Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

E3 ubiquitin-protein ligase TRIM56

Gene

TRIM56

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 5 out of 5-Experimental evidence at protein leveli

Functioni

E3 ubiquitin-protein ligase that mediates 'Lys-63'-linked polyubiquitination of TMEM173/STING, thereby playing a key role in innate immunity. TMEM173/STING 'Lys-63'-linked ubiquitination activates the production of type I interferon IFN-beta following detection of pathogen- and host-derived double-stranded DNA (By similarity).By similarity

Regions

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri21 – 6040RING-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri98 – 14952B box-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri164 – 20542B box-type 2PROSITE-ProRule annotationAdd
BLAST

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Molecular functioni

Ligase

Keywords - Biological processi

Antiviral defense, Immunity, Innate immunity, Ubl conjugation pathway

Keywords - Ligandi

Metal-binding, Zinc

Enzyme and pathway databases

ReactomeiR-HSA-3134975. Regulation of innate immune responses to cytosolic DNA.

Names & Taxonomyi

Protein namesi
Recommended name:
E3 ubiquitin-protein ligase TRIM56 (EC:6.3.2.-)
Alternative name(s):
RING finger protein 109
Tripartite motif-containing protein 56
Gene namesi
Name:TRIM56
Synonyms:RNF109
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 7

Organism-specific databases

HGNCiHGNC:19028. TRIM56.

Subcellular locationi

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Cytoplasm

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA134958549.

Polymorphism and mutation databases

BioMutaiTRIM56.
DMDMi56749788.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 755755E3 ubiquitin-protein ligase TRIM56PRO_0000056288Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei418 – 4181PhosphothreonineCombined sources
Modified residuei442 – 4421PhosphothreonineCombined sources
Modified residuei475 – 4751PhosphoserineCombined sources

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9BRZ2.
MaxQBiQ9BRZ2.
PaxDbiQ9BRZ2.
PeptideAtlasiQ9BRZ2.
PRIDEiQ9BRZ2.

PTM databases

iPTMnetiQ9BRZ2.
PhosphoSiteiQ9BRZ2.

Expressioni

Gene expression databases

BgeeiENSG00000169871.
CleanExiHS_TRIM56.
ExpressionAtlasiQ9BRZ2. baseline and differential.
GenevisibleiQ9BRZ2. HS.

Organism-specific databases

HPAiHPA024358.

Interactioni

Subunit structurei

Interacts with TMEM173/STING.By similarity

Protein-protein interaction databases

BioGridi123596. 20 interactions.
IntActiQ9BRZ2. 20 interactions.
STRINGi9606.ENSP00000305161.

Structurei

3D structure databases

ProteinModelPortaliQ9BRZ2.
SMRiQ9BRZ2. Positions 10-86.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Coiled coil

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Coiled coili216 – 31499Sequence analysisAdd
BLAST

Compositional bias

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Compositional biasi302 – 3098Poly-Ala
Compositional biasi459 – 4646Poly-Lys

Sequence similaritiesi

Belongs to the TRIM/RBCC family.Curated
Contains 2 B box-type zinc fingers.PROSITE-ProRule annotation
Contains 1 RING-type zinc finger.PROSITE-ProRule annotation

Zinc finger

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Zinc fingeri21 – 6040RING-typePROSITE-ProRule annotationAdd
BLAST
Zinc fingeri98 – 14952B box-type 1PROSITE-ProRule annotationAdd
BLAST
Zinc fingeri164 – 20542B box-type 2PROSITE-ProRule annotationAdd
BLAST

Keywords - Domaini

Coiled coil, Repeat, Zinc-finger

Phylogenomic databases

eggNOGiENOG410ITEJ. Eukaryota.
ENOG410YNG0. LUCA.
GeneTreeiENSGT00550000074377.
HOGENOMiHOG000154679.
HOVERGENiHBG079280.
InParanoidiQ9BRZ2.
KOiK12026.
OMAiAYHGLEK.
OrthoDBiEOG091G03B5.
PhylomeDBiQ9BRZ2.
TreeFamiTF338323.

