Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BRY0 (S39A3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified April 16, 2014. Version 96. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (5) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
Zinc transporter ZIP3
Alternative name(s):
Solute carrier family 39 member 3
Zrt- and Irt-like protein 3
Short name=ZIP-3
Gene names
Name:SLC39A3
Synonyms:ZIP3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length314 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

Acts as a zinc-influx transporter Potential.

Subcellular location

Membrane; Multi-pass membrane protein Potential.

Sequence similarities

Belongs to the ZIP transporter (TC 2.A.5) family. [View classification]

Ontologies

Keywords
   Biological processIon transport
Transport
Zinc transport
   Cellular componentMembrane
   Coding sequence diversityAlternative splicing
Polymorphism
   DomainTransmembrane
Transmembrane helix
   LigandZinc
   PTMPhosphoprotein
   Technical termComplete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processtransmembrane transport

Traceable author statement. Source: Reactome

   Cellular_componentintegral component of membrane

Inferred from electronic annotation. Source: UniProtKB-KW

plasma membrane

Traceable author statement. Source: Reactome

   Molecular_functionzinc ion transmembrane transporter activity

Inferred from electronic annotation. Source: Ensembl

Complete GO annotation...

Alternative products

This entry describes 2 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BRY0-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9BRY0-2)

The sequence of this isoform differs from the canonical sequence as follows:
     71-105: LQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLI → VRAPWALAAALGTLWPRDSDAFSTLMPSSVKALML
     106-314: Missing.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 314314Zinc transporter ZIP3
PRO_0000312868

Regions

Topological domain1 – 33Extracellular Potential
Transmembrane4 – 2421Helical; Potential
Topological domain25 – 4218Cytoplasmic Potential
Transmembrane43 – 6321Helical; Potential
Topological domain64 – 8522Extracellular Potential
Transmembrane86 – 10621Helical; Potential
Topological domain107 – 16963Cytoplasmic Potential
Transmembrane170 – 19021Helical; Potential
Topological domain191 – 1966Extracellular Potential
Transmembrane197 – 21721Helical; Potential
Topological domain218 – 22912Cytoplasmic Potential
Transmembrane230 – 25021Helical; Potential
Topological domain251 – 26212Extracellular Potential
Transmembrane263 – 28321Helical; Potential
Topological domain284 – 2929Cytoplasmic Potential
Transmembrane293 – 31321Helical; Potential
Topological domain3141Extracellular Potential

Amino acid modifications

Modified residue1251Phosphoserine Ref.3 Ref.4

Natural variations

Alternative sequence71 – 10535LQKVL…LEQLI → VRAPWALAAALGTLWPRDSD AFSTLMPSSVKALML in isoform 2.
VSP_029920
Alternative sequence106 – 314209Missing in isoform 2.
VSP_029921
Natural variant1001F → L.
Corresponds to variant rs11539244 [ dbSNP | Ensembl ].
VAR_037599
Natural variant2571P → L.
Corresponds to variant rs35594294 [ dbSNP | Ensembl ].
VAR_037600

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified March 1, 2004. Version 2.
Checksum: 572ADE958735D2CE

FASTA31433,601
        10         20         30         40         50         60 
MVKLLVAKIL CMVGVFFFML LGSLLPVKII ETDFEKAHRS KKILSLCNTF GGGVFLATCF 

        70         80         90        100        110        120 
NALLPAVREK LQKVLSLGHI STDYPLAETI LLLGFFMTVF LEQLILTFRK EKPSFIDLET 

       130        140        150        160        170        180 
FNAGSDVGSD SEYESPFMGG ARGHALYVEP HGHGPSLSVQ GLSRASPVRL LSLAFALSAH 

       190        200        210        220        230        240 
SVFEGLALGL QEEGEKVVSL FVGVAVHETL VAVALGISMA RSAMPLRDAA KLAVTVSAMI 

       250        260        270        280        290        300 
PLGIGLGLGI ESAQGVPGSV ASVLLQGLAG GTFLFITFLE ILAKELEEKS DRLLKVLFLV 

       310 
LGYTVLAGMV FLKW 

« Hide

Isoform 2 [UniParc].

Checksum: 23AB373A99F177F7
Show »

FASTA10511,459

References

[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
Tissue: Placenta.
[2]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
Tissue: Duodenum and Lymph.
[3]"Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[4]"A quantitative atlas of mitotic phosphorylation."
Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P.
Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract]
Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
[5]"Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Leukemic T-cell.
[6]"Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
Tissue: Cervix carcinoma.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK002044 mRNA. Translation: BAG51005.1.
BC005869 mRNA. Translation: AAH05869.2.
BC020571 mRNA. Translation: AAH20571.1.
RefSeqNP_653165.2. NM_144564.4.
NP_998733.1. NM_213568.1.
UniGeneHs.515046.

3D structure databases

ProteinModelPortalQ9BRY0.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid119011. 1 interaction.
STRING9606.ENSP00000269740.

Protein family/group databases

TCDB2.A.5.3.3. the zinc (zn(2+))-iron (fe(2+)) permease (zip) family.

PTM databases

PhosphoSiteQ9BRY0.

Polymorphism databases

DMDM74732942.

Proteomic databases

PaxDbQ9BRY0.
PRIDEQ9BRY0.

Protocols and materials databases

StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000269740; ENSP00000269740; ENSG00000141873. [Q9BRY0-1]
ENST00000455372; ENSP00000393715; ENSG00000141873. [Q9BRY0-2]
GeneID29985.
KEGGhsa:29985.
UCSCuc002lwg.3. human. [Q9BRY0-1]
uc002lwh.3. human. [Q9BRY0-2]

Organism-specific databases

CTD29985.
GeneCardsGC19M002732.
HGNCHGNC:17128. SLC39A3.
HPAHPA042139.
MIM612168. gene.
neXtProtNX_Q9BRY0.
PharmGKBPA38203.
GenAtlasSearch...

Phylogenomic databases

eggNOGKOG1558.
HOVERGENHBG108447.
InParanoidQ9BRY0.
KOK14709.
PhylomeDBQ9BRY0.
TreeFamTF317098.

Enzyme and pathway databases

ReactomeREACT_15518. Transmembrane transport of small molecules.

Gene expression databases

ArrayExpressQ9BRY0.
BgeeQ9BRY0.
CleanExHS_SLC39A3.
GenevestigatorQ9BRY0.

Family and domain databases

InterProIPR003689. ZIP.
[Graphical view]
PfamPF02535. Zip. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

GeneWikiSLC39A3.
GenomeRNAi29985.
NextBio52750.
PROQ9BRY0.
SOURCESearch...

Entry information

Entry nameS39A3_HUMAN
AccessionPrimary (citable) accession number: Q9BRY0
Secondary accession number(s): B3KMJ3, Q8WUG1
Entry history
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: March 1, 2004
Last modified: April 16, 2014
This is version 96 of the entry and version 2 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human polymorphisms and disease mutations

Index of human polymorphisms and disease mutations

Human entries with polymorphisms or disease mutations

List of human entries with polymorphisms or disease mutations

Human chromosome 19

Human chromosome 19: entries, gene names and cross-references to MIM