Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

Zinc transporter ZIP3

Gene

SLC39A3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

Acts as a zinc-influx transporter.Curated

GO - Molecular functioni

GO - Biological processi

Complete GO annotation...

Keywords - Biological processi

Ion transport, Transport, Zinc transport

Keywords - Ligandi

Zinc

Enzyme and pathway databases

BioCyciZFISH:ENSG00000141873-MONOMER.
ReactomeiR-HSA-442380. Zinc influx into cells by the SLC39 gene family.

Protein family/group databases

TCDBi2.A.5.3.3. the zinc (zn(2+))-iron (fe(2+)) permease (zip) family.

Names & Taxonomyi

Protein namesi
Recommended name:
Zinc transporter ZIP3
Alternative name(s):
Solute carrier family 39 member 3
Zrt- and Irt-like protein 3
Short name:
ZIP-3
Gene namesi
Name:SLC39A3
Synonyms:ZIP3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 19

Organism-specific databases

HGNCiHGNC:17128. SLC39A3.

Subcellular locationi

Topology

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Topological domaini1 – 3ExtracellularSequence analysis3
Transmembranei4 – 24HelicalSequence analysisAdd BLAST21
Topological domaini25 – 42CytoplasmicSequence analysisAdd BLAST18
Transmembranei43 – 63HelicalSequence analysisAdd BLAST21
Topological domaini64 – 85ExtracellularSequence analysisAdd BLAST22
Transmembranei86 – 106HelicalSequence analysisAdd BLAST21
Topological domaini107 – 169CytoplasmicSequence analysisAdd BLAST63
Transmembranei170 – 190HelicalSequence analysisAdd BLAST21
Topological domaini191 – 196ExtracellularSequence analysis6
Transmembranei197 – 217HelicalSequence analysisAdd BLAST21
Topological domaini218 – 229CytoplasmicSequence analysisAdd BLAST12
Transmembranei230 – 250HelicalSequence analysisAdd BLAST21
Topological domaini251 – 262ExtracellularSequence analysisAdd BLAST12
Transmembranei263 – 283HelicalSequence analysisAdd BLAST21
Topological domaini284 – 292CytoplasmicSequence analysis9
Transmembranei293 – 313HelicalSequence analysisAdd BLAST21
Topological domaini314ExtracellularSequence analysis1

GO - Cellular componenti

Complete GO annotation...

Keywords - Cellular componenti

Membrane

Pathology & Biotechi

Organism-specific databases

DisGeNETi29985.
OpenTargetsiENSG00000141873.
PharmGKBiPA38203.

Polymorphism and mutation databases

BioMutaiSLC39A3.
DMDMi74732942.

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003128681 – 314Zinc transporter ZIP3Add BLAST314

Amino acid modifications

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Modified residuei125PhosphoserineCombined sources1
Modified residuei129PhosphoserineBy similarity1

Keywords - PTMi

Phosphoprotein

Proteomic databases

EPDiQ9BRY0.
MaxQBiQ9BRY0.
PaxDbiQ9BRY0.
PeptideAtlasiQ9BRY0.
PRIDEiQ9BRY0.

PTM databases

iPTMnetiQ9BRY0.
PhosphoSitePlusiQ9BRY0.

Expressioni

Gene expression databases

BgeeiENSG00000141873.
CleanExiHS_SLC39A3.
ExpressionAtlasiQ9BRY0. baseline and differential.
GenevisibleiQ9BRY0. HS.

Organism-specific databases

HPAiHPA042139.
HPA058526.

Interactioni

Protein-protein interaction databases

BioGridi119011. 8 interactors.
STRINGi9606.ENSP00000269740.

Structurei

3D structure databases

ProteinModelPortaliQ9BRY0.
ModBaseiSearch...
MobiDBiSearch...

Family & Domainsi

Sequence similaritiesi

Keywords - Domaini

Transmembrane, Transmembrane helix

Phylogenomic databases

eggNOGiKOG1558. Eukaryota.
ENOG4111GP2. LUCA.
GeneTreeiENSGT00530000063242.
HOVERGENiHBG108447.
InParanoidiQ9BRY0.
KOiK14709.
PhylomeDBiQ9BRY0.
TreeFamiTF317098.

Family and domain databases

InterProiIPR003689. ZIP.
[Graphical view]
PfamiPF02535. Zip. 1 hit.
[Graphical view]

Sequences (2)i

Sequence statusi: Complete.

This entry describes 2 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BRY0-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MVKLLVAKIL CMVGVFFFML LGSLLPVKII ETDFEKAHRS KKILSLCNTF
60 70 80 90 100
GGGVFLATCF NALLPAVREK LQKVLSLGHI STDYPLAETI LLLGFFMTVF
110 120 130 140 150
LEQLILTFRK EKPSFIDLET FNAGSDVGSD SEYESPFMGG ARGHALYVEP
160 170 180 190 200
HGHGPSLSVQ GLSRASPVRL LSLAFALSAH SVFEGLALGL QEEGEKVVSL
210 220 230 240 250
FVGVAVHETL VAVALGISMA RSAMPLRDAA KLAVTVSAMI PLGIGLGLGI
260 270 280 290 300
ESAQGVPGSV ASVLLQGLAG GTFLFITFLE ILAKELEEKS DRLLKVLFLV
310
LGYTVLAGMV FLKW
Length:314
Mass (Da):33,601
Last modified:March 1, 2004 - v2
Checksum:i572ADE958735D2CE
GO
Isoform 2 (identifier: Q9BRY0-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     71-105: LQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLI → VRAPWALAAALGTLWPRDSDAFSTLMPSSVKALML
     106-314: Missing.

Show »
Length:105
Mass (Da):11,459
Checksum:i23AB373A99F177F7
GO

Natural variant

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Natural variantiVAR_037599100F → L.Corresponds to variant rs11539244dbSNPEnsembl.1
Natural variantiVAR_037600257P → L.Corresponds to variant rs35594294dbSNPEnsembl.1

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_02992071 – 105LQKVL…LEQLI → VRAPWALAAALGTLWPRDSD AFSTLMPSSVKALML in isoform 2. 2 PublicationsAdd BLAST35
Alternative sequenceiVSP_029921106 – 314Missing in isoform 2. 2 PublicationsAdd BLAST209

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002044 mRNA. Translation: BAG51005.1.
BC005869 mRNA. Translation: AAH05869.2.
BC020571 mRNA. Translation: AAH20571.1.
CCDSiCCDS12093.1. [Q9BRY0-1]
CCDS45909.1. [Q9BRY0-2]
RefSeqiNP_653165.2. NM_144564.4. [Q9BRY0-1]
NP_998733.1. NM_213568.1. [Q9BRY0-2]
UniGeneiHs.515046.

Genome annotation databases

EnsembliENST00000269740; ENSP00000269740; ENSG00000141873. [Q9BRY0-1]
ENST00000455372; ENSP00000393715; ENSG00000141873. [Q9BRY0-2]
GeneIDi29985.
KEGGihsa:29985.
UCSCiuc002lwg.4. human. [Q9BRY0-1]

Keywords - Coding sequence diversityi

Alternative splicing, Polymorphism

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK002044 mRNA. Translation: BAG51005.1.
BC005869 mRNA. Translation: AAH05869.2.
BC020571 mRNA. Translation: AAH20571.1.
CCDSiCCDS12093.1. [Q9BRY0-1]
CCDS45909.1. [Q9BRY0-2]
RefSeqiNP_653165.2. NM_144564.4. [Q9BRY0-1]
NP_998733.1. NM_213568.1. [Q9BRY0-2]
UniGeneiHs.515046.

3D structure databases

ProteinModelPortaliQ9BRY0.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi119011. 8 interactors.
STRINGi9606.ENSP00000269740.

Protein family/group databases

TCDBi2.A.5.3.3. the zinc (zn(2+))-iron (fe(2+)) permease (zip) family.

PTM databases

iPTMnetiQ9BRY0.
PhosphoSitePlusiQ9BRY0.

Polymorphism and mutation databases

BioMutaiSLC39A3.
DMDMi74732942.

Proteomic databases

EPDiQ9BRY0.
MaxQBiQ9BRY0.
PaxDbiQ9BRY0.
PeptideAtlasiQ9BRY0.
PRIDEiQ9BRY0.

Protocols and materials databases

Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000269740; ENSP00000269740; ENSG00000141873. [Q9BRY0-1]
ENST00000455372; ENSP00000393715; ENSG00000141873. [Q9BRY0-2]
GeneIDi29985.
KEGGihsa:29985.
UCSCiuc002lwg.4. human. [Q9BRY0-1]

Organism-specific databases

CTDi29985.
DisGeNETi29985.
GeneCardsiSLC39A3.
HGNCiHGNC:17128. SLC39A3.
HPAiHPA042139.
HPA058526.
MIMi612168. gene.
neXtProtiNX_Q9BRY0.
OpenTargetsiENSG00000141873.
PharmGKBiPA38203.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiKOG1558. Eukaryota.
ENOG4111GP2. LUCA.
GeneTreeiENSGT00530000063242.
HOVERGENiHBG108447.
InParanoidiQ9BRY0.
KOiK14709.
PhylomeDBiQ9BRY0.
TreeFamiTF317098.

Enzyme and pathway databases

BioCyciZFISH:ENSG00000141873-MONOMER.
ReactomeiR-HSA-442380. Zinc influx into cells by the SLC39 gene family.

Miscellaneous databases

ChiTaRSiSLC39A3. human.
GeneWikiiSLC39A3.
GenomeRNAii29985.
PROiQ9BRY0.
SOURCEiSearch...

Gene expression databases

BgeeiENSG00000141873.
CleanExiHS_SLC39A3.
ExpressionAtlasiQ9BRY0. baseline and differential.
GenevisibleiQ9BRY0. HS.

Family and domain databases

InterProiIPR003689. ZIP.
[Graphical view]
PfamiPF02535. Zip. 1 hit.
[Graphical view]
ProtoNetiSearch...

Entry informationi

Entry nameiS39A3_HUMAN
AccessioniPrimary (citable) accession number: Q9BRY0
Secondary accession number(s): B3KMJ3, Q8WUG1
Entry historyi
Integrated into UniProtKB/Swiss-Prot: December 4, 2007
Last sequence update: March 1, 2004
Last modified: November 2, 2016
This is version 118 of the entry and version 2 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

Complete proteome, Reference proteome

Documents

  1. Human chromosome 19
    Human chromosome 19: entries, gene names and cross-references to MIM
  2. Human entries with polymorphisms or disease mutations
    List of human entries with polymorphisms or disease mutations
  3. Human polymorphisms and disease mutations
    Index of human polymorphisms and disease mutations
  4. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  5. SIMILARITY comments
    Index of protein domains and families

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into one UniRef entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.