Skip Header

You are using a version of browser that may not display all the features of this website. Please consider upgrading your browser.

Q9BRX5

- PSF3_HUMAN

UniProt

Q9BRX5 - PSF3_HUMAN

(max 400 entries)x

Your basket is currently empty.

Select item(s) and click on "Add to basket" to create your own collection here
(400 entries max)

Protein

DNA replication complex GINS protein PSF3

Gene

GINS3

Organism
Homo sapiens (Human)
Status
Reviewed - Annotation score: 4 out of 5- Experimental evidence at protein leveli

Functioni

The GINS complex plays an essential role in the initiation of DNA replication, and progression of DNA replication forks. GINS complex seems to bind preferentially to single-stranded DNA.1 Publication

GO - Biological processi

  1. DNA replication Source: UniProtKB-KW
Complete GO annotation...

Keywords - Biological processi

DNA replication

Names & Taxonomyi

Protein namesi
Recommended name:
DNA replication complex GINS protein PSF3
Alternative name(s):
GINS complex subunit 3
Gene namesi
Name:GINS3
Synonyms:PSF3
OrganismiHomo sapiens (Human)
Taxonomic identifieri9606 [NCBI]
Taxonomic lineageiEukaryotaMetazoaChordataCraniataVertebrataEuteleostomiMammaliaEutheriaEuarchontogliresPrimatesHaplorrhiniCatarrhiniHominidaeHomo
ProteomesiUP000005640: Chromosome 16

Organism-specific databases

HGNCiHGNC:25851. GINS3.

Subcellular locationi

Nucleus By similarity

GO - Cellular componenti

  1. nucleus Source: HPA
Complete GO annotation...

Keywords - Cellular componenti

Nucleus

Pathology & Biotechi

Organism-specific databases

PharmGKBiPA145008327.

PTM / Processingi

Molecule processing

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Chaini1 – 216216DNA replication complex GINS protein PSF3PRO_0000327615Add
BLAST

Proteomic databases

MaxQBiQ9BRX5.
PaxDbiQ9BRX5.
PRIDEiQ9BRX5.

PTM databases

PhosphoSiteiQ9BRX5.

Expressioni

Gene expression databases

BgeeiQ9BRX5.
CleanExiHS_GINS3.
GenevestigatoriQ9BRX5.

Organism-specific databases

HPAiHPA041216.
HPA048209.

Interactioni

Subunit structurei

Component of the GINS complex which is a heterotetramer of GINS1, GINS2, GINS3 and GINS4. Forms a stable subcomplex with GINS2. GINS complex interacts with DNA primase in vitro.5 Publications

Protein-protein interaction databases

BioGridi122295. 29 interactions.
DIPiDIP-29333N.
IntActiQ9BRX5. 1 interaction.
STRINGi9606.ENSP00000401018.

Structurei

Secondary structure

1
216
Legend: HelixTurnBeta strand
Show more details
Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Beta strandi14 – 163
Helixi22 – 276
Beta strandi30 – 389
Beta strandi40 – 423
Helixi44 – 463
Helixi55 – 573
Beta strandi65 – 695
Helixi70 – 767
Beta strandi79 – 868
Helixi90 – 923
Helixi94 – 1029
Helixi104 – 1063
Turni109 – 1113
Helixi116 – 1227
Helixi123 – 1264
Helixi131 – 15323
Turni154 – 1574
Helixi162 – 1654
Helixi170 – 19021

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
EntryMethodResolution (Å)ChainPositionsPDBsum
2E9XX-ray2.30C/G1-216[»]
2EHOX-ray3.00D/H/L1-216[»]
2Q9QX-ray2.36D/H2-216[»]
ProteinModelPortaliQ9BRX5.
SMRiQ9BRX5. Positions 2-193.
ModBaseiSearch...
MobiDBiSearch...

Miscellaneous databases

EvolutionaryTraceiQ9BRX5.

Family & Domainsi

Region

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Regioni1 – 1616Not essential for folding and stability of GINS complex, but may regulate accessibility to the central complex poreAdd
BLAST

Sequence similaritiesi

Belongs to the GINS3/PSF3 family.Curated

Phylogenomic databases

eggNOGiCOG5138.
GeneTreeiENSGT00390000001622.
HOGENOMiHOG000007879.
HOVERGENiHBG057574.
InParanoidiQ9BRX5.
KOiK10734.
OMAiQQGWRTV.
OrthoDBiEOG7HXCS9.
PhylomeDBiQ9BRX5.
TreeFamiTF314626.

