Q9BRY0 (S39A3_HUMAN) Reviewed, UniProtKB/Swiss-Prot
Last modified
April 3, 2013.
Version 88.
History...
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order
Names·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize orderNames and origin
| Protein names | Recommended name: Zinc transporter ZIP3 Alternative name(s): Solute carrier family 39 member 3 Zrt- and Irt-like protein 3 Short name=ZIP-3 | ||||
| Gene names |
| ||||
| Organism | Homo sapiens (Human) [Reference proteome] | ||||
| Taxonomic identifier | 9606 [NCBI] | ||||
| Taxonomic lineage | Eukaryota › Metazoa › Chordata › Craniata › Vertebrata › Euteleostomi › Mammalia › Eutheria › Euarchontoglires › Primates › Haplorrhini › Catarrhini › Hominidae › Homo![]() |
Protein attributes
| Sequence length | 314 AA. |
| Sequence status | Complete. |
| Protein existence | Evidence at protein level |
General annotation (Comments)
| Function | Acts as a zinc-influx transporter Potential. |
| Subcellular location | Membrane; Multi-pass membrane protein Potential. |
| Sequence similarities | Belongs to the ZIP transporter (TC 2.A.5) family. [View classification] |
Ontologies
| Keywords | |
|---|---|
| Biological process | Ion transport Transport Zinc transport |
| Cellular component | Membrane |
| Coding sequence diversity | Alternative splicing Polymorphism |
| Domain | Transmembrane Transmembrane helix |
| Ligand | Zinc |
| PTM | Phosphoprotein |
| Technical term | Complete proteome Reference proteome |
| Gene Ontology (GO) | |
| Biological_process | transmembrane transport Traceable author statement. Source: Reactome |
| Cellular_component | integral to membrane Inferred from electronic annotation. Source: UniProtKB-KW plasma membraneTraceable author statement. Source: Reactome |
| Molecular_function | zinc ion transmembrane transporter activity Inferred from electronic annotation. Source: Compara |
| Complete GO annotation... | |
Alternative products
| This entry describes 2 isoforms produced by alternative splicing. [Align] [Select] | ||||||
| Isoform 1 (identifier: Q9BRY0-1) This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry. | ||||||
| Isoform 2 (identifier: Q9BRY0-2) The sequence of this isoform differs from the canonical sequence as follows: 71-105: LQKVLSLGHISTDYPLAETILLLGFFMTVFLEQLI → VRAPWALAAALGTLWPRDSDAFSTLMPSSVKALML 106-314: Missing. |
Sequence annotation (Features)
| Feature key | Position(s) | Length | Description | Graphical view | Feature identifier | ||||
Molecule processing | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| Chain | 1 – 314 | 314 | Zinc transporter ZIP3 | PRO_0000312868 | |||||
Regions | |||||||||
| Topological domain | 1 – 3 | 3 | Extracellular Potential | ||||||
| Transmembrane | 4 – 24 | 21 | Helical; Potential | ||||||
| Topological domain | 25 – 42 | 18 | Cytoplasmic Potential | ||||||
| Transmembrane | 43 – 63 | 21 | Helical; Potential | ||||||
| Topological domain | 64 – 85 | 22 | Extracellular Potential | ||||||
| Transmembrane | 86 – 106 | 21 | Helical; Potential | ||||||
| Topological domain | 107 – 169 | 63 | Cytoplasmic Potential | ||||||
| Transmembrane | 170 – 190 | 21 | Helical; Potential | ||||||
| Topological domain | 191 – 196 | 6 | Extracellular Potential | ||||||
| Transmembrane | 197 – 217 | 21 | Helical; Potential | ||||||
| Topological domain | 218 – 229 | 12 | Cytoplasmic Potential | ||||||
| Transmembrane | 230 – 250 | 21 | Helical; Potential | ||||||
| Topological domain | 251 – 262 | 12 | Extracellular Potential | ||||||
| Transmembrane | 263 – 283 | 21 | Helical; Potential | ||||||
| Topological domain | 284 – 292 | 9 | Cytoplasmic Potential | ||||||
| Transmembrane | 293 – 313 | 21 | Helical; Potential | ||||||
| Topological domain | 314 | 1 | Extracellular Potential | ||||||
Amino acid modifications | |||||||||
| Modified residue | 125 | 1 | Phosphoserine Ref.3 Ref.4 | ||||||
Natural variations | |||||||||
| Alternative sequence | 71 – 105 | 35 | LQKVL…LEQLI → VRAPWALAAALGTLWPRDSD AFSTLMPSSVKALML in isoform 2. | VSP_029920 | |||||
| Alternative sequence | 106 – 314 | 209 | Missing in isoform 2. | VSP_029921 | |||||
| Natural variant | 100 | 1 | F → L. Corresponds to variant rs11539244 [ dbSNP | Ensembl ]. | VAR_037599 | |||||
| Natural variant | 257 | 1 | P → L. Corresponds to variant rs35594294 [ dbSNP | Ensembl ]. | VAR_037600 | |||||
Sequences
| ||||||||||||||||||||||||
References
| [1] | "Complete sequencing and characterization of 21,243 full-length human cDNAs." Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. Sugano S.Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2). Tissue: Placenta. |
| [2] | "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)." The MGC Project Team Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract] Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2). Tissue: Duodenum and Lymph. |
| [3] | "Kinase-selective enrichment enables quantitative phosphoproteomics of the kinome across the cell cycle." Daub H., Olsen J.V., Bairlein M., Gnad F., Oppermann F.S., Korner R., Greff Z., Keri G., Stemmann O., Mann M. Mol. Cell 31:438-448(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [4] | "A quantitative atlas of mitotic phosphorylation." Dephoure N., Zhou C., Villen J., Beausoleil S.A., Bakalarski C.E., Elledge S.J., Gygi S.P. Proc. Natl. Acad. Sci. U.S.A. 105:10762-10767(2008) [PubMed] [Europe PMC] [Abstract] Cited for: PHOSPHORYLATION [LARGE SCALE ANALYSIS] AT SER-125, MASS SPECTROMETRY. Tissue: Cervix carcinoma. |
| [5] | "Quantitative phosphoproteomic analysis of T cell receptor signaling reveals system-wide modulation of protein-protein interactions." Mayya V., Lundgren D.H., Hwang S.-I., Rezaul K., Wu L., Eng J.K., Rodionov V., Han D.K. Sci. Signal. 2:RA46-RA46(2009) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Leukemic T-cell. |
| [6] | "Quantitative phosphoproteomics reveals widespread full phosphorylation site occupancy during mitosis." Olsen J.V., Vermeulen M., Santamaria A., Kumar C., Miller M.L., Jensen L.J., Gnad F., Cox J., Jensen T.S., Nigg E.A., Brunak S., Mann M. Sci. Signal. 3:RA3-RA3(2010) [PubMed] [Europe PMC] [Abstract] Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS]. Tissue: Cervix carcinoma. |
| + | Additional computationally mapped references. |
Cross-references
Sequence databases | |
|---|---|
| EMBL GenBank DDBJ | AK002044 mRNA. Translation: BAG51005.1. BC005869 mRNA. Translation: AAH05869.2. BC020571 mRNA. Translation: AAH20571.1. |
| IPI | IPI00029337. IPI00382918. |
| RefSeq | NP_653165.2. NM_144564.4. NP_998733.1. NM_213568.1. |
| UniGene | Hs.515046. |
3D structure databases | |
| ProteinModelPortal | Q9BRY0. |
| ModBase | Search... |
Protein-protein interaction databases | |
| STRING | 9606.ENSP00000269740. |
Protein family/group databases | |
| TCDB | 2.A.5.3.3. zinc (Zn2+)-iron (Fe2+) permease (ZIP) family. |
PTM databases | |
| PhosphoSite | Q9BRY0. |
Polymorphism databases | |
| DMDM | 74732942. |
Proteomic databases | |
| PaxDb | Q9BRY0. |
| PRIDE | Q9BRY0. |
Protocols and materials databases | |
| StructuralBiologyKnowledgebase | Search... |
Genome annotation databases | |
| Ensembl | ENST00000269740; ENSP00000269740; ENSG00000141873. ENST00000455372; ENSP00000393715; ENSG00000141873. |
| GeneID | 29985. |
| KEGG | hsa:29985. |
| UCSC | uc002lwg.3. human. uc002lwh.3. human. |
Organism-specific databases | |
| CTD | 29985. |
| GeneCards | GC19M002732. |
| HGNC | HGNC:17128. SLC39A3. |
| HPA | HPA042139. |
| MIM | 612168. gene. |
| neXtProt | NX_Q9BRY0. |
| PharmGKB | PA38203. |
| GenAtlas | Search... |
Phylogenomic databases | |
| eggNOG | KOG1558. |
| HOVERGEN | HBG108447. |
| InParanoid | Q9BRY0. |
| KO | K14709. |
| OrthoDB | EOG47D9H5. |
| PhylomeDB | Q9BRY0. |
Enzyme and pathway databases | |
| Reactome | REACT_15518. Transmembrane transport of small molecules. |
Gene expression databases | |
| ArrayExpress | Q9BRY0. |
| Bgee | Q9BRY0. |
| CleanEx | HS_SLC39A3. |
| Genevestigator | Q9BRY0. |
Family and domain databases | |
| InterPro | IPR003689. ZIP. [Graphical view] |
| Pfam | PF02535. Zip. 1 hit. [Graphical view] |
| ProtoNet | Search... |
Other | |
| GenomeRNAi | 29985. |
| NextBio | 52750. |
| SOURCE | Search... |
Entry information
| Entry name | S39A3_HUMAN | ||||||||
| Accession | Primary (citable) accession number: Q9BRY0 Secondary accession number(s): B3KMJ3, Q8WUG1 | ||||||||
| Entry history |
| ||||||||
| Entry status | Reviewed (UniProtKB/Swiss-Prot) | ||||||||
| Annotation program | Chordata Protein Annotation Program | ||||||||
| Disclaimer | Any medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care. | ||||||||
Relevant documents
| Human chromosome 19 Human chromosome 19: entries, gene names and cross-references to MIM |
| Human entries with polymorphisms or disease mutations List of human entries with polymorphisms or disease mutations |
| Human polymorphisms and disease mutations Index of human polymorphisms and disease mutations |
| MIM cross-references Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot |
| SIMILARITY comments Index of protein domains and families |

Clusters with
