Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BRY0

- S39A3_HUMAN

UniProt

Q9BRY0 - S39A3_HUMAN

Protein

Zinc transporter ZIP3

Gene

SLC39A3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 100 (01 Oct 2014)
      Sequence version 2 (01 Mar 2004)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    Acts as a zinc-influx transporter.Curated

    GO - Molecular functioni

    1. zinc ion transmembrane transporter activity Source: Ensembl

    GO - Biological processi

    1. transmembrane transport Source: Reactome

    Keywords - Biological processi

    Ion transport, Transport, Zinc transport

    Keywords - Ligandi

    Zinc

    Enzyme and pathway databases

    ReactomeiREACT_20603. Zinc influx into cells by the SLC39 gene family.

    Protein family/group databases

    TCDBi2.A.5.3.3. the zinc (zn(2+))-iron (fe(2+)) permease (zip) family.

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    Zinc transporter ZIP3
    Alternative name(s):
    Solute carrier family 39 member 3
    Zrt- and Irt-like protein 3
    Short name:
    ZIP-3
    Gene namesi
    Name:SLC39A3
    Synonyms:ZIP3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 19

    Organism-specific databases

    HGNCiHGNC:17128. SLC39A3.

    Subcellular locationi

    GO - Cellular componenti

    1. integral component of membrane Source: UniProtKB-KW
    2. plasma membrane Source: Reactome

    Keywords - Cellular componenti

    Membrane

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA38203.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 314314Zinc transporter ZIP3PRO_0000312868Add
    BLAST

    Amino acid modifications

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Modified residuei125 – 1251Phosphoserine2 Publications

    Keywords - PTMi

    Phosphoprotein

    Proteomic databases

    MaxQBiQ9BRY0.
    PaxDbiQ9BRY0.
    PRIDEiQ9BRY0.

    PTM databases

    PhosphoSiteiQ9BRY0.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9BRY0.
    BgeeiQ9BRY0.
    CleanExiHS_SLC39A3.
    GenevestigatoriQ9BRY0.

    Organism-specific databases

    HPAiHPA042139.

    Interactioni

    Protein-protein interaction databases

    BioGridi119011. 1 interaction.
    STRINGi9606.ENSP00000269740.

    Structurei

    3D structure databases

    ProteinModelPortaliQ9BRY0.
    ModBaseiSearch...
    MobiDBiSearch...

    Topological domain

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Topological domaini1 – 33ExtracellularSequence Analysis
    Topological domaini25 – 4218CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini64 – 8522ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini107 – 16963CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini191 – 1966ExtracellularSequence Analysis
    Topological domaini218 – 22912CytoplasmicSequence AnalysisAdd
    BLAST
    Topological domaini251 – 26212ExtracellularSequence AnalysisAdd
    BLAST
    Topological domaini284 – 2929CytoplasmicSequence Analysis
    Topological domaini314 – 3141ExtracellularSequence Analysis

    Transmembrane

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Transmembranei4 – 2421HelicalSequence AnalysisAdd
    BLAST
    Transmembranei43 – 6321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei86 – 10621HelicalSequence AnalysisAdd
    BLAST
    Transmembranei170 – 19021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei197 – 21721HelicalSequence AnalysisAdd
    BLAST
    Transmembranei230 – 25021HelicalSequence AnalysisAdd
    BLAST
    Transmembranei263 – 28321HelicalSequence AnalysisAdd
    BLAST
    Transmembranei293 – 31321HelicalSequence AnalysisAdd
    BLAST

    Family & Domainsi

    Sequence similaritiesi

    Keywords - Domaini

    Transmembrane, Transmembrane helix

    Phylogenomic databases

    eggNOGiKOG1558.
    HOVERGENiHBG108447.
    InParanoidiQ9BRY0.
    KOiK14709.
    OMAiPYNTREN.
    PhylomeDBiQ9BRY0.
    TreeFamiTF317098.

    Family and domain databases

    InterProiIPR003689. ZIP.
    [Graphical view]
    PfamiPF02535. Zip. 1 hit.
    [Graphical view]

    Sequences (2)i

    Sequence statusi: Complete.

    This entry describes 2 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BRY0-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MVKLLVAKIL CMVGVFFFML LGSLLPVKII ETDFEKAHRS KKILSLCNTF    50
    GGGVFLATCF NALLPAVREK LQKVLSLGHI STDYPLAETI LLLGFFMTVF 100
    LEQLILTFRK EKPSFIDLET FNAGSDVGSD SEYESPFMGG ARGHALYVEP 150
    HGHGPSLSVQ GLSRASPVRL LSLAFALSAH SVFEGLALGL QEEGEKVVSL 200
    FVGVAVHETL VAVALGISMA RSAMPLRDAA KLAVTVSAMI PLGIGLGLGI 250
    ESAQGVPGSV ASVLLQGLAG GTFLFITFLE ILAKELEEKS DRLLKVLFLV 300
    LGYTVLAGMV FLKW 314
    Length:314
    Mass (Da):33,601
    Last modified:March 1, 2004 - v2
    Checksum:i572ADE958735D2CE
    GO
    Isoform 2 (identifier: Q9BRY0-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         71-105: LQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLI → VRAPWALAAALGTLWPRDSDAFSTLMPSSVKALML
         106-314: Missing.