Family and domain databases

InterProiIPR021151. GINS_complex.
IPR010492. GINS_Psf3.
[Graphical view]
PANTHERiPTHR22768. PTHR22768. 1 hit.
PfamiPF05916. Sld5. 1 hit.
[Graphical view]

Sequences (3)i

Sequence statusi: Complete.

This entry describes 3 isoformsi produced by alternative splicing. Align

Isoform 1 (identifier: Q9BRX5-1) [UniParc]FASTAAdd to Basket

This isoform has been chosen as the 'canonical' sequence. All positional information in this entry refers to it. This is also the sequence that appears in the downloadable versions of the entry.

« Hide

        10         20         30         40         50
MSEAYFRVES GALGPEENFL SLDDILMSHE KLPVRTETAM PRLGAFFLER
60 70 80 90 100
SAGAETDNAV PQGSKLELPL WLAKGLFDNK RRILSVELPK IYQEGWRTVF
110 120 130 140 150
SADPNVVDLH KMGPHFYGFG SQLLHFDSPE NADISQSLLQ TFIGRFRRIM
160 170 180 190 200
DSSQNAYNED TSALVARLDE MERGLFQTGQ KGLNDFQCWE KGQASQITAS
210
NLVQNYKKRK FTDMED
Length:216
Mass (Da):24,535
Last modified:June 1, 2001 - v1
Checksum:iA1B264A72371C551
GO
Isoform 2 (identifier: Q9BRX5-2) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     62-139: Missing.

Show »
Length:138
Mass (Da):15,655
Checksum:i50D249B01A5F66EE
GO
Isoform 3 (identifier: Q9BRX5-3) [UniParc]FASTAAdd to Basket

The sequence of this isoform differs from the canonical sequence as follows:
     63-63: G → GFALLPRLECSGVIWLTAALTSQAPEILPPQPPMWLVLQG

Note: Gene prediction based on EST data.

Show »
Length:255
Mass (Da):28,775
Checksum:i99614F114B6B6CF1
GO

Mass spectrometryi

Molecular mass is 98373±13 Da from positions 1 - 216. Determined by ESI. This is the measured mass for the GINS complex.1 Publication

Alternative sequence

Feature keyPosition(s)LengthDescriptionGraphical viewFeature identifierActions
Alternative sequencei62 – 13978Missing in isoform 2. 2 PublicationsVSP_032737Add
BLAST
Alternative sequencei63 – 631G → GFALLPRLECSGVIWLTAAL TSQAPEILPPQPPMWLVLQG in isoform 3. CuratedVSP_046694

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK023974 mRNA. Translation: BAB14747.1.
AK315622 mRNA. Translation: BAG37990.1.
CR457283 mRNA. Translation: CAG33564.1.
AC009107 Genomic DNA. No translation available.
AC009118 Genomic DNA. No translation available.
AC084063 Genomic DNA. No translation available.
CH471092 Genomic DNA. Translation: EAW82973.1.
CH471092 Genomic DNA. Translation: EAW82976.1.
BC005879 mRNA. Translation: AAH05879.1.
BC014437 mRNA. Translation: AAH14437.1.
CCDSiCCDS10796.1. [Q9BRX5-1]
CCDS45498.1. [Q9BRX5-3]
CCDS45499.1. [Q9BRX5-2]
RefSeqiNP_001119601.1. NM_001126129.1. [Q9BRX5-3]
NP_001119602.1. NM_001126130.1. [Q9BRX5-2]
NP_073607.2. NM_022770.3. [Q9BRX5-1]
UniGeneiHs.47125.
Hs.605546.

Genome annotation databases

EnsembliENST00000318129; ENSP00000318196; ENSG00000181938. [Q9BRX5-1]
ENST00000328514; ENSP00000327449; ENSG00000181938. [Q9BRX5-2]
ENST00000426538; ENSP00000401018; ENSG00000181938. [Q9BRX5-3]
GeneIDi64785.
KEGGihsa:64785.
UCSCiuc002enh.4. human. [Q9BRX5-1]
uc002enj.4. human. [Q9BRX5-2]

Polymorphism databases

DMDMi74732939.

