Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

BTB/POZ domain-containing protein 10

Gene

BTBD10

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Plays a major role as an activator of AKT family members by inhibiting PPP2CA-mediated dephosphorylation, thereby keeping AKTs activated. Plays a role in preventing motor neuronal death and accelerating the growth of pancreatic beta cells.By similarity

GO - Biological processi

Names & Taxonomyi

Protein namesi
Recommended name:
BTB/POZ domain-containing protein 10
Alternative name(s):
Glucose metabolism-related protein 11 Publication
Gene namesi
Name:BTBD10
Synonyms:GMRP11 Publication
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 11

Organism-specific databases

EuPathDBiHostDB:ENSG00000148925.10.
HGNCiHGNC:21445. BTBD10.

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Cytoplasm, Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi84280.
OpenTargetsiENSG00000148925.
PharmGKBiPA142672543.

Polymorphism and mutation databases

BioMutaiBTBD10.
DMDMi74733002.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00002289851 – 475BTB/POZ domain-containing protein 10Add BLAST475

Proteomic databases

EPDiQ9BSF8.
MaxQBiQ9BSF8.
PaxDbiQ9BSF8.
PeptideAtlasiQ9BSF8.
PRIDEiQ9BSF8.

PTM databases

iPTMnetiQ9BSF8.
PhosphoSitePlusiQ9BSF8.

Expressioni

Tissue specificityi

Ubiquitously expressed. Highly expressed in adult brain, testis, aorta and small intestine and weakly expressed in the heart, lung, liver, kidney, pancreas, spleen, thymus, prostate, ovary and colon. Down-regulated in glioma.2 Publications

Gene expression databases

BgeeiENSG00000148925.
CleanExiHS_BTBD10.
ExpressionAtlasiQ9BSF8. baseline and differential.
GenevisibleiQ9BSF8. HS.

Organism-specific databases

HPAiHPA046777.

Interactioni

Subunit structurei

Interacts (via C-terminal 330-amino-acid region) with AKT1; AKT2 and AKT3. Interacts with PPP2CA and PPP1CA.By similarity

Protein-protein interaction databases

BioGridi124007. 10 interactors.
IntActiQ9BSF8. 8 interactors.
MINTiMINT-1376480.
STRINGi9606.ENSP00000278174.

Structurei

3D structure databases

ProteinModelPortaliQ9BSF8.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Domains and Repeats

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Domaini167 – 241BTBAdd BLAST75

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni146 – 475Interaction with AKT family membersBy similarityAdd BLAST330

Compositional bias

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Compositional biasi106 – 142Ser-richAdd BLAST37

Phylogenomic databases

eggNOGiKOG3840. Eukaryota.
ENOG410XSS5. LUCA.
GeneTreeiENSGT00390000007975.
HOGENOMiHOG000261659.
HOVERGENiHBG059410.
InParanoidiQ9BSF8.
KOiK10482.
OMAiFSCFCVS.
OrthoDBiEOG091G05SP.
PhylomeDBiQ9BSF8.
TreeFamiTF314369.

Family and domain databases

InterProiView protein in InterPro
IPR000210. BTB/POZ_dom.
IPR011333. SKP1/BTB/POZ.
SMARTiView protein in SMART
SM00225. BTB. 1 hit.
SUPFAMiSSF54695. SSF54695. 1 hit.

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BSF8-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MAGRPHPYDG NSSDPENWDR KLHSRPRKLY KHSSTSSRIA KGGVDHTKMS
60 70 80 90 100
LHGASGGHER SRDRRRSSDR SRDSSHERTE SQLTPCIRNV TSPTRQHHVE
110 120 130 140 150
REKDHSSSRP SSPRPQKASP NGSISSAGNS SRNSSQSSSD GSCKTAGEMV
160 170 180 190 200
FVYENAKEGA RNIRTSERVT LIVDNTRFVV DPSIFTAQPN TMLGRMFGSG
210 220 230 240 250
REHNFTRPNE KGEYEVAEGI GSTVFRAILD YYKTGIIRCP DGISIPELRE
260 270 280 290 300
ACDYLCISFE YSTIKCRDLS ALMHELSNDG ARRQFEFYLE EMILPLMVAS
310 320 330 340 350
AQSGERECHI VVLTDDDVVD WDEEYPPQMG EEYSQIIYST KLYRFFKYIE
360 370 380 390 400
NRDVAKSVLK ERGLKKIRLG IEGYPTYKEK VKKRPGGRPE VIYNYVQRPF
410 420 430 440 450
IRMSWEKEEG KSRHVDFQCV KSKSITNLAA AAADIPQDQL VVMHPTPQVD
460 470
ELDILPIHPP SGNSDLDPDA QNPML
Length:475
Mass (Da):53,779
Last modified:November 23, 2004 - v2
Checksum:i0D6433891EAA33A6
GO
Isoform 2 (identifier: Q9BSF8-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     1-33: MAGRPHPYDGNSSDPENWDRKLHSRPRKLYKHS → MPKDADLAFSASLFERAESLYTLISKFFSCFCVSTLAYTKG

Note: No experimental confirmation available.
Show »
Length:483
Mass (Da):54,406
Checksum:i60A410E3A24EDA6D
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_033638145T → A. Corresponds to variant dbSNP:rs34185489Ensembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_0555521 – 33MAGRP…LYKHS → MPKDADLAFSASLFERAESL YTLISKFFSCFCVSTLAYTK G in isoform 2. 1 PublicationAdd BLAST33

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AY221959 mRNA. Translation: AAO64360.1.
AK294259 mRNA. Translation: BAH11714.1.
AK316163 mRNA. Translation: BAH14534.1.
AL832981 mRNA. Translation: CAH56329.1.
AC016884 Genomic DNA. No translation available.
AC021269 Genomic DNA. No translation available.
BC005071 mRNA. Translation: AAH05071.2.
CCDSiCCDS73261.1. [Q9BSF8-2]
CCDS7811.1. [Q9BSF8-1]
RefSeqiNP_001284671.1. NM_001297742.1. [Q9BSF8-2]
NP_115696.2. NM_032320.6. [Q9BSF8-1]
XP_016873897.1. XM_017018408.1. [Q9BSF8-1]
UniGeneiHs.332382.

Genome annotation databases

EnsembliENST00000278174; ENSP00000278174; ENSG00000148925. [Q9BSF8-1]
ENST00000530907; ENSP00000431186; ENSG00000148925. [Q9BSF8-2]
GeneIDi84280.
KEGGihsa:84280.
UCSCiuc001mkz.4. human. [Q9BSF8-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Similar proteinsi

Entry informationi

Entry nameiBTBDA_HUMAN
AccessioniPrimary (citable) accession number: Q9BSF8
Secondary accession number(s): B7Z228, Q86WG1
Entry historyiIntegrated into UniProtKB/Swiss-Prot: March 21, 2006
Last sequence update: November 23, 2004
Last modified: September 27, 2017
This is version 123 of the entry and version 2 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 11
    Human chromosome 11: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot