Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA replication complex GINS protein PSF3

Gene

GINS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: -Experimental evidence at protein leveli

Functioni

The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA.1 Publication

GO - Biological processi

Keywordsi

Biological processDNA replication

Enzyme and pathway databases

ReactomeiR-HSA-176974 Unwinding of DNA

Names & Taxonomyi

Protein namesi
Recommended name:
DNA replication complex GINS protein PSF3
Alternative name(s):
GINS complex subunit 3
Gene namesi
Name:GINS3
Synonyms:PSF3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
Proteomesi
  • UP000005640 Componenti: Chromosome 16

Organism-specific databases

EuPathDBiHostDB:ENSG00000181938.13
HGNCiHGNC:25851 GINS3
MIMi610610 gene
neXtProtiNX_Q9BRX5

Subcellular locationi

Extracellular region or secreted Cytosol Plasma membrane Cytoskeleton Lysosome Endosome Peroxisome ER Golgi apparatus Nucleus Mitochondrion Manual annotation Automatic computational assertionGraphics by Christian Stolte; Source: COMPARTMENTS

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

DisGeNETi64785
OpenTargetsiENSG00000181938
PharmGKBiPA145008327

Polymorphism and mutation databases

BioMutaiGINS3
DMDMi74732939

PTM / Processingi

Molecule processing

Feature keyPosition(s)DescriptionActionsGraphical viewLength
ChainiPRO_00003276151 – 216DNA replication complex GINS protein PSF3Add BLAST216

Proteomic databases

EPDiQ9BRX5
MaxQBiQ9BRX5
PeptideAtlasiQ9BRX5
PRIDEiQ9BRX5

PTM databases

iPTMnetiQ9BRX5
PhosphoSitePlusiQ9BRX5

Expressioni

Gene expression databases

BgeeiENSG00000181938
CleanExiHS_GINS3
ExpressionAtlasiQ9BRX5 baseline and differential
GenevisibleiQ9BRX5 HS

Organism-specific databases

HPAiHPA041216
HPA048209

Interactioni

Subunit structurei

Component of the GINS complex which is a heterotetramer of GINS1, GINS2, GINS3 and GINS4. Forms a stable subcomplex with GINS2. GINS complex interacts with DNA primase in vitro.5 Publications

Binary interactionsi

Show more details

Protein-protein interaction databases

BioGridi122295, 40 interactors
CORUMiQ9BRX5
DIPiDIP-29333N
IntActiQ9BRX5, 7 interactors

Structurei

Secondary structure

1216
Legend: HelixTurnBeta strandPDB Structure known for this area
Show more details
Feature keyPosition(s)DescriptionActionsGraphical viewLength
Beta strandi14 – 16Combined sources3
Helixi22 – 27Combined sources6
Beta strandi30 – 38Combined sources9
Beta strandi40 – 42Combined sources3
Helixi44 – 46Combined sources3
Helixi55 – 57Combined sources3
Beta strandi65 – 69Combined sources5
Helixi70 – 76Combined sources7
Beta strandi79 – 86Combined sources8
Helixi90 – 92Combined sources3
Helixi94 – 102Combined sources9
Helixi104 – 106Combined sources3
Turni109 – 111Combined sources3
Helixi116 – 122Combined sources7
Helixi123 – 126Combined sources4
Helixi131 – 153Combined sources23
Turni154 – 157Combined sources4
Helixi162 – 165Combined sources4
Helixi170 – 190Combined sources21

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
PDB entryMethodResolution (Å)ChainPositionsPDBsum
2E9XX-ray2.30C/G1-216[»]
2EHOX-ray3.00D/H/L1-216[»]
2Q9QX-ray2.36D/H2-216[»]
ProteinModelPortaliQ9BRX5
SMRiQ9BRX5
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9BRX5

Family & Domainsi

Region

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Regioni1 – 16Not essential for folding and stability of GINS complex, but may regulate accessibility to the central complex poreAdd BLAST16

Sequence similaritiesi

Belongs to the GINS3/PSF3 family.Curated

Phylogenomic databases

GeneTreeiENSGT00390000001622
HOGENOMiHOG000007879
HOVERGENiHBG057574
InParanoidiQ9BRX5
KOiK10734
OMAiGTKMELP
OrthoDBiEOG091G0QNW
PhylomeDBiQ9BRX5
TreeFamiTF314626