    Show »
    Length:105
    Mass (Da):11,459
    Checksum:i23AB373A99F177F7
    GO

    Natural variant

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Natural varianti100 – 1001F → L.
    Corresponds to variant rs11539244 [ dbSNP | Ensembl ].
    VAR_037599
    Natural varianti257 – 2571P → L.
    Corresponds to variant rs35594294 [ dbSNP | Ensembl ].
    VAR_037600

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei71 – 10535LQKVL…LEQLI → VRAPWALAAALGTLWPRDSD AFSTLMPSSVKALML in isoform 2. 2 PublicationsVSP_029920Add
    BLAST
    Alternative sequencei106 – 314209Missing in isoform 2. 2 PublicationsVSP_029921Add
    BLAST

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK002044 mRNA. Translation: BAG51005.1.
    BC005869 mRNA. Translation: AAH05869.2.
    BC020571 mRNA. Translation: AAH20571.1.
    CCDSiCCDS12093.1. [Q9BRY0-1]
    CCDS45909.1. [Q9BRY0-2]
    RefSeqiNP_653165.2. NM_144564.4. [Q9BRY0-1]
    NP_998733.1. NM_213568.1. [Q9BRY0-2]
    UniGeneiHs.515046.

    Genome annotation databases

    EnsembliENST00000269740; ENSP00000269740; ENSG00000141873. [Q9BRY0-1]
    ENST00000455372; ENSP00000393715; ENSG00000141873. [Q9BRY0-2]
    GeneIDi29985.
    KEGGihsa:29985.
    UCSCiuc002lwg.3. human. [Q9BRY0-1]
    uc002lwh.3. human. [Q9BRY0-2]

    Polymorphism databases

    DMDMi74732942.

    Keywords - Coding sequence diversityi

    Alternative splicing, Polymorphism

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK002044 mRNA. Translation: BAG51005.1 .
    BC005869 mRNA. Translation: AAH05869.2 .
    BC020571 mRNA. Translation: AAH20571.1 .
    CCDSi CCDS12093.1. [Q9BRY0-1 ]
    CCDS45909.1. [Q9BRY0-2 ]
    RefSeqi NP_653165.2. NM_144564.4. [Q9BRY0-1 ]
    NP_998733.1. NM_213568.1. [Q9BRY0-2 ]
    UniGenei Hs.515046.

    3D structure databases

    ProteinModelPortali Q9BRY0.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 119011. 1 interaction.
    STRINGi 9606.ENSP00000269740.

    Protein family/group databases

    TCDBi 2.A.5.3.3. the zinc (zn(2+))-iron (fe(2+)) permease (zip) family.

    PTM databases

    PhosphoSitei Q9BRY0.

    Polymorphism databases

    DMDMi 74732942.

    Proteomic databases

    MaxQBi Q9BRY0.
    PaxDbi Q9BRY0.
    PRIDEi Q9BRY0.

    Protocols and materials databases

    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000269740 ; ENSP00000269740 ; ENSG00000141873 . [Q9BRY0-1 ]
    ENST00000455372 ; ENSP00000393715 ; ENSG00000141873 . [Q9BRY0-2 ]
    GeneIDi 29985.
    KEGGi hsa:29985.
    UCSCi uc002lwg.3. human. [Q9BRY0-1 ]
    uc002lwh.3. human. [Q9BRY0-2 ]

    Organism-specific databases

    CTDi 29985.
    GeneCardsi GC19M002732.
    HGNCi HGNC:17128. SLC39A3.
    HPAi HPA042139.
    MIMi 612168. gene.
    neXtProti NX_Q9BRY0.
    PharmGKBi PA38203.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi KOG1558.
    HOVERGENi HBG108447.
    InParanoidi Q9BRY0.
    KOi K14709.
    OMAi PYNTREN.
    PhylomeDBi Q9BRY0.
    TreeFami TF317098.

    Enzyme and pathway databases

    Reactomei REACT_20603. Zinc influx into cells by the SLC39 gene family.

    Miscellaneous databases

    GeneWikii SLC39A3.
    GenomeRNAii 29985.
    NextBioi 52750.
    PROi Q9BRY0.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BRY0.
    Bgeei Q9BRY0.
    CleanExi HS_SLC39A3.
    Genevestigatori Q9BRY0.

    Family and domain databases

    InterProi IPR003689. ZIP.
    [Graphical view ]
    Pfami PF02535. Zip. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
      Tissue: Placenta.
    2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
      Tissue: Duodenum and Lymph.
    3. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
      Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
      Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
      Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.
    5. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
      Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
      Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Leukemic T-cell.
    6. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
      Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
      Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
      Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
      Tissue: Cervix carcinoma.

    Entry informationi

    Entry nameiS39A3_HUMAN
    AccessioniPrimary (citable) accession number: Q9BRY0
    Secondary accession number(s): B3KMJ3, Q8WUG1
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: December 4, 2007
    Last sequence update: March 1, 2004
    Last modified: October 1, 2014
    This is version 100 of the entry and version 2 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    Complete proteome, Reference proteome

    Documents

    1. Human chromosome 19
      Human chromosome 19: entries, gene names and cross-references to MIM
    2. Human entries with polymorphisms or disease mutations
      List of human entries with polymorphisms or disease mutations
    3. Human polymorphisms and disease mutations
      Index of human polymorphisms and disease mutations
    4. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    5. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3