Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Basket 0
(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Q9BRX5

- PSF3_HUMAN

UniProt

Q9BRX5 - PSF3_HUMAN

Protein

DNA replication complex GINS protein PSF3

Gene

GINS3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli
    • BLAST
    • Align
    • Format
    • Add to basket
    • History
      Entry version 103 (01 Oct 2014)
      Sequence version 1 (01 Jun 2001)
      Previous versions | rss
    • Help video
    • Feedback
    • Comment

    Functioni

    The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA.1 Publication

    GO - Biological processi

    1. DNA replication Source: UniProtKB-KW

    Keywords - Biological processi

    DNA replication

    Names & Taxonomyi

    Protein namesi
    Recommended name:
    DNA replication complex GINS protein PSF3
    Alternative name(s):
    GINS complex subunit 3
    Gene namesi
    Name:GINS3
    Synonyms:PSF3
    OrganismiHomo sapiens (Human)
    Taxonomic identifieri9606 [NCBI]
    Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
    ProteomesiUP000005640: Chromosome 16

    Organism-specific databases

    HGNCiHGNC:25851. GINS3.

    Subcellular locationi

    Nucleus By similarity

    GO - Cellular componenti

    1. nucleus Source: HPA

    Keywords - Cellular componenti

    Nucleus

    Pathology & Biotechi

    Organism-specific databases

    PharmGKBiPA145008327.

    PTM / Processingi

    Molecule processing

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Chaini1 – 216216DNA replication complex GINS protein PSF3PRO_0000327615Add
    BLAST

    Proteomic databases

    MaxQBiQ9BRX5.
    PaxDbiQ9BRX5.
    PRIDEiQ9BRX5.

    PTM databases

    PhosphoSiteiQ9BRX5.

    Expressioni

    Gene expression databases

    ArrayExpressiQ9BRX5.
    BgeeiQ9BRX5.
    CleanExiHS_GINS3.
    GenevestigatoriQ9BRX5.

    Organism-specific databases

    HPAiHPA041216.
    HPA048209.

    Interactioni

    Subunit structurei

    Component of the GINS complex which is a heterotetramer of GINS1, GINS2, GINS3 and GINS4. Forms a stable subcomplex with GINS2. GINS complex interacts with DNA primase in vitro.5 Publications

    Protein-protein interaction databases

    BioGridi122295. 24 interactions.
    DIPiDIP-29333N.
    IntActiQ9BRX5. 1 interaction.
    STRINGi9606.ENSP00000401018.

    Structurei

    Secondary structure

    1
    216
    Legend: HelixTurnBeta strand
    Show more details
    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Beta strandi14 – 163
    Helixi22 – 276
    Beta strandi30 – 389
    Beta strandi40 – 423
    Helixi44 – 463
    Helixi55 – 573
    Beta strandi65 – 695
    Helixi70 – 767
    Beta strandi79 – 868
    Helixi90 – 923
    Helixi94 – 1029
    Helixi104 – 1063
    Turni109 – 1113
    Helixi116 – 1227
    Helixi123 – 1264
    Helixi131 – 15323
    Turni154 – 1574
    Helixi162 – 1654
    Helixi170 – 19021

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    EntryMethodResolution (Å)ChainPositionsPDBsum
    2E9XX-ray2.30C/G1-216[»]
    2EHOX-ray3.00D/H/L1-216[»]
    2Q9QX-ray2.36D/H2-216[»]
    ProteinModelPortaliQ9BRX5.
    SMRiQ9BRX5. Positions 2-193.
    ModBaseiSearch...
    MobiDBiSearch...

    Miscellaneous databases

    EvolutionaryTraceiQ9BRX5.

    Family & Domainsi

    Region

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Regioni1 – 1616Not essential for folding and stability of GINS complex, but may regulate accessibility to the central complex poreAdd
    BLAST

    Sequence similaritiesi

    Belongs to the GINS3/PSF3 family.Curated

    Phylogenomic databases

    eggNOGiCOG5138.
    HOGENOMiHOG000007879.
    HOVERGENiHBG057574.
    InParanoidiQ9BRX5.
    KOiK10734.
    OMAiQQGWRTV.
    OrthoDBiEOG7HXCS9.
    PhylomeDBiQ9BRX5.
    TreeFamiTF314626.

    Family and domain databases

    InterProiIPR021151. GINS_complex.
    IPR010492. GINS_Psf3.
    [Graphical view]
    PANTHERiPTHR22768. PTHR22768. 1 hit.
    PfamiPF05916. Sld5. 1 hit.
    [Graphical view]

    Sequences (3)i

    Sequence statusi: Complete.

    This entry describes 3 isoformsi produced by alternative splicing. Align

    Isoform 1 (identifier: Q9BRX5-1) [UniParc]FASTAAdd to Basket

    This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

    « Hide

    MSEAYFRVES GALGPEENFL SLDDILMSHE KLPVRTETAM PRLGAFFLER    50
    SAGAETDNAV PQGSKLELPL WLAKGLFDNK RRILSVELPK IYQEGWRTVF 100
    SADPNVVDLH KMGPHFYGFG SQLLHFDSPE NADISQSLLQ TFIGRFRRIM 150
    DSSQNAYNED TSALVARLDE MERGLFQTGQ KGLNDFQCWE KGQASQITAS 200
    NLVQNYKKRK FTDMED 216
    Length:216
    Mass (Da):24,535
    Last modified:June 1, 2001 - v1
    Checksum:iA1B264A72371C551
    GO
    Isoform 2 (identifier: Q9BRX5-2) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         62-139: Missing.