Family and domain databases

Gene3Di2.120.10.30. 1 hit.
3.30.40.10. 1 hit.
InterProiIPR011042. 6-blade_b-propeller_TolB-like.
IPR027370. Znf-RING_LisH.
IPR000315. Znf_B-box.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF00643. zf-B_box. 1 hit.
PF13445. zf-RING_UBOX. 1 hit.
[Graphical view]
SMARTiSM00336. BBOX. 1 hit.
SM00184. RING. 1 hit.
[Graphical view]
PROSITEiPS50119. ZF_BBOX. 1 hit.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BRZ2-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVSHGSSPSL LEALSSDFLA CKICLEQLRA PKTLPCLHTY CQDCLAQLAD
60 70 80 90 100
GGRVRCPECR ETVPVPPEGV ASFKTNFFVN GLLDLVKARA CGDLRAGKPA
110 120 130 140 150
CALCPLVGGT STGGPATARC LDCADDLCQA CADGHRCTRQ THTHRVVDLV
160 170 180 190 200
GYRAGWYDEE ARERQAAQCP QHPGEALRFL CQPCSQLLCR ECRLDPHLDH
210 220 230 240 250
PCLPLAEAVR ARRPGLEGLL AGVDNNLVEL EAARRVEKEA LARLREQAAR
260 270 280 290 300
VGTQVEEAAE GVLRALLAQK QEVLGQLRAH VEAAEEAARE RLAELEGREQ
310 320 330 340 350
VARAAAAFAR RVLSLGREAE ILSLEGAIAQ RLRQLQGCPW APGPAPCLLP
360 370 380 390 400
QLELHPGLLD KNCHLLRLSF EEQQPQKDGG KDGAGTQGGE ESQSRREDEP
410 420 430 440 450
KTERQGGVQP QAGDGAQTPK EEKAQTTREE GAQTLEEDRA QTPHEDGGPQ
460 470 480 490 500
PHRGGRPNKK KKFKGRLKSI SREPSPALGP NLDGSGLLPR PIFYCSFPTR
510 520 530 540 550
MPGDKRSPRI TGLCPFGPRE ILVADEQNRA LKRFSLNGDY KGTVPVPEGC
560 570 580 590 600
SPCSVAALQS AVAFSASARL YLINPNGEVQ WRRALSLSQA SHAVAALPSG
610 620 630 640 650
DRVAVSVAGH VEVYNMEGSL ATRFIPGGKA SRGLRALVFL TTSPQGHFVG
660 670 680 690 700
SDWQQNSVVI CDGLGQVVGE YKGPGLHGCQ PGSVSVDKKG YIFLTLREVN
710 720 730 740 750
KVVILDPKGS LLGDFLTAYH GLEKPRVTTM VDGRYLVVSL SNGTIHIFRV

RSPDS
Length:755
Mass (Da):81,488
Last modified:December 21, 2004 - v3
Checksum:iCF72D0C8EC9F69E7
GO
Isoform 2 (identifier: Q9BRZ2-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     273-308: VLGQLRAHVEAAEEAARERLAELEGREQVARAAAAF → NHLNPGGGSCSELRSHHCTPAWVTRMKLHLKKKKKK
     309-755: Missing.

Note: No experimental confirmation available.
Show »
Length:308
Mass (Da):33,550
Checksum:iEB69C6B0CE90A126
GO
Isoform 3 (identifier: Q9BRZ2-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     259-269: AEGVLRALLAQ → CLLRTESCKAE
     270-755: Missing.

Show »
Length:269
Mass (Da):29,185
Checksum:iCA973592F7F41BB4
GO

Sequence cautioni

The sequence AAH11882 differs from that shown. Reason: Erroneous initiation. Translation N-terminally shortened.Curated
The sequence BAC11500 differs from that shown. Reason: Erroneous initiation. Translation N-terminally extended.Curated

Experimental Info

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Sequence conflicti230 – 2301L → P in AK092927 (PubMed:14702039).Curated

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei259 – 26911AEGVLRALLAQ → CLLRTESCKAE in isoform 3. 1 PublicationVSP_029109Add
BLAST
Alternative sequencei270 – 755486Missing in isoform 3. 1 PublicationVSP_029110Add
BLAST
Alternative sequencei273 – 30836VLGQL…AAAAF → NHLNPGGGSCSELRSHHCTP AWVTRMKLHLKKKKKK in isoform 2. 1 PublicationVSP_029111Add
BLAST
Alternative sequencei309 – 755447Missing in isoform 2. 1 PublicationVSP_029112Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK075255 mRNA. Translation: BAC11500.1. Different initiation.
AK092927 mRNA. No translation available.
AC105446 Genomic DNA. No translation available.
BC005847 mRNA. Translation: AAH05847.3.
BC011882 mRNA. Translation: AAH11882.1. Different initiation.
BC048194 mRNA. Translation: AAH48194.1.
AL512757 mRNA. Translation: CAC21676.1.
CCDSiCCDS43625.1. [Q9BRZ2-1]
RefSeqiNP_112223.1. NM_030961.2. [Q9BRZ2-1]
XP_011514891.1. XM_011516589.2. [Q9BRZ2-1]
UniGeneiHs.521092.

