Skip Header

You are using a version of Internet Explorer that may not display all features of this website. Please upgrade to a modern browser.
Contribute Send feedback
Read comments (?) or add your own

Q9BRX5 (PSF3_HUMAN) Reviewed, UniProtKB/Swiss-Prot

Last modified July 9, 2014. Version 102. Feed History...

Clusters with 100%, 90%, 50% identity | Documents (4) | Third-party data text xml rdf/xml gff fasta
to top of pageNames·Attributes·General annotation·Ontologies·Alt products·Sequence annotation·Sequences·References·Cross-refs·Entry info·DocumentsCustomize order

Names and origin

Protein namesRecommended name:
DNA replication complex GINS protein PSF3
Alternative name(s):
GINS complex subunit 3
Gene names
Name:GINS3
Synonyms:PSF3
OrganismHomo sapiens (Human) [Reference proteome]
Taxonomic identifier9606 [NCBI]
Taxonomic lineageEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo

Protein attributes

Sequence length216 AA.
Sequence statusComplete.
Protein existenceEvidence at protein level

General annotation (Comments)

Function

The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA. Ref.10

Subunit structure

Component of the GINS complex which is a heterotetramer of GINS1, GINS2, GINS3 and GINS4. Forms a stable subcomplex with GINS2. GINS complex interacts with DNA primase in vitro. Ref.6 Ref.8 Ref.9 Ref.10 Ref.11

Subcellular location

Nucleus By similarity.

Sequence similarities

Belongs to the GINS3/PSF3 family.

Mass spectrometry

Molecular mass is 98373±13 Da from positions 1 - 216. Determined by ESI. This is the measured mass for the GINS complex. Ref.8

Ontologies

Keywords
   Biological processDNA replication
   Cellular componentNucleus
   Coding sequence diversityAlternative splicing
   Technical term3D-structure
Complete proteome
Reference proteome
Gene Ontology (GO)
   Biological_processDNA replication

Inferred from electronic annotation. Source: UniProtKB-KW

   Cellular_componentnucleus

Inferred from direct assay. Source: HPA

Complete GO annotation...

Alternative products

This entry describes 3 isoforms produced by alternative splicing. [Align] [Select]
Isoform 1 (identifier: Q9BRX5-1)

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.
Isoform 2 (identifier: Q9BRX5-2)

The sequence of this isoform differs from the canonical sequence as follows:
     62-139: Missing.
Isoform 3 (identifier: Q9BRX5-3)

The sequence of this isoform differs from the canonical sequence as follows:
     63-63: G → GFALLPRLECSGVIWLTAALTSQAPEILPPQPPMWLVLQG
Note: Gene prediction based on EST data.

Sequence annotation (Features)

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifier

Molecule processing

Chain1 – 216216DNA replication complex GINS protein PSF3
PRO_0000327615

Regions

Region1 – 1616Not essential for folding and stability of GINS complex, but may regulate accessibility to the central complex pore

Natural variations

Alternative sequence62 – 13978Missing in isoform 2.
VSP_032737
Alternative sequence631G → GFALLPRLECSGVIWLTAAL TSQAPEILPPQPPMWLVLQG in isoform 3.
VSP_046694

Secondary structure

.................................... 216
Helix Strand Turn

Details...

Sequences

Sequence LengthMass (Da)Tools
Isoform 1 [UniParc].

Last modified June 1, 2001. Version 1.
Checksum: A1B264A72371C551

FASTA21624,535
        10         20         30         40         50         60 
MSEAYFRVES GALGPEENFL SLDDILMSHE KLPVRTETAM PRLGAFFLER SAGAETDNAV 

        70         80         90        100        110        120 
PQGSKLELPL WLAKGLFDNK RRILSVELPK IYQEGWRTVF SADPNVVDLH KMGPHFYGFG 

       130        140        150        160        170        180 
SQLLHFDSPE NADISQSLLQ TFIGRFRRIM DSSQNAYNED TSALVARLDE MERGLFQTGQ 

       190        200        210 
KGLNDFQCWE KGQASQITAS NLVQNYKKRK FTDMED 

« Hide

Isoform 2 [UniParc].

