Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc transporter ZIP3

Gene

SLC39A3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a zinc-influx transporter.Curated

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ion transport, Transport, Zinc transport

Keywords - Ligandi

Zinc

Enzyme and pathway databases

ReactomeiREACT_20603. Zinc influx into cells by the SLC39 gene family.

Protein family/group databases

TCDBi2.A.5.3.3. the zinc (zn(2+))-iron (fe(2+)) permease (zip) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc transporter ZIP3
Alternative name(s):
Solute carrier family 39 member 3
Zrt- and Irt-like protein 3
Short name:
ZIP-3
Gene namesi
Name:SLC39A3
Synonyms:ZIP3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:17128. SLC39A3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 33ExtracellularSequence Analysis
Transmembranei4 – 2421HelicalSequence AnalysisAdd
BLAST
Topological domaini25 – 4218CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei43 – 6321HelicalSequence AnalysisAdd
BLAST
Topological domaini64 – 8522ExtracellularSequence AnalysisAdd
BLAST
Transmembranei86 – 10621HelicalSequence AnalysisAdd
BLAST
Topological domaini107 – 16963CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei170 – 19021HelicalSequence AnalysisAdd
BLAST
Topological domaini191 – 1966ExtracellularSequence Analysis
Transmembranei197 – 21721HelicalSequence AnalysisAdd
BLAST
Topological domaini218 – 22912CytoplasmicSequence AnalysisAdd
BLAST
Transmembranei230 – 25021HelicalSequence AnalysisAdd
BLAST
Topological domaini251 – 26212ExtracellularSequence AnalysisAdd
BLAST
Transmembranei263 – 28321HelicalSequence AnalysisAdd
BLAST
Topological domaini284 – 2929CytoplasmicSequence Analysis
Transmembranei293 – 31321HelicalSequence AnalysisAdd
BLAST
Topological domaini314 – 3141ExtracellularSequence Analysis

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38203.

Polymorphism and mutation databases

BioMutaiSLC39A3.
DMDMi74732942.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 314314Zinc transporter ZIP3PRO_0000312868Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei125 – 1251Phosphoserine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9BRY0.
PaxDbiQ9BRY0.
PRIDEiQ9BRY0.

PTM databases

PhosphoSiteiQ9BRY0.

Expressioni

Gene expression databases

BgeeiQ9BRY0.
CleanExiHS_SLC39A3.
ExpressionAtlasiQ9BRY0. baseline and differential.
GenevisibleiQ9BRY0. HS.

Organism-specific databases

HPAiHPA042139.
HPA058526.

Interactioni

Protein-protein interaction databases

BioGridi119011. 5 interactions.
STRINGi9606.ENSP00000269740.

Structurei

3D structure databases

ProteinModelPortaliQ9BRY0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1558.
GeneTreeiENSGT00530000063242.
HOVERGENiHBG108447.
InParanoidiQ9BRY0.
KOiK14709.
PhylomeDBiQ9BRY0.
TreeFamiTF317098.

Family and domain databases

InterProiIPR003689. ZIP.
[Graphical view]
PfamiPF02535. Zip. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BRY0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVKLLVAKIL CMVGVFFFML LGSLLPVKII ETDFEKAHRS KKILSLCNTF
60 70 80 90 100
GGGVFLATCF NALLPAVREK LQKVLSLGHI STDYPLAETI LLLGFFMTVF
110 120 130 140 150
LEQLILTFRK EKPSFIDLET FNAGSDVGSD SEYESPFMGG ARGHALYVEP
160 170 180 190 200
HGHGPSLSVQ GLSRASPVRL LSLAFALSAH SVFEGLALGL QEEGEKVVSL
210 220 230 240 250
FVGVAVHETL VAVALGISMA RSAMPLRDAA KLAVTVSAMI PLGIGLGLGI
260 270 280 290 300
ESAQGVPGSV ASVLLQGLAG GTFLFITFLE ILAKELEEKS DRLLKVLFLV
310
LGYTVLAGMV FLKW
Length:314
Mass (Da):33,601
Last modified:March 1, 2004 - v2
Checksum:i572ADE958735D2CE
GO
Isoform 2 (identifier: Q9BRY0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-105: LQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLI → VRAPWALAAALGTLWPRDSDAFSTLMPSSVKALML
     106-314: Missing.

Show »
Length:105
Mass (Da):11,459
Checksum:i23AB373A99F177F7
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti100 – 1001F → L.
Corresponds to variant rs11539244 [ dbSNP | Ensembl ].
VAR_037599
Natural varianti257 – 2571P → L.
Corresponds to variant rs35594294 [ dbSNP | Ensembl ].
VAR_037600

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei71 – 10535LQKVL…LEQLI → VRAPWALAAALGTLWPRDSD AFSTLMPSSVKALML in isoform 2. 2 PublicationsVSP_029920Add
BLAST
Alternative sequencei106 – 314209Missing in isoform 2. 2 PublicationsVSP_029921Add
BLAST

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002044 mRNA. Translation: BAG51005.1.
BC005869 mRNA. Translation: AAH05869.2.
BC020571 mRNA. Translation: AAH20571.1.
CCDSiCCDS12093.1. [Q9BRY0-1]
CCDS45909.1. [Q9BRY0-2]
RefSeqiNP_653165.2. NM_144564.4. [Q9BRY0-1]
NP_998733.1. NM_213568.1. [Q9BRY0-2]
UniGeneiHs.515046.

Genome annotation databases

EnsembliENST00000269740; ENSP00000269740; ENSG00000141873. [Q9BRY0-1]
ENST00000455372; ENSP00000393715; ENSG00000141873. [Q9BRY0-2]
GeneIDi29985.
KEGGihsa:29985.
UCSCiuc002lwg.3. human. [Q9BRY0-1]
uc002lwh.3. human. [Q9BRY0-2]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002044 mRNA. Translation: BAG51005.1.
BC005869 mRNA. Translation: AAH05869.2.
BC020571 mRNA. Translation: AAH20571.1.
CCDSiCCDS12093.1. [Q9BRY0-1]
CCDS45909.1. [Q9BRY0-2]
RefSeqiNP_653165.2. NM_144564.4. [Q9BRY0-1]
NP_998733.1. NM_213568.1. [Q9BRY0-2]
UniGeneiHs.515046.

3D structure databases

ProteinModelPortaliQ9BRY0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119011. 5 interactions.
STRINGi9606.ENSP00000269740.

Protein family/group databases

TCDBi2.A.5.3.3. the zinc (zn(2+))-iron (fe(2+)) permease (zip) family.

PTM databases

PhosphoSiteiQ9BRY0.

Polymorphism and mutation databases

BioMutaiSLC39A3.
DMDMi74732942.

Proteomic databases

MaxQBiQ9BRY0.
PaxDbiQ9BRY0.
PRIDEiQ9BRY0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000269740; ENSP00000269740; ENSG00000141873. [Q9BRY0-1]
ENST00000455372; ENSP00000393715; ENSG00000141873. [Q9BRY0-2]
GeneIDi29985.
KEGGihsa:29985.
UCSCiuc002lwg.3. human. [Q9BRY0-1]
uc002lwh.3. human. [Q9BRY0-2]

Organism-specific databases

CTDi29985.
GeneCardsiGC19M002732.
HGNCiHGNC:17128. SLC39A3.
HPAiHPA042139.
HPA058526.
MIMi612168. gene.
neXtProtiNX_Q9BRY0.
PharmGKBiPA38203.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1558.
GeneTreeiENSGT00530000063242.
HOVERGENiHBG108447.
InParanoidiQ9BRY0.
KOiK14709.
PhylomeDBiQ9BRY0.
TreeFamiTF317098.

Enzyme and pathway databases

ReactomeiREACT_20603. Zinc influx into cells by the SLC39 gene family.

Miscellaneous databases

ChiTaRSiSLC39A3. human.
GeneWikiiSLC39A3.
GenomeRNAii29985.
NextBioi52750.
PROiQ9BRY0.
SOURCEiSearch...

Gene expression databases

BgeeiQ9BRY0.
CleanExiHS_SLC39A3.
ExpressionAtlasiQ9BRY0. baseline and differential.
GenevisibleiQ9BRY0. HS.

Family and domain databases

InterProiIPR003689. ZIP.
[Graphical view]
PfamiPF02535. Zip. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Placenta.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Duodenum and Lymph.
  3. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  5. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  6. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiS39A3_HUMAN
AccessioniPrimary (citable) accession number: Q9BRY0
Secondary accession number(s): B3KMJ3, Q8WUG1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: March 1, 2004
Last modified: June 24, 2015
This is version 106 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.