Genome annotation databases

EnsembliENST00000306085; ENSP00000305161; ENSG00000169871. [Q9BRZ2-1]
GeneIDi81844.
KEGGihsa:81844.
UCSCiuc003uxq.4. human. [Q9BRZ2-1]

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK075255 mRNA. Translation: BAC11500.1. Different initiation.
AK092927 mRNA. No translation available.
AC105446 Genomic DNA. No translation available.
BC005847 mRNA. Translation: AAH05847.3.
BC011882 mRNA. Translation: AAH11882.1. Different initiation.
BC048194 mRNA. Translation: AAH48194.1.
AL512757 mRNA. Translation: CAC21676.1.
CCDSiCCDS43625.1. [Q9BRZ2-1]
RefSeqiNP_112223.1. NM_030961.2. [Q9BRZ2-1]
XP_011514891.1. XM_011516589.2. [Q9BRZ2-1]
UniGeneiHs.521092.

3D structure databases

ProteinModelPortaliQ9BRZ2.
SMRiQ9BRZ2. Positions 10-86.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi123596. 20 interactions.
IntActiQ9BRZ2. 20 interactions.
STRINGi9606.ENSP00000305161.

PTM databases

iPTMnetiQ9BRZ2.
PhosphoSiteiQ9BRZ2.

Polymorphism and mutation databases

BioMutaiTRIM56.
DMDMi56749788.

Proteomic databases

EPDiQ9BRZ2.
MaxQBiQ9BRZ2.
PaxDbiQ9BRZ2.
PeptideAtlasiQ9BRZ2.
PRIDEiQ9BRZ2.

Protocols and materials databases

DNASUi81844.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000306085; ENSP00000305161; ENSG00000169871. [Q9BRZ2-1]
GeneIDi81844.
KEGGihsa:81844.
UCSCiuc003uxq.4. human. [Q9BRZ2-1]

Organism-specific databases

CTDi81844.
GeneCardsiTRIM56.
H-InvDBHIX0006941.
HGNCiHGNC:19028. TRIM56.
HPAiHPA024358.
neXtProtiNX_Q9BRZ2.
PharmGKBiPA134958549.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiENOG410ITEJ. Eukaryota.
ENOG410YNG0. LUCA.
GeneTreeiENSGT00550000074377.
HOGENOMiHOG000154679.
HOVERGENiHBG079280.
InParanoidiQ9BRZ2.
KOiK12026.
OMAiAYHGLEK.
OrthoDBiEOG091G03B5.
PhylomeDBiQ9BRZ2.
TreeFamiTF338323.

Enzyme and pathway databases

ReactomeiR-HSA-3134975. Regulation of innate immune responses to cytosolic DNA.

Miscellaneous databases

ChiTaRSiTRIM56. human.
GenomeRNAii81844.
PROiQ9BRZ2.

Gene expression databases

BgeeiENSG00000169871.
CleanExiHS_TRIM56.
ExpressionAtlasiQ9BRZ2. baseline and differential.
GenevisibleiQ9BRZ2. HS.

Family and domain databases

Gene3Di2.120.10.30. 1 hit.
3.30.40.10. 1 hit.
InterProiIPR011042. 6-blade_b-propeller_TolB-like.
IPR027370. Znf-RING_LisH.
IPR000315. Znf_B-box.
IPR001841. Znf_RING.
IPR013083. Znf_RING/FYVE/PHD.
IPR017907. Znf_RING_CS.
[Graphical view]
PfamiPF00643. zf-B_box. 1 hit.
PF13445. zf-RING_UBOX. 1 hit.
[Graphical view]
SMARTiSM00336. BBOX. 1 hit.
SM00184. RING. 1 hit.
[Graphical view]
PROSITEiPS50119. ZF_BBOX. 1 hit.
PS00518. ZF_RING_1. 1 hit.
PS50089. ZF_RING_2. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiTRI56_HUMAN
AccessioniPrimary (citable) accession number: Q9BRZ2
Secondary accession number(s): Q6PJS5
, Q86VT6, Q8N2H8, Q8NAC0, Q9H031
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 21, 2004
Last sequence update: December 21, 2004
Last modified: September 7, 2016
This is version 132 of the entry and version 3 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 7
    Human chromosome 7: entries, gene names and cross-references to MIM
  2. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.