Checksum: 50D249B01A5F66EE
Show »

FASTA13815,655
Isoform 3 [UniParc].

Checksum: 99614F114B6B6CF1
Show »

FASTA25528,775

References

« Hide 'large scale' references
[1]"Complete sequencing and characterization of 21,243 full-length human cDNAs."
Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S. expand/collapse author list , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
[2]"Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
[3]"The sequence and analysis of duplication-rich human chromosome 16."
Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J. expand/collapse author list , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[4]Mural R.J., Istrail S., Sutton G.G., Florea L., Halpern A.L., Mobarry C.M., Lippert R., Walenz B., Shatkay H., Dew I., Miller J.R., Flanigan M.J., Edwards N.J., Bolanos R., Fasulo D., Halldorsson B.V., Hannenhalli S., Turner R. expand/collapse author list , Yooseph S., Lu F., Nusskern D.R., Shue B.C., Zheng X.H., Zhong F., Delcher A.L., Huson D.H., Kravitz S.A., Mouchard L., Reinert K., Remington K.A., Clark A.G., Waterman M.S., Eichler E.E., Adams M.D., Hunkapiller M.W., Myers E.W., Venter J.C.
Submitted (JUL-2005) to the EMBL/GenBank/DDBJ databases
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
[5]"The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
The MGC Project Team
Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
Tissue: Muscle and Skin.
[6]"The human GINS complex binds to and specifically stimulates human DNA polymerase alpha-primase."
De Falco M., Ferrari E., De Felice M., Rossi M., Hubscher U., Pisani F.M.
EMBO Rep. 8:99-103(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: SUBUNIT, INTERACTION WITH DNA PRIMASE.
[7]"Initial characterization of the human central proteome."
Burkard T.R., Planyavsky M., Kaupe I., Breitwieser F.P., Buerckstuemmer T., Bennett K.L., Superti-Furga G., Colinge J.
BMC Syst. Biol. 5:17-17(2011) [PubMed] [Europe PMC] [Abstract]
Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
[8]"Molecular architecture of the human GINS complex."
Boskovic J., Coloma J., Aparicio T., Zhou M., Robinson C.V., Mendez J., Montoya G.
EMBO Rep. 8:678-684(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: STRUCTURE BY ELECTRON MICROSCOPY (33 ANGSTROMS) IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT, MASS SPECTROMETRY OF GINS COMPLEX.
[9]"Crystal structure of the human GINS complex."
Choi J.M., Lim H.S., Kim J.J., Song O.K., Cho Y.
Genes Dev. 21:1316-1321(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT.
[10]"Structure of the human GINS complex and its assembly and functional interface in replication initiation."
Kamada K., Kubota Y., Arata T., Shindo Y., Hanaoka F.
Nat. Struct. Mol. Biol. 14:388-396(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: FUNCTION, X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT.
[11]"Crystal structure of the GINS complex and functional insights into its role in DNA replication."
Chang Y.P., Wang G., Bermudez V., Hurwitz J., Chen X.S.
Proc. Natl. Acad. Sci. U.S.A. 104:12685-12690(2007) [PubMed] [Europe PMC] [Abstract]
Cited for: X-RAY CRYSTALLOGRAPHY (2.36 ANGSTROMS) OF 2-216 IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT, REGION.
+Additional computationally mapped references.