Keywords - Coding sequence diversityi

Alternative splicing

Cross-referencesi

Sequence databases

Select the link destinations:
EMBL
GenBank
DDBJ
Links Updated
AK023974 mRNA. Translation: BAB14747.1 .
AK315622 mRNA. Translation: BAG37990.1 .
CR457283 mRNA. Translation: CAG33564.1 .
AC009107 Genomic DNA. No translation available.
AC009118 Genomic DNA. No translation available.
AC084063 Genomic DNA. No translation available.
CH471092 Genomic DNA. Translation: EAW82973.1 .
CH471092 Genomic DNA. Translation: EAW82976.1 .
BC005879 mRNA. Translation: AAH05879.1 .
BC014437 mRNA. Translation: AAH14437.1 .
CCDSi CCDS10796.1. [Q9BRX5-1 ]
CCDS45498.1. [Q9BRX5-3 ]
CCDS45499.1. [Q9BRX5-2 ]
RefSeqi NP_001119601.1. NM_001126129.1. [Q9BRX5-3 ]
NP_001119602.1. NM_001126130.1. [Q9BRX5-2 ]
NP_073607.2. NM_022770.3. [Q9BRX5-1 ]
UniGenei Hs.47125.
Hs.605546.

3D structure databases

Select the link destinations:
PDBe
RCSB PDB
PDBj
Links Updated
Entry Method Resolution (Å) Chain Positions PDBsum
2E9X X-ray 2.30 C/G 1-216 [» ]
2EHO X-ray 3.00 D/H/L 1-216 [» ]
2Q9Q X-ray 2.36 D/H 2-216 [» ]
ProteinModelPortali Q9BRX5.
SMRi Q9BRX5. Positions 2-193.
ModBasei Search...
MobiDBi Search...

Protein-protein interaction databases

BioGridi 122295. 29 interactions.
DIPi DIP-29333N.
IntActi Q9BRX5. 1 interaction.
STRINGi 9606.ENSP00000401018.

PTM databases

PhosphoSitei Q9BRX5.

Polymorphism databases

DMDMi 74732939.

Proteomic databases

MaxQBi Q9BRX5.
PaxDbi Q9BRX5.
PRIDEi Q9BRX5.

Protocols and materials databases

DNASUi 64785.
Structural Biology Knowledgebase Search...

Genome annotation databases

Ensembli ENST00000318129 ; ENSP00000318196 ; ENSG00000181938 . [Q9BRX5-1 ]
ENST00000328514 ; ENSP00000327449 ; ENSG00000181938 . [Q9BRX5-2 ]
ENST00000426538 ; ENSP00000401018 ; ENSG00000181938 . [Q9BRX5-3 ]
GeneIDi 64785.
KEGGi hsa:64785.
UCSCi uc002enh.4. human. [Q9BRX5-1 ]
uc002enj.4. human. [Q9BRX5-2 ]

Organism-specific databases

CTDi 64785.
GeneCardsi GC16P058328.
HGNCi HGNC:25851. GINS3.
HPAi HPA041216.
HPA048209.
MIMi 610610. gene.
neXtProti NX_Q9BRX5.
PharmGKBi PA145008327.
GenAtlasi Search...

Phylogenomic databases

eggNOGi COG5138.
GeneTreei ENSGT00390000001622.
HOGENOMi HOG000007879.
HOVERGENi HBG057574.
InParanoidi Q9BRX5.
KOi K10734.
OMAi QQGWRTV.
OrthoDBi EOG7HXCS9.
PhylomeDBi Q9BRX5.
TreeFami TF314626.

Miscellaneous databases

EvolutionaryTracei Q9BRX5.
GenomeRNAii 64785.
NextBioi 66832.
PROi Q9BRX5.
SOURCEi Search...

Gene expression databases

Bgeei Q9BRX5.
CleanExi HS_GINS3.
Genevestigatori Q9BRX5.

Family and domain databases

InterProi IPR021151. GINS_complex.
IPR010492. GINS_Psf3.
[Graphical view ]
PANTHERi PTHR22768. PTHR22768. 1 hit.
Pfami PF05916. Sld5. 1 hit.
[Graphical view ]
ProtoNeti Search...

Publicationsi

« Hide 'large scale' publications
  1. "Complete sequencing and characterization of 21,243 full-length human cDNAs."
    Ota T., Suzuki Y., Nishikawa T., Otsuki T., Sugiyama T., Irie R., Wakamatsu A., Hayashi K., Sato H., Nagai K., Kimura K., Makita H., Sekine M., Obayashi M., Nishi T., Shibahara T., Tanaka T., Ishii S.
    , Yamamoto J., Saito K., Kawai Y., Isono Y., Nakamura Y., Nagahari K., Murakami K., Yasuda T., Iwayanagi T., Wagatsuma M., Shiratori A., Sudo H., Hosoiri T., Kaku Y., Kodaira H., Kondo H., Sugawara M., Takahashi M., Kanda K., Yokoi T., Furuya T., Kikkawa E., Omura Y., Abe K., Kamihara K., Katsuta N., Sato K., Tanikawa M., Yamazaki M., Ninomiya K., Ishibashi T., Yamashita H., Murakawa K., Fujimori K., Tanai H., Kimata M., Watanabe M., Hiraoka S., Chiba Y., Ishida S., Ono Y., Takiguchi S., Watanabe S., Yosida M., Hotuta T., Kusano J., Kanehori K., Takahashi-Fujii A., Hara H., Tanase T.-O., Nomura Y., Togiya S., Komai F., Hara R., Takeuchi K., Arita M., Imose N., Musashino K., Yuuki H., Oshima A., Sasaki N., Aotsuka S., Yoshikawa Y., Matsunawa H., Ichihara T., Shiohata N., Sano S., Moriya S., Momiyama H., Satoh N., Takami S., Terashima Y., Suzuki O., Nakagawa S., Senoh A., Mizoguchi H., Goto Y., Shimizu F., Wakebe H., Hishigaki H., Watanabe T., Sugiyama A., Takemoto M., Kawakami B., Yamazaki M., Watanabe K., Kumagai A., Itakura S., Fukuzumi Y., Fujimori Y., Komiyama M., Tashiro H., Tanigami A., Fujiwara T., Ono T., Yamada K., Fujii Y., Ozaki K., Hirao M., Ohmori Y., Kawabata A., Hikiji T., Kobatake N., Inagaki H., Ikema Y., Okamoto S., Okitani R., Kawakami T., Noguchi S., Itoh T., Shigeta K., Senba T., Matsumura K., Nakajima Y., Mizuno T., Morinaga M., Sasaki M., Togashi T., Oyama M., Hata H., Watanabe M., Komatsu T., Mizushima-Sugano J., Satoh T., Shirai Y., Takahashi Y., Nakagawa K., Okumura K., Nagase T., Nomura N., Kikuchi H., Masuho Y., Yamashita R., Nakai K., Yada T., Nakamura Y., Ohara O., Isogai T., Sugano S.
    Nat. Genet. 36:40-45(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORMS 1 AND 2).
  2. "Cloning of human full open reading frames in Gateway(TM) system entry vector (pDONR201)."
    Ebert L., Schick M., Neubert P., Schatten R., Henze S., Korn B.
    Submitted (JUN-2004) to the EMBL/GenBank/DDBJ databases
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 2).
  3. "The sequence and analysis of duplication-rich human chromosome 16."
    Martin J., Han C., Gordon L.A., Terry A., Prabhakar S., She X., Xie G., Hellsten U., Chan Y.M., Altherr M., Couronne O., Aerts A., Bajorek E., Black S., Blumer H., Branscomb E., Brown N.C., Bruno W.J.
    , Buckingham J.M., Callen D.F., Campbell C.S., Campbell M.L., Campbell E.W., Caoile C., Challacombe J.F., Chasteen L.A., Chertkov O., Chi H.C., Christensen M., Clark L.M., Cohn J.D., Denys M., Detter J.C., Dickson M., Dimitrijevic-Bussod M., Escobar J., Fawcett J.J., Flowers D., Fotopulos D., Glavina T., Gomez M., Gonzales E., Goodstein D., Goodwin L.A., Grady D.L., Grigoriev I., Groza M., Hammon N., Hawkins T., Haydu L., Hildebrand C.E., Huang W., Israni S., Jett J., Jewett P.B., Kadner K., Kimball H., Kobayashi A., Krawczyk M.-C., Leyba T., Longmire J.L., Lopez F., Lou Y., Lowry S., Ludeman T., Manohar C.F., Mark G.A., McMurray K.L., Meincke L.J., Morgan J., Moyzis R.K., Mundt M.O., Munk A.C., Nandkeshwar R.D., Pitluck S., Pollard M., Predki P., Parson-Quintana B., Ramirez L., Rash S., Retterer J., Ricke D.O., Robinson D.L., Rodriguez A., Salamov A., Saunders E.H., Scott D., Shough T., Stallings R.L., Stalvey M., Sutherland R.D., Tapia R., Tesmer J.G., Thayer N., Thompson L.S., Tice H., Torney D.C., Tran-Gyamfi M., Tsai M., Ulanovsky L.E., Ustaszewska A., Vo N., White P.S., Williams A.L., Wills P.L., Wu J.-R., Wu K., Yang J., DeJong P., Bruce D., Doggett N.A., Deaven L., Schmutz J., Grimwood J., Richardson P., Rokhsar D.S., Eichler E.E., Gilna P., Lucas S.M., Myers R.M., Rubin E.M., Pennacchio L.A.