    Show »
    Length:138
    Mass (Da):15,655
    Checksum:i50D249B01A5F66EE
    GO
    Isoform 3 (identifier: Q9BRX5-3) [UniParc]FASTAAdd to Basket

    The sequence of this isoform differs from the canonical sequence as follows:
         63-63: G → GFALLPRLECSGVIWLTAALTSQAPEILPPQPPMWLVLQG

    Note: Gene prediction based on EST data.

    Show »
    Length:255
    Mass (Da):28,775
    Checksum:i99614F114B6B6CF1
    GO

    Mass spectrometryi

    Molecular mass is 98373±13 Da from positions 1 - 216. Determined by ESI. This is the measured mass for the GINS complex.1 Publication

    Alternative sequence

    Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
    Alternative sequencei62 – 13978Missing in isoform 2. 2 PublicationsVSP_032737Add
    BLAST
    Alternative sequencei63 – 631G → GFALLPRLECSGVIWLTAAL TSQAPEILPPQPPMWLVLQG in isoform 3. CuratedVSP_046694

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK023974 mRNA. Translation: BAB14747.1.
    AK315622 mRNA. Translation: BAG37990.1.
    CR457283 mRNA. Translation: CAG33564.1.
    AC009107 Genomic DNA. No translation available.
    AC009118 Genomic DNA. No translation available.
    AC084063 Genomic DNA. No translation available.
    CH471092 Genomic DNA. Translation: EAW82973.1.
    CH471092 Genomic DNA. Translation: EAW82976.1.
    BC005879 mRNA. Translation: AAH05879.1.
    BC014437 mRNA. Translation: AAH14437.1.
    CCDSiCCDS10796.1. [Q9BRX5-1]
    CCDS45498.1. [Q9BRX5-3]
    CCDS45499.1. [Q9BRX5-2]
    RefSeqiNP_001119601.1. NM_001126129.1. [Q9BRX5-3]
    NP_001119602.1. NM_001126130.1. [Q9BRX5-2]
    NP_073607.2. NM_022770.3. [Q9BRX5-1]
    UniGeneiHs.47125.
    Hs.605546.

    Genome annotation databases

    EnsembliENST00000318129; ENSP00000318196; ENSG00000181938. [Q9BRX5-1]
    ENST00000328514; ENSP00000327449; ENSG00000181938. [Q9BRX5-2]
    ENST00000426538; ENSP00000401018; ENSG00000181938. [Q9BRX5-3]
    GeneIDi64785.
    KEGGihsa:64785.
    UCSCiuc002enh.4. human. [Q9BRX5-1]
    uc002enj.4. human. [Q9BRX5-2]

    Polymorphism databases

    DMDMi74732939.

    Keywords - Coding sequence diversityi

    Alternative splicing

    Cross-referencesi

    Sequence databases

    Select the link destinations:
    EMBL
    GenBank
    DDBJ
    Links Updated
    AK023974 mRNA. Translation: BAB14747.1 .
    AK315622 mRNA. Translation: BAG37990.1 .
    CR457283 mRNA. Translation: CAG33564.1 .
    AC009107 Genomic DNA. No translation available.
    AC009118 Genomic DNA. No translation available.
    AC084063 Genomic DNA. No translation available.
    CH471092 Genomic DNA. Translation: EAW82973.1 .
    CH471092 Genomic DNA. Translation: EAW82976.1 .
    BC005879 mRNA. Translation: AAH05879.1 .
    BC014437 mRNA. Translation: AAH14437.1 .
    CCDSi CCDS10796.1. [Q9BRX5-1 ]
    CCDS45498.1. [Q9BRX5-3 ]
    CCDS45499.1. [Q9BRX5-2 ]
    RefSeqi NP_001119601.1. NM_001126129.1. [Q9BRX5-3 ]
    NP_001119602.1. NM_001126130.1. [Q9BRX5-2 ]
    NP_073607.2. NM_022770.3. [Q9BRX5-1 ]
    UniGenei Hs.47125.
    Hs.605546.

    3D structure databases

    Select the link destinations:
    PDBe
    RCSB PDB
    PDBj
    Links Updated
    Entry Method Resolution (Å) Chain Positions PDBsum
    2E9X X-ray 2.30 C/G 1-216 [» ]
    2EHO X-ray 3.00 D/H/L 1-216 [» ]
    2Q9Q X-ray 2.36 D/H 2-216 [» ]
    ProteinModelPortali Q9BRX5.
    SMRi Q9BRX5. Positions 2-193.
    ModBasei Search...
    MobiDBi Search...

    Protein-protein interaction databases

    BioGridi 122295. 24 interactions.
    DIPi DIP-29333N.
    IntActi Q9BRX5. 1 interaction.
    STRINGi 9606.ENSP00000401018.

    PTM databases

    PhosphoSitei Q9BRX5.

    Polymorphism databases

    DMDMi 74732939.

    Proteomic databases

    MaxQBi Q9BRX5.
    PaxDbi Q9BRX5.
    PRIDEi Q9BRX5.

    Protocols and materials databases

    DNASUi 64785.
    Structural Biology Knowledgebase Search...

    Genome annotation databases

    Ensembli ENST00000318129 ; ENSP00000318196 ; ENSG00000181938 . [Q9BRX5-1 ]
    ENST00000328514 ; ENSP00000327449 ; ENSG00000181938 . [Q9BRX5-2 ]
    ENST00000426538 ; ENSP00000401018 ; ENSG00000181938 . [Q9BRX5-3 ]
    GeneIDi 64785.
    KEGGi hsa:64785.
    UCSCi uc002enh.4. human. [Q9BRX5-1 ]
    uc002enj.4. human. [Q9BRX5-2 ]

    Organism-specific databases

    CTDi 64785.
    GeneCardsi GC16P058426.
    HGNCi HGNC:25851. GINS3.
    HPAi HPA041216.
    HPA048209.
    MIMi 610610. gene.
    neXtProti NX_Q9BRX5.
    PharmGKBi PA145008327.
    GenAtlasi Search...

    Phylogenomic databases

    eggNOGi COG5138.
    HOGENOMi HOG000007879.
    HOVERGENi HBG057574.
    InParanoidi Q9BRX5.
    KOi K10734.
    OMAi QQGWRTV.
    OrthoDBi EOG7HXCS9.
    PhylomeDBi Q9BRX5.
    TreeFami TF314626.

    Miscellaneous databases

    EvolutionaryTracei Q9BRX5.
    GenomeRNAii 64785.
    NextBioi 66832.
    PROi Q9BRX5.
    SOURCEi Search...

    Gene expression databases

    ArrayExpressi Q9BRX5.
    Bgeei Q9BRX5.
    CleanExi HS_GINS3.
    Genevestigatori Q9BRX5.

    Family and domain databases

    InterProi IPR021151. GINS_complex.
    IPR010492. GINS_Psf3.
    [Graphical view ]
    PANTHERi PTHR22768. PTHR22768. 1 hit.
    Pfami PF05916. Sld5. 1 hit.
    [Graphical view ]
    ProtoNeti Search...

    Publicationsi

    1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
      Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
      , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
      Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
    2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
      Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
      Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
    3. "The sequence and analysis of duplication-rich human chromosome 16."
      Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
      , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
      Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
    5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
      The MGC Project Team
      Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
      Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
      Tissue: Muscle and Skin.
    6. "The human GINS complex binds to and specifically stimulates human DNA polymerase alpha-primase."
      De Falco M., Ferrari E., De Felice M., Rossi M., Hubscher U., Pisani F.M.
      EMBO Rep. 8:99-103(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: SUBUNIT, INTERACTION WITH DNA PRIMASE.
    7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
    8. Cited for: STRUCTURE BY ELECTRON MICROSCOPY (33 ANGSTROMS) IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT, MASS SPECTROMETRY OF GINS COMPLEX.
    9. "Crystal structure of the human GINS complex."
      Choi J.M., Lim H.S., Kim J.J., Song O.K., Cho Y.
      Genes Dev. 21:1316-1321(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT.
    10. "Structure of the human GINS complex and its assembly and functional interface in replication initiation."
      Kamada K., Kubota Y., Arata T., Shindo Y., Hanaoka F.
      Nat. Struct. Mol. Biol. 14:388-396(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: FUNCTION, X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT.
    11. "Crystal structure of the GINS complex and functional insights into its role in DNA replication."
      Chang Y.P., Wang G., Bermudez V., Hurwitz J., Chen X.S.
      Proc. Natl. Acad. Sci. U.S.A. 104:12685-12690(2007) [PubMed] [Europe PMC] [Abstract]
      Cited for: X-RAY CRYSTALLOGRAPHY (2.36 ANGSTROMS) OF 2-216 IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT, REGION.

    Entry informationi

    Entry nameiPSF3_HUMAN
    AccessioniPrimary (citable) accession number: Q9BRX5
    Secondary accession number(s): B2RDP3, E9PB21, Q9H870
    Entry historyi
    Integrated into UniProtKB/Swiss-Prot: April 8, 2008
    Last sequence update: June 1, 2001
    Last modified: October 1, 2014
    This is version 103 of the entry and version 1 of the sequence. [Complete history]
    Entry statusiReviewed (UniProtKB/Swiss-Prot)
    Annotation programChordata Protein Annotation Program
    DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

    Miscellaneousi

    Keywords - Technical termi

    3D-structure, Complete proteome, Reference proteome

    Documents

    1. Human chromosome 16
      Human chromosome 16: entries, gene names and cross-references to MIM
    2. MIM cross-references
      Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
    3. PDB cross-references
      Index of Protein Data Bank (PDB) cross-references
    4. SIMILARITY comments
      Index of protein domains and families

    External Data

    Dasty 3