Family and domain databases

Gene3Di1.20.58.2050, 1 hit
InterProiView protein in InterPro
IPR021151 GINS_A
IPR036224 GINS_bundle-like_dom_sf
IPR010492 GINS_Psf3
IPR038437 GINS_Psf3_sf
PANTHERiPTHR22768 PTHR22768, 1 hit
PfamiView protein in Pfam
PF05916 Sld5, 1 hit
SUPFAMiSSF158573 SSF158573, 1 hit

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BRX5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEAYFRVES GALGPEENFL SLDDILMSHE KLPVRTETAM PRLGAFFLER
60 70 80 90 100
SAGAETDNAV PQGSKLELPL WLAKGLFDNK RRILSVELPK IYQEGWRTVF
110 120 130 140 150
SADPNVVDLH KMGPHFYGFG SQLLHFDSPE NADISQSLLQ TFIGRFRRIM
160 170 180 190 200
DSSQNAYNED TSALVARLDE MERGLFQTGQ KGLNDFQCWE KGQASQITAS
210
NLVQNYKKRK FTDMED
Length:216
Mass (Da):24,535
Last modified:June 1, 2001 - v1
Checksum:iA1B264A72371C551
GO
Isoform 2 (identifier: Q9BRX5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     62-139: Missing.

Show »
Length:138
Mass (Da):15,655
Checksum:i50D249B01A5F66EE
GO
Isoform 3 (identifier: Q9BRX5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-63: G → GFALLPRLECSGVIWLTAALTSQAPEILPPQPPMWLVLQG

Note: Gene prediction based on EST data.
Show »
Length:255
Mass (Da):28,775
Checksum:i99614F114B6B6CF1
GO

Mass spectrometryi

Molecular mass is 98373±13 Da from positions 1 - 216. Determined by ESI. This is the measured mass for the GINS complex.1 Publication

Alternative sequence

Feature keyPosition(s)DescriptionActionsGraphical viewLength
Alternative sequenceiVSP_03273762 – 139Missing in isoform 2. 2 PublicationsAdd BLAST78
Alternative sequenceiVSP_04669463G → GFALLPRLECSGVIWLTAAL TSQAPEILPPQPPMWLVLQG in isoform 3. Curated1

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023974 mRNA Translation: BAB14747.1
AK315622 mRNA Translation: BAG37990.1
CR457283 mRNA Translation: CAG33564.1
AC009107 Genomic DNA No translation available.
AC009118 Genomic DNA No translation available.
AC084063 Genomic DNA No translation available.
CH471092 Genomic DNA Translation: EAW82973.1
CH471092 Genomic DNA Translation: EAW82976.1
BC005879 mRNA Translation: AAH05879.1
BC014437 mRNA Translation: AAH14437.1
CCDSiCCDS10796.1 [Q9BRX5-1]
CCDS45498.1 [Q9BRX5-3]
CCDS45499.1 [Q9BRX5-2]
RefSeqiNP_001119601.1, NM_001126129.1 [Q9BRX5-3]
NP_001119602.1, NM_001126130.1 [Q9BRX5-2]
NP_073607.2, NM_022770.3 [Q9BRX5-1]
UniGeneiHs.47125
Hs.605546

Genome annotation databases

EnsembliENST00000318129; ENSP00000318196; ENSG00000181938 [Q9BRX5-1]
ENST00000328514; ENSP00000327449; ENSG00000181938 [Q9BRX5-2]
ENST00000426538; ENSP00000401018; ENSG00000181938 [Q9BRX5-3]
GeneIDi64785
KEGGihsa:64785
UCSCiuc002enh.4 human [Q9BRX5-1]

Keywords - Coding sequence diversityi

Alternative splicing

Similar proteinsi

Entry informationi

Entry nameiPSF3_HUMAN
AccessioniPrimary (citable) accession number: Q9BRX5
Secondary accession number(s): B2RDP3, E9PB21, Q9H870
Entry historyiIntegrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: June 1, 2001
Last modified: March 28, 2018
This is version 131 of the entry and version 1 of the sequence. See complete history.
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

We'd like to inform you that we have updated our Privacy Notice to comply with Europe’s new General Data Protection Regulation (GDPR) that applies since 25 May 2018.

Do not show this banner again
UniProt is an ELIXIR core data resource
Main funding by: National Institutes of Health