    Nature 432:988-994(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  4. Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE GENOMIC DNA].
  5. "The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC)."
    The MGC Project Team
    Genome Res. 14:2121-2127(2004) [PubMed] [Europe PMC] [Abstract]
    Cited for: NUCLEOTIDE SEQUENCE [LARGE SCALE MRNA] (ISOFORM 1).
    Tissue: Muscle and Skin.
  6. "The human GINS complex binds to and specifically stimulates human DNA polymerase alpha-primase."
    De Falco M., Ferrari E., De Felice M., Rossi M., Hubscher U., Pisani F.M.
    EMBO Rep. 8:99-103(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: SUBUNIT, INTERACTION WITH DNA PRIMASE.
  7. Cited for: IDENTIFICATION BY MASS SPECTROMETRY [LARGE SCALE ANALYSIS].
  8. Cited for: STRUCTURE BY ELECTRON MICROSCOPY (33 ANGSTROMS) IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT, MASS SPECTROMETRY OF GINS COMPLEX.
  9. "Crystal structure of the human GINS complex."
    Choi J.M., Lim H.S., Kim J.J., Song O.K., Cho Y.
    Genes Dev. 21:1316-1321(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (3.0 ANGSTROMS) IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT.
  10. "Structure of the human GINS complex and its assembly and functional interface in replication initiation."
    Kamada K., Kubota Y., Arata T., Shindo Y., Hanaoka F.
    Nat. Struct. Mol. Biol. 14:388-396(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: FUNCTION, X-RAY CRYSTALLOGRAPHY (2.3 ANGSTROMS) IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT.
  11. "Crystal structure of the GINS complex and functional insights into its role in DNA replication."
    Chang Y.P., Wang G., Bermudez V., Hurwitz J., Chen X.S.
    Proc. Natl. Acad. Sci. U.S.A. 104:12685-12690(2007) [PubMed] [Europe PMC] [Abstract]
    Cited for: X-RAY CRYSTALLOGRAPHY (2.36 ANGSTROMS) OF 2-216 IN COMPLEX WITH GINS1; GINS2 AND GINS4, SUBUNIT, REGION.

Entry informationi

Entry nameiPSF3_HUMAN
AccessioniPrimary (citable) accession number: Q9BRX5
Secondary accession number(s): B2RDP3, E9PB21, Q9H870
Entry historyi
Integrated into UniProtKB/Swiss-Prot: April 8, 2008
Last sequence update: June 1, 2001
Last modified: October 29, 2014
This is version 104 of the entry and version 1 of the sequence. [Complete history]
Entry statusiReviewed (UniProtKB/Swiss-Prot)
Annotation programChordata Protein Annotation Program
DisclaimerAny medical or genetic information present in this entry is provided for research, educational and informational purposes only. It is not in any way intended to be used as a substitute for professional medical advice, diagnosis, treatment or care.

Miscellaneousi

Keywords - Technical termi

3D-structure, Complete proteome, Reference proteome

Documents

  1. Human chromosome 16
    Human chromosome 16: entries, gene names and cross-references to MIM
  2. MIM cross-references
    Online Mendelian Inheritance in Man (MIM) cross-references in UniProtKB/Swiss-Prot
  3. PDB cross-references
    Index of Protein Data Bank (PDB) cross-references
  4. SIMILARITY comments
    Index of protein domains and families

External Data

Dasty 3