Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.
Protein

DNA replication complex GINS protein PSF3

Gene

GINS3

Organism
Homo sapiens (Human)
Status
Reviewed-Annotation score: Annotation score: 4 out of 5-Experimental evidence at protein leveli

Functioni

The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA.1 Publication

GO - Biological processi

  1. DNA replication Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

DNA replication

Names & Taxonomyi

Protein namesi
Recommended name:
DNA replication complex GINS protein PSF3
Alternative name(s):
GINS complex subunit 3
Gene namesi
Name:GINS3
Synonyms:PSF3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640 Componenti: Chromosome 16

Organism-specific databases

HGNCiHGNC:25851. GINS3.

Subcellular locationi

  1. Nucleus By similarity

GO - Cellular componenti

  1. nucleoplasm Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145008327.

Polymorphism and mutation databases

BioMutaiGINS3.
DMDMi74732939.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 216216DNA replication complex GINS protein PSF3PRO_0000327615Add
BLAST

Proteomic databases

MaxQBiQ9BRX5.
PaxDbiQ9BRX5.
PRIDEiQ9BRX5.

PTM databases

PhosphoSiteiQ9BRX5.

Expressioni

Gene expression databases

BgeeiQ9BRX5.
CleanExiHS_GINS3.
GenevestigatoriQ9BRX5.

Organism-specific databases

HPAiHPA041216.
HPA048209.

Interactioni

Subunit structurei

Component of the GINS complex which is a heterotetramer of GINS1, GINS2, GINS3 and GINS4. Forms a stable subcomplex with GINS2. GINS complex interacts with DNA primase in vitro.5 Publications

Protein-protein interaction databases

BioGridi122295. 29 interactions.
DIPiDIP-29333N.
IntActiQ9BRX5. 1 interaction.
STRINGi9606.ENSP00000401018.

Structurei

Secondary structure

1
216
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi14 – 163Combined sources
Helixi22 – 276Combined sources
Beta strandi30 – 389Combined sources
Beta strandi40 – 423Combined sources
Helixi44 – 463Combined sources
Helixi55 – 573Combined sources
Beta strandi65 – 695Combined sources
Helixi70 – 767Combined sources
Beta strandi79 – 868Combined sources
Helixi90 – 923Combined sources
Helixi94 – 1029Combined sources
Helixi104 – 1063Combined sources
Turni109 – 1113Combined sources
Helixi116 – 1227Combined sources
Helixi123 – 1264Combined sources
Helixi131 – 15323Combined sources
Turni154 – 1574Combined sources
Helixi162 – 1654Combined sources
Helixi170 – 19021Combined sources

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2E9XX-ray2.30C/G1-216[»]
2EHOX-ray3.00D/H/L1-216[»]
2Q9QX-ray2.36D/H2-216[»]
ProteinModelPortaliQ9BRX5.
SMRiQ9BRX5. Positions 2-193.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9BRX5.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 1616Not essential for folding and stability of GINS complex, but may regulate accessibility to the central complex poreAdd
BLAST

Sequence similaritiesi

Belongs to the GINS3/PSF3 family.Curated

Phylogenomic databases

eggNOGiCOG5138.
GeneTreeiENSGT00390000001622.
HOGENOMiHOG000007879.
HOVERGENiHBG057574.
InParanoidiQ9BRX5.
KOiK10734.
OMAiYYYGLGS.
OrthoDBiEOG7HXCS9.
PhylomeDBiQ9BRX5.
TreeFamiTF314626.

Family and domain databases

InterProiIPR021151. GINS_complex.
IPR010492. GINS_Psf3.
[Graphical view]
PANTHERiPTHR22768. PTHR22768. 1 hit.
PfamiPF05916. Sld5. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. AlignAdd to basket

Isoform 1 (identifier: Q9BRX5-1) [UniParc]FASTAAdd to basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEAYFRVES GALGPEENFL SLDDILMSHE KLPVRTETAM PRLGAFFLER
60 70 80 90 100
SAGAETDNAV PQGSKLELPL WLAKGLFDNK RRILSVELPK IYQEGWRTVF
110 120 130 140 150
SADPNVVDLH KMGPHFYGFG SQLLHFDSPE NADISQSLLQ TFIGRFRRIM
160 170 180 190 200
DSSQNAYNED TSALVARLDE MERGLFQTGQ KGLNDFQCWE KGQASQITAS
210
NLVQNYKKRK FTDMED
Length:216
Mass (Da):24,535
Last modified:June 1, 2001 - v1
Checksum:iA1B264A72371C551
GO
Isoform 2 (identifier: Q9BRX5-2) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     62-139: Missing.

Show »
Length:138
Mass (Da):15,655
Checksum:i50D249B01A5F66EE
GO
Isoform 3 (identifier: Q9BRX5-3) [UniParc]FASTAAdd to basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-63: G → GFALLPRLECSGVIWLTAALTSQAPEILPPQPPMWLVLQG

Note: Gene prediction based on EST data.

Show »
Length:255
Mass (Da):28,775
Checksum:i99614F114B6B6CF1
GO

Mass spectrometryi

Molecular mass is 98373±13 Da from positions 1 - 216. Determined by ESI. This is the measured mass for the GINS complex.1 Publication

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei62 – 13978Missing in isoform 2. 2 PublicationsVSP_032737Add
BLAST
Alternative sequencei63 – 631G → GFALLPRLECSGVIWLTAAL TSQAPEILPPQPPMWLVLQG in isoform 3. CuratedVSP_046694

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023974 mRNA. Translation: BAB14747.1.
AK315622 mRNA. Translation: BAG37990.1.
CR457283 mRNA. Translation: CAG33564.1.
AC009107 Genomic DNA. No translation available.
AC009118 Genomic DNA. No translation available.
AC084063 Genomic DNA. No translation available.
CH471092 Genomic DNA. Translation: EAW82973.1.
CH471092 Genomic DNA. Translation: EAW82976.1.
BC005879 mRNA. Translation: AAH05879.1.
BC014437 mRNA. Translation: AAH14437.1.
CCDSiCCDS10796.1. [Q9BRX5-1]
CCDS45498.1. [Q9BRX5-3]
CCDS45499.1. [Q9BRX5-2]
RefSeqiNP_001119601.1. NM_001126129.1. [Q9BRX5-3]
NP_001119602.1. NM_001126130.1. [Q9BRX5-2]
NP_073607.2. NM_022770.3. [Q9BRX5-1]
UniGeneiHs.47125.
Hs.605546.

Genome annotation databases

EnsembliENST00000318129; ENSP00000318196; ENSG00000181938. [Q9BRX5-1]
ENST00000328514; ENSP00000327449; ENSG00000181938. [Q9BRX5-2]
ENST00000426538; ENSP00000401018; ENSG00000181938. [Q9BRX5-3]
GeneIDi64785.
KEGGihsa:64785.
UCSCiuc002enh.4. human. [Q9BRX5-1]
uc002enj.4. human. [Q9BRX5-2]

Polymorphism and mutation databases

BioMutaiGINS3.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBLi
GenBanki
DDBJi
Links Updated
AK023974 mRNA. Translation: BAB14747.1.
AK315622 mRNA. Translation: BAG37990.1.
CR457283 mRNA. Translation: CAG33564.1.
AC009107 Genomic DNA. No translation available.
AC009118 Genomic DNA. No translation available.
AC084063 Genomic DNA. No translation available.
CH471092 Genomic DNA. Translation: EAW82973.1.
CH471092 Genomic DNA. Translation: EAW82976.1.
BC005879 mRNA. Translation: AAH05879.1.
BC014437 mRNA. Translation: AAH14437.1.
CCDSiCCDS10796.1. [Q9BRX5-1]
CCDS45498.1. [Q9BRX5-3]
CCDS45499.1. [Q9BRX5-2]
RefSeqiNP_001119601.1. NM_001126129.1. [Q9BRX5-3]
NP_001119602.1. NM_001126130.1. [Q9BRX5-2]
NP_073607.2. NM_022770.3. [Q9BRX5-1]
UniGeneiHs.47125.
Hs.605546.

3D structure databases

Select the link destinations:
PDBei
RCSB PDBi
PDBji
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2E9XX-ray2.30C/G1-216[»]
2EHOX-ray3.00D/H/L1-216[»]
2Q9QX-ray2.36D/H2-216[»]
ProteinModelPortaliQ9BRX5.
SMRiQ9BRX5. Positions 2-193.
ModBaseiSearch...
MobiDBiSearch...

Protein-protein interaction databases

BioGridi122295. 29 interactions.
DIPiDIP-29333N.
IntActiQ9BRX5. 1 interaction.
STRINGi9606.ENSP00000401018.

PTM databases

PhosphoSiteiQ9BRX5.

Polymorphism and mutation databases

BioMutaiGINS3.
DMDMi74732939.

Proteomic databases

MaxQBiQ9BRX5.
PaxDbiQ9BRX5.
PRIDEiQ9BRX5.

Protocols and materials databases

DNASUi64785.
Structural Biology KnowledgebaseSearch...

Genome annotation databases

EnsembliENST00000318129; ENSP00000318196; ENSG00000181938. [Q9BRX5-1]
ENST00000328514; ENSP00000327449; ENSG00000181938. [Q9BRX5-2]
ENST00000426538; ENSP00000401018; ENSG00000181938. [Q9BRX5-3]
GeneIDi64785.
KEGGihsa:64785.
UCSCiuc002enh.4. human. [Q9BRX5-1]
uc002enj.4. human. [Q9BRX5-2]

Organism-specific databases

CTDi64785.
GeneCardsiGC16P058328.
HGNCiHGNC:25851. GINS3.
HPAiHPA041216.
HPA048209.
MIMi610610. gene.
neXtProtiNX_Q9BRX5.
PharmGKBiPA145008327.
GenAtlasiSearch...

Phylogenomic databases

eggNOGiCOG5138.
GeneTreeiENSGT00390000001622.
HOGENOMiHOG000007879.
HOVERGENiHBG057574.
InParanoidiQ9BRX5.
KOiK10734.
OMAiYYYGLGS.
OrthoDBiEOG7HXCS9.
PhylomeDBiQ9BRX5.
TreeFamiTF314626.

Miscellaneous databases

EvolutionaryTraceiQ9BRX5.
GenomeRNAii64785.
NextBioi66832.
PROiQ9BRX5.
SOURCEiSearch...

Gene expression databases

BgeeiQ9BRX5.
CleanExiHS_GINS3.
GenevestigatoriQ9BRX5.

Family and domain databases

InterProiIPR021151. GINS_complex.
IPR010492. GINS_Psf3.
[Graphical view]
PANTHERiPTHR22768. PTHR22768. 1 hit.
PfamiPF05916. Sld5. 1 hit.
[Graphical view]
ProtoNetiSearch...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
  2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Muscle and Skin.
  6. "The human GINS complex binds to and specifically stimulates human DNA polymerase alpha-primase."
    De Falco M., Ferrari E., De Felice M., Rossi M., Hubscher U., Pisani F.M.
    EMBO Rep. 8:99-103(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBUNIT, INTERACTION WITH DNA PRIMASE.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. Cited for: STRUCTURE BY ELECTRON MICROSCOPY (33 ANGSTROMS) IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT, MASS SPECTROMETRY OF GINS COMPLEX.
  9. "Crystal structure of the human GINS complex."
    Choi J.M., Lim H.S., Kim J.J., Song O.K., Cho Y.
    Genes Dev. 21:1316-1321(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT.
  10. "Structure of the human GINS complex and its assembly and functional interface in replication initiation."
    Kamada K., Kubota Y., Arata T., Shindo Y., Hanaoka F.
    Nat. Struct. Mol. Biol. 14:388-396(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT.
  11. "Crystal structure of the GINS complex and functional insights into its role in DNA replication."
    Chang Y.P., Wang G., Bermudez V., Hurwitz J., Chen X.S.
    Proc. Natl. Acad. Sci. U.S.A. 104:12685-12690(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.36 ANGSTROMS) OF 2-216 IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT, REGION.

Entry informationi

Entry nameiPSF3_HUMAN
AccessioniPrimary (citable) accession number: Q9BRX5
Secondary accession number(s): B2RDP3, E9PB21, Q9H870
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: June 1, 2001
Last modified: April 29, 2015
This is version 108 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3

Similar proteinsi

Links to similar proteins from the UniProt Reference Clusters (UniRef) at 100%, 90% and 50% sequence identity:
100%UniRef100 combines identical sequences and sub-fragments with 11 or more residues from any organism into Uniref entry.
90%UniRef90 is built by clustering UniRef100 sequences that have at least 90% sequence identity to, and 80% overlap with, the longest sequence (a.k.a seed sequence).
50%UniRef50 is built by clustering UniRef90 seed sequences that have at least 50% sequence identity to, and 80% overlap with, the longest sequence in the cluster.