Cross-references

Sequence databases

EMBL
GenBank
DDBJ
AK023974 mRNA. Translation: BAB14747.1.
AK315622 mRNA. Translation: BAG37990.1.
CR457283 mRNA. Translation: CAG33564.1.
AC009107 Genomic DNA. No translation available.
AC009118 Genomic DNA. No translation available.
AC084063 Genomic DNA. No translation available.
CH471092 Genomic DNA. Translation: EAW82973.1.
CH471092 Genomic DNA. Translation: EAW82976.1.
BC005879 mRNA. Translation: AAH05879.1.
BC014437 mRNA. Translation: AAH14437.1.
CCDSCCDS10796.1. [Q9BRX5-1]
CCDS45498.1. [Q9BRX5-3]
CCDS45499.1. [Q9BRX5-2]
RefSeqNP_001119601.1. NM_001126129.1. [Q9BRX5-3]
NP_001119602.1. NM_001126130.1. [Q9BRX5-2]
NP_073607.2. NM_022770.3. [Q9BRX5-1]
UniGeneHs.47125.
Hs.605546.

3D structure databases

PDBe
RCSB-PDB
PDBj
EntryMethodResolution (Å)ChainPositionsPDBsum
2E9XX-ray2.30C/G1-216[»]
2EHOX-ray3.00D/H/L1-216[»]
2Q9QX-ray2.36D/H2-216[»]
ProteinModelPortalQ9BRX5.
SMRQ9BRX5. Positions 2-193.
ModBaseSearch...
MobiDBSearch...

Protein-protein interaction databases

BioGrid122295. 24 interactions.
DIPDIP-29333N.
IntActQ9BRX5. 1 interaction.
STRING9606.ENSP00000401018.

PTM databases

PhosphoSiteQ9BRX5.

Polymorphism databases

DMDM74732939.

Proteomic databases

MaxQBQ9BRX5.
PaxDbQ9BRX5.
PRIDEQ9BRX5.

Protocols and materials databases

DNASU64785.
StructuralBiologyKnowledgebaseSearch...

Genome annotation databases

EnsemblENST00000318129; ENSP00000318196; ENSG00000181938. [Q9BRX5-1]
ENST00000328514; ENSP00000327449; ENSG00000181938. [Q9BRX5-2]
ENST00000426538; ENSP00000401018; ENSG00000181938. [Q9BRX5-3]
GeneID64785.
KEGGhsa:64785.
UCSCuc002enh.4. human. [Q9BRX5-1]
uc002enj.4. human. [Q9BRX5-2]

Organism-specific databases

CTD64785.
GeneCardsGC16P058426.
HGNCHGNC:25851. GINS3.
HPAHPA041216.
HPA048209.
MIM610610. gene.
neXtProtNX_Q9BRX5.
PharmGKBPA145008327.
GenAtlasSearch...

Phylogenomic databases

eggNOGCOG5138.
HOGENOMHOG000007879.
HOVERGENHBG057574.
InParanoidQ9BRX5.
KOK10734.
OMAQQGWRTV.
OrthoDBEOG7HXCS9.
PhylomeDBQ9BRX5.
TreeFamTF314626.

Gene expression databases

ArrayExpressQ9BRX5.
BgeeQ9BRX5.
CleanExHS_GINS3.
GenevestigatorQ9BRX5.

Family and domain databases

InterProIPR021151. GINS_complex.
IPR010492. GINS_Psf3.
[Graphical view]
PANTHERPTHR22768. PTHR22768. 1 hit.
PfamPF05916. Sld5. 1 hit.
[Graphical view]
ProtoNetSearch...

Other

EvolutionaryTraceQ9BRX5.
GenomeRNAi64785.
NextBio66832.
PROQ9BRX5.
SOURCESearch...

Entry information

Entry namePSF3_HUMAN
AccessionPrimary (citable) accession number: Q9BRX5
Secondary accession number(s): B2RDP3, E9PB21, Q9H870
Entry history
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: June 1, 2001
Last modified: July 9, 2014
This is version 102 of the entry and version 1 of the sequence. [Complete history]
Entry statusReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Relevant documents

SIMILARITY comments

Index of protein domains and families

PDB cross-references

Index of Protein Data Bank (PDB) cross-references

MIM cross-references

Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot

Human chromosome 16

Human chromosome 16: entries, gene names and cross-references to MIM