SubmitCancel

Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BRY0

- S39A3_HUMAN

UniProt

Q9BRY0 - S39A3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

Zinc transporter ZIP3

Gene
SLC39A3, ZIP3
Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 3 out of 5 - Experimental evidence at protein leveli

Functioni

Acts as a zinc-influx transporter Reviewed prediction.

GO - Molecular functioni

  1. zinc ion transmembrane transporter activity Source: Ensembl

GO - Biological processi

  1. transmembrane transport Source: Reactome
Complete GO annotation...

Keywords - Biological processi

Ion transport, Transport, Zinc transport

Keywords - Ligandi

Zinc

Enzyme and pathway databases

ReactomeiREACT_20603. Zinc influx into cells by the SLC39 gene family.

Protein family/group databases

TCDBi2.A.5.3.3. the zinc (zn(2+))-iron (fe(2+)) permease (zip) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc transporter ZIP3
Alternative name(s):
Solute carrier family 39 member 3
Zrt- and Irt-like protein 3
Short name:
ZIP-3
Gene namesi
Name:SLC39A3
Synonyms:ZIP3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 19

Organism-specific databases

HGNCiHGNC:17128. SLC39A3.

Subcellular locationi

Topology

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Topological domaini1 – 33Extracellular Reviewed prediction
Transmembranei4 – 2421Helical; Reviewed predictionAdd
BLAST
Topological domaini25 – 4218Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei43 – 6321Helical; Reviewed predictionAdd
BLAST
Topological domaini64 – 8522Extracellular Reviewed predictionAdd
BLAST
Transmembranei86 – 10621Helical; Reviewed predictionAdd
BLAST
Topological domaini107 – 16963Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei170 – 19021Helical; Reviewed predictionAdd
BLAST
Topological domaini191 – 1966Extracellular Reviewed prediction
Transmembranei197 – 21721Helical; Reviewed predictionAdd
BLAST
Topological domaini218 – 22912Cytoplasmic Reviewed predictionAdd
BLAST
Transmembranei230 – 25021Helical; Reviewed predictionAdd
BLAST
Topological domaini251 – 26212Extracellular Reviewed predictionAdd
BLAST
Transmembranei263 – 28321Helical; Reviewed predictionAdd
BLAST
Topological domaini284 – 2929Cytoplasmic Reviewed prediction
Transmembranei293 – 31321Helical; Reviewed predictionAdd
BLAST
Topological domaini314 – 3141Extracellular Reviewed prediction

GO - Cellular componenti

  1. integral component of membrane Source: UniProtKB-KW
  2. plasma membrane Source: Reactome
Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA38203.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 314314Zinc transporter ZIP3PRO_0000312868Add
BLAST

Amino acid modifications

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Modified residuei125 – 1251Phosphoserine2 Publications

Keywords - PTMi

Phosphoprotein

Proteomic databases

MaxQBiQ9BRY0.
PaxDbiQ9BRY0.
PRIDEiQ9BRY0.

PTM databases

PhosphoSiteiQ9BRY0.

Expressioni

Gene expression databases

ArrayExpressiQ9BRY0.
BgeeiQ9BRY0.
CleanExiHS_SLC39A3.
GenevestigatoriQ9BRY0.

Organism-specific databases

HPAiHPA042139.

Interactioni

Protein-protein interaction databases

BioGridi119011. 1 interaction.
STRINGi9606.ENSP00000269740.

Structurei

3D structure databases

ProteinModelPortaliQ9BRY0.

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1558.
HOVERGENiHBG108447.
InParanoidiQ9BRY0.
KOiK14709.
OMAiPYNTREN.
PhylomeDBiQ9BRY0.
TreeFamiTF317098.

Family and domain databases

InterProiIPR003689. ZIP.
[Graphical view]
PfamiPF02535. Zip. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BRY0-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

MVKLLVAKIL CMVGVFFFML LGSLLPVKII ETDFEKAHRS KKILSLCNTF    50
GGGVFLATCF NALLPAVREK LQKVLSLGHI STDYPLAETI LLLGFFMTVF 100
LEQLILTFRK EKPSFIDLET FNAGSDVGSD SEYESPFMGG ARGHALYVEP 150
HGHGPSLSVQ GLSRASPVRL LSLAFALSAH SVFEGLALGL QEEGEKVVSL 200
FVGVAVHETL VAVALGISMA RSAMPLRDAA KLAVTVSAMI PLGIGLGLGI 250
ESAQGVPGSV ASVLLQGLAG GTFLFITFLE ILAKELEEKS DRLLKVLFLV 300
LGYTVLAGMV FLKW 314
Length:314
Mass (Da):33,601
Last modified:March 1, 2004 - v2
Checksum:i572ADE958735D2CE
GO
Isoform 2 (identifier: Q9BRY0-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-105: LQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLI → VRAPWALAAALGTLWPRDSDAFSTLMPSSVKALML
     106-314: Missing.

Show »
Length:105
Mass (Da):11,459
Checksum:i23AB373A99F177F7
GO

Natural variant

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Natural varianti100 – 1001F → L.
Corresponds to variant rs11539244 [ dbSNP | Ensembl ].
VAR_037599
Natural varianti257 – 2571P → L.
Corresponds to variant rs35594294 [ dbSNP | Ensembl ].
VAR_037600

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei71 – 10535LQKVL…LEQLI → VRAPWALAAALGTLWPRDSD AFSTLMPSSVKALML in isoform 2. VSP_029920Add
BLAST
Alternative sequencei106 – 314209Missing in isoform 2. VSP_029921Add
BLAST

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK002044 mRNA. Translation: BAG51005.1.
BC005869 mRNA. Translation: AAH05869.2.
BC020571 mRNA. Translation: AAH20571.1.
CCDSiCCDS12093.1. [Q9BRY0-1]
CCDS45909.1. [Q9BRY0-2]
RefSeqiNP_653165.2. NM_144564.4. [Q9BRY0-1]
NP_998733.1. NM_213568.1. [Q9BRY0-2]
UniGeneiHs.515046.

Genome annotation databases

EnsembliENST00000269740; ENSP00000269740; ENSG00000141873. [Q9BRY0-1]
ENST00000455372; ENSP00000393715; ENSG00000141873. [Q9BRY0-2]
GeneIDi29985.
KEGGihsa:29985.
UCSCiuc002lwg.3. human. [Q9BRY0-1]
uc002lwh.3. human. [Q9BRY0-2]

Polymorphism databases

DMDMi74732942.

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK002044 mRNA. Translation: BAG51005.1 .
BC005869 mRNA. Translation: AAH05869.2 .
BC020571 mRNA. Translation: AAH20571.1 .
CCDSi CCDS12093.1. [Q9BRY0-1 ]
CCDS45909.1. [Q9BRY0-2 ]
RefSeqi NP_653165.2. NM_144564.4. [Q9BRY0-1 ]
NP_998733.1. NM_213568.1. [Q9BRY0-2 ]
UniGenei Hs.515046.

3D structure databases

ProteinModelPortali Q9BRY0.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 119011. 1 interaction.
STRINGi 9606.ENSP00000269740.

Protein family/group databases

TCDBi 2.A.5.3.3. the zinc (zn(2+))-iron (fe(2+)) permease (zip) family.

PTM databases

PhosphoSitei Q9BRY0.

Polymorphism databases

DMDMi 74732942.

Proteomic databases

MaxQBi Q9BRY0.
PaxDbi Q9BRY0.
PRIDEi Q9BRY0.

Protocols and materials databases

Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000269740 ; ENSP00000269740 ; ENSG00000141873 . [Q9BRY0-1 ]
ENST00000455372 ; ENSP00000393715 ; ENSG00000141873 . [Q9BRY0-2 ]
GeneIDi 29985.
KEGGi hsa:29985.
UCSCi uc002lwg.3. human. [Q9BRY0-1 ]
uc002lwh.3. human. [Q9BRY0-2 ]

Organism-specific databases

CTDi 29985.
GeneCardsi GC19M002732.
HGNCi HGNC:17128. SLC39A3.
HPAi HPA042139.
MIMi 612168. gene.
neXtProti NX_Q9BRY0.
PharmGKBi PA38203.
GenAtlasi Search...

Phylogenomic databases

eggNOGi KOG1558.
HOVERGENi HBG108447.
InParanoidi Q9BRY0.
KOi K14709.
OMAi PYNTREN.
PhylomeDBi Q9BRY0.
TreeFami TF317098.

Enzyme and pathway databases

Reactomei REACT_20603. Zinc influx into cells by the SLC39 gene family.

Miscellaneous databases

GeneWikii SLC39A3.
GenomeRNAii 29985.
NextBioi 52750.
PROi Q9BRY0.
SOURCEi Search...

Gene expression databases

ArrayExpressi Q9BRY0.
Bgeei Q9BRY0.
CleanExi HS_SLC39A3.
Genevestigatori Q9BRY0.

Family and domain databases

InterProi IPR003689. ZIP.
[Graphical view ]
Pfami PF02535. Zip. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    Tissue: Placenta.
  2. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    Tissue: Duodenum and Lymph.
  3. "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle."
    Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M.
    Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract]
    Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  4. Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125, IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.
  5. "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions."
    Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K.
    Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Leukemic T-cell.
  6. "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis."
    Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M.
    Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract]
    Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    Tissue: Cervix carcinoma.

Entry informationi

Entry nameiS39A3_HUMAN
AccessioniPrimary (citable) accession number: Q9BRY0
Secondary accession number(s): B3KMJ3, Q8WUG1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: March 1, 2004
Last modified: September 3, 2014
This is version 99 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi