiPA31623.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410IHPW. Eukaryota.
ENOG4111GDK. LUCA.
GeneTreeiENSGT00390000001505.
HOGENOMiHOG000006705.
HOVERGENiHBG052619.
InParanoidiQ9BSH3.
KOiK16607.
OMAiCDMARVL.
OrthoDBiEOG091G0NXM.
PhylomeDBiQ9BSH3.
TreeFamiTF329753.

Miscellaneous databases

ChiTaRSiNICN1. human.
GenomeRNAii84276.
PROiQ9BSH3.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000145029.
CleanExiHS_NICN1.
ExpressionAtlasiQ9BSH3. baseline and differential.
GenevisibleiQ9BSH3. HS.

Family and domain databases

ProtoNetiSearch...

Entry informationi

Entry nameiNICN1_HUMAN
AccessioniPrimary (citable) accession number: Q9BSH3
Secondary accession number(s): Q8IZQ2
Entry historyi
Integrated into UniProtKB/Swiss-Prot: August 31, 2004
Last sequence update: June 1, 2001
Last modified: September 7, 2016
This is version 98 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 3
    Human chromosome